"Hiçbir şeye ihtiyacımız yok, yalnız bir şeye ihtiyacımız vardır; çalışkan olmak!" M.Kemal Atatürk
22 Eylül 2020 Salı

Tüm Duyurular

Dijital Tarım Pazarı (DİTAP)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda; Tarım ve Orman Bakanlığı nın yazısına atfen; 3. Tarım Orman Şurası nda alınan kararlar neticesinde Dijital Tarım Pazarı (DİTAP) kurulduğu bildirilmektedir. Sistemin tecrübe edilebilmesi adına oluşturulan test ortamına ait kullanıcı adları ve şifreler aşağıda paylaşılmaktadır. Test Ortamı Web Adresi:https://test-ditap.tarbil.gov.tr/login Üretici Kullanıcı Adı: ciftci Üretici Şifre: 1234 Alıcı Kullanıcı Adı: tarimas Alıcı Şifre: 1234 Sistemin yayında olan haline isewww.ditap.gov.tradresinden ulaşılabilmektedir. Detaylı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2021 Yılı Taslak Buğday Alım Baremi
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, TMO koordinatörlüğünde, Bakanlığımızın ilgili birimleri, Ankara Tohumculuk Tescil ve Sertifikasyon Merkezi Müdürlüğü, Ticaret Borsaları, TSÜAB, TSE, TKKMB, UHK, OAİB, TİGEM, TUSAF, TZOB, PANKOBİRLİK, Bahri Dağdaş ve Tarla Bitkileri Merkez Araştırma Enstitüleri temsilcilerinin de yer aldığı geniş katılımlı “TMO Barem Değerlendirme Toplantısı” 15 Eylül 2020 tarihinde video konferans yöntemi ile gerçekleştirilmiştir. Toplantıda; tescili yapılmış olan buğday çeşitlerinin kalite performansları incelenerek 2021 yılında uygulanacak Taslak Buğday Alım Baremi değerlendirilmiş olup web sitemizde yayınlanmıştır, bilgisi yer almaktadır. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Meybem A.Ş. İlave Yetki Alınan Yeterllikler Hakkında
Sayın Üyemiz, TOBB un girişimleriyle tehlikeli ve çok tehlikeli meslekler başta olmak üzere mesleki yeterlilik sınav ve belgelendirme hizmeti vermek üzere kurulan TOBB MEYBEM Mesleki Yeterlilik ve Belgelendirme Merkezleri, 81 il ve 160 ilçede bulunan Oda ve Borsalarımız işbirliğiyle faaliyetlerine devam etmektedir. Bugüne kadar 80 binden fazla adayın sınav ve belgelendirme hizmetlerini yürüten MEYBEM, Oda ve Borsalarımızın talep ve önerileri doğrultusunda kapsamını her geçen gün genişletmektedir. Bu kapsamda MEYBEM, Oda ve Borsalarımız tarafından talep edilen "plastik", "otomotiv", "elektrik", "makine" ve "haddecilik" sektörlerinde ekte detayları yer alan 13 yeni meslekte daha yetkilendirme ve akreditasyon sürecini tamamlamış olup, sınav ve belgelendirme hizmetlerine Eylül 2020 itibariyle başlamıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2020/22 Sayılı Atık İthalatı Genelgesi
Sayın Üyemiz, İlgi : 04.09.2020 tarihli, 186502 sayılı ve 2020/22 Sayılı Atık İthalatı Genelgesi konulu yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Çevre ve Şehircilik Bakanlığı tarafından Birliğimize iletilen ilgide kayıtlı yazıda; Çevrenin Korunması Yönünden Kontrol Altında Tutulan Atıkların İthalat Denetimi Tebliği (Ürün Güvenliği ve Denetimi 2020/3) çerçevesinde 31.12.2019 tarihinde yayımlanarak yürürlüğe giren Atık İthalatı Uygulamalarının düzenlendiği 2019/18 sayılı Genelge nin yürürlükten kaldırılarak, ekte yer alan 03.09.2020 tarih ve 2020/22 sayılı Genelge nin yürürlüğe girdiği bildirilmektedir. İlgi yazıda; 2019/18 sayılı Genelgeyi yürürlükten kaldıran 2020/22 sayılı yeni Genelge ile atık ithalatı kotasının %30 azaltılarak, %50 ye indirildiği belirtilmiş ve Genelgenin yürürlüğe girdiği tarih olan 03.09.2020 tarihi itibariyle, 2020 yılı sonuna kadar firmaların Kapasite Raporunda belirtilen tesis tüketim kapasitesinin azami %50 si oranında atık ithalatına müsaade edileceği ifade edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşyeri Açma ve Çalışma Ruhsatlarına İlişkin Yönetmelikte Değişiklik Yapılmasına Dair Yönetmelik
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,9 Eylül 2020 Çarşamba tarihli Resmi Gazete ile "İşyeri Açma ve Çalışma Ruhsatlarına İlişkin Yönetmelikte Değişiklik Yapılmasına Dair Yönetmelik" (Karar Sayısı: 2945) yayımlanarak yürürlüğe girmiştir. Yeni yönetmelik ile uyum süreci kapsamında "bu maddenin yürürlüğe girdiği tarihten itibaren üç ay içinde" ibaresi "31/7/2021 tarihine kadar" şeklinde değiştirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COVID-19 Krizi Üzerine Özel Sektör ile Sanal Toplantı
Sayın Üyemiz, İlgi : Kültür ve Turizm Bakanlığı’nın 10.09.2020 tarih ve 669030 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Ekonomik İşbirliği ve Kalkınma Örgütü nden (OECD) alınarak bir örneği ekte sunulan e-postaya atıfla, 29 Eylül 2020 tarihinde (Paris saatiyle 12:00-13:30 arasında) "zoom" platformu üzerinden "COVID-19 Krizi Üzerine Özel Sektör ile OECD Turizm Politikası Diyaloğu" adlı etkinliğinin gerçekleştirileceği duyurulmaktadır. Anılan yazıda devamla, OECD Turizm Komitesi ve Turizm İstatistikleri Çalışma Grubu üyelerinin, bahsi geçen COVID-19 pandemisinin turizme etkilerinin azaltılmasını ve toparlanmayı hazırlayacak politik tedbirlere ilişkin sanal toplantıya, özel sektör temsilcileriyle birlikte katılmaya davet edildiğinin ifade edildiği belirtilmektedir. Söz konusu toplantının amacının, COVID-19 un etkileri üzerine, turizm işletmelerinin ihtiyaçları, öncelikli eylem alanları ve potansiyel politik çözümler konusunda sektör temsilcileriyle fikir alışverişinde bulunmak için bir platform sağlamak olduğu ifade edilmektedir. Taslak gündemi ekte sunulan ve İngilizce dilinde düzenlenecek olan toplantıya: https://meetoecd1.zoom.us/meeting/register/tJEvceiqqjkqHdN1xcwN7iHHdY-CvvJmJdrv bağlantısı üzerinden "Ülke – Ad Soyad" belirtmek suretiyle kayıt yapılması gerektiği vurgulanmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ceylanpınar Tarım İşletmesi Müdürülüğü ne Ait Pazarlık Usulü Mahsul Buğday Ve Mercimek Satışı
Sayın Üyemiz, 24.09.2020 günü saat 10.00 da Şanlıurfa Ticaret Borsasında işletmemize ait 2019-2020 yılı istihsali 6.891 ton mahsul buğday ve 2.055 ton temiz ve çepelli mercimeklerin açık artırma usulüpazarlıkile satış ihalesi yapılacaktır. ihale ile ilgili evraklar www.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çerezlik ve Yağlık Ayçiçeği Kriterleri
Sayın Üyemiz, Ticaret Bakanlığı İç Ticaret Genel Müdürlüğünden Borsamıza gönderilen yazıda, 5300 sayılı Tarım Ürünleri Lisanslı Depoculuk Kanunu ve bu Kanuna dayanılarakçıkarılan Yetkili Sınıflandırıcıların Lisans Alma, Faaliyet ve Denetimine İlişkin Yönetmeliğin18 nci maddesi kapsamında lisanslı depolarda depolanan ürünler, yetkili sınıflandırıcılartarafından TSE standartlarına veya Bakanlığımızca belirlenen standartlara göre analiz edilereksınıflandırılmakta olup lisanslı depo işletmelerinde depolanacak ayçiçeği ürünününsınıflandırılmasında uygulanacak kalite kriterleri 22/08/2019 tarihinde onaylanarak ilanedilmiştir. Bu kapsamda, yağlık ayçiçeği ürününe ilişkin kalite kriterlerinde değişiklik öngörenkriterler ile çerezlik ayçiçeği ürününe ilişkin kalite kriterleri, 21/08/2020 tarihli ve 56791275sayılı Bakanlığımız onayı ile ekteki şekilde yürürlüğe konulmuştur, bilgisi yer almaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
SDG Business Forum
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 10.09.2020 tarihli ve 69363697-724.01.01 sayılı yazısı. Ticaret Bakanlığı nın ilgide kayıtlı yazısı ile, Dışişleri Bakanlığı ndan alınan bir yazıya atfen, BM 75. Genel Kurulu yüksek düzeyli haftası kapsamında, Uluslararası Ticaret Odası (ICC), BM Ekonomik ve Sosyal İşler Bölümü (DESA) ve BM Küresel İlkeler Sözleşmesi (UN Global Compact) ev sahipliğinde 23 Eylül 2020 tarihinde saat 07.00-14.00 saatleri arasında "Sürdürülebilir Kalkınma Hedefleri İş Forumu (SDG Business Forum)" başlıklı toplantının sanal ortamda düzenleneceği bildirilmektedir. Yazıda devamla, özel sektörün mevcut ekonomik sorunların çözümünde ve sürdürülebilir bir gelecek için kalıcı çözümlerin oluşturulmasındaki rolüne odaklanacak bahse konu forumun, esasen 21-22 Eylül 2020 tarihlerinde düzenlenecek Özel Sektör Forumu ve Küresel Etki Forumu nun devamı niteliğinde olduğu, anılan etkinliğe https://www.sdgbusinessforum.org adresinden kayıt yapılabileceği belirtilmektedir. SDG Business Forum programına https://www.sdgbusinessforum.org/uploads/1/9/6/4/19640823/concept_note_- _sdg_business_forum_2020_-_15_september_am.pdf adresinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOBİ Ar-Ge Destekleri Semineri (internet üzerinden)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,TÜBİTAK tarafından KOBİ lere yönelik olarak verilen Ar-Ge destek ve hibeleri hakkında 01 Ekim 2020 Perşembe günü saat 14:00 te internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin duyuru metni ekte sunulmaktadır. Birliğimiz organizasyonunda ve TÜBİTAK işbirliğinde gerçekleştirilecek olan seminerde; Sanayi Ar-Ge Projeleri Destekleri, Üniversite-Sanayi İş Birliği Desteği, KOBİ Ar-Ge Başlangıç Desteği, Uluslararası Sanayi Ar-Ge Projeleri Desteği, Öncelikli Alanlar Araştırma Teknoloji Geliştirme ve Yenilik Projeleri Desteği, Teknogirişim Sermayesi Destek Programı, Yenilik Girişimcilik Alanlarında Kapasite Artırılmasına Yönelik Destek Programı ve Siparişe Dayalı Ar-Ge Projeleri için KOBİ Destekleme Çağrısı başlıkları anlatılacak olup, seminer sonunda KOBİ lerin soruları cevaplandırılacaktır. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirleri ile Elektronik Sohbetler - Singapur ve Japonya
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 16.09.2020 tarih ve 57433898 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ticaret Bakanlığından alınan ilgide kayıtlı yazıda, 22 Eylül 2020 Salı günü 10:00-11:30 saatleri arasında Singapur da görev yapmakta olan Ticaret Bakanlığı temsilcileri, 24 Eylül 2020 Perşembe günü 10:00-11:30 saatlerinde ise Japonya da görev yapmakta olan Ticaret temsilcileri ve bu ülkelerde iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşılacağı e-sohbet toplantılarının gerçekleştirileceği bildirilmektedir. Toplantıların programı ve toplantıya katılmak için gerekli linkler ekte sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-Katar İş Forumu
Sayın Üyemiz, Birliğimiz ve Katar Ticaret ve Sanayi Odası işbirliğinde; gıda ve tarım ürünleri, ev kimyasalları, tıbbi ekipmanlar, tekstil ürünleri, inşaat ve inşaat malzemeleri, mobilya, bilişim teknolojileri ve kimyasal endüstri sektörlerinde faaliyet gösteren Katarlı firmaların katılımlarıyla 29 Eylül 2020 Salı günü saat 11:00 da Zoom uygulaması üzerinden Türkiye-Katar İş Forumu gerçekleştirilecektir. Bahse konu İş Forumu nun ilk oturumunda açılış konuşmalarının ardından, Türkiye ve Katar ın ilgili Bakanlıkları, kuruluşları ve Büyükelçilikleri tarafından anılan ülkelerdeki iş imkânları konusunda sunumlar yer alacak olup bu bölümde Arapça-Türkçe ve İngilizce-Türkçe simultane tercüme hizmeti sağlanacaktır. İş Forumu kapsamında gerçekleşecek ikinci oturumda ise Türk ve Katarlı firmalar arasında, her iki taraftan gerekli talep olması halinde, belirtilen sektörlerde paralel ikili görüşmeler düzenlenecektir. Bahse konu görüşmelerin eş zamanlı olarak gerçekleştirilecek olması sebebiyle aynı anda sadece bir sektörel görüşme takip edilebilecektir. Bu kapsamda, birden fazla sektörde faaliyet gösterip, bu doğrultuda birkaç farklı görüşmeye katılmak isteyen firmaların her sektörel görüşmeye farklı bir personelinin kayıt olması ve görüşmeyi takip etmesi gerekecektir. Söz konusu İş Forumu na katılmak isteyen firmalarımızın kayıtlarını (İngilizce olarak) katar.tobb.org.tr adresinden en geç 23 Eylül 2020 Çarşamba günü mesai bitimine kadar tamamlamaları gerekmektedir. İş Forumu na katılacak Katarlı şirketlerin profili, katılımcı listesi ve toplantı için teknik ayrıntılar, katılım teyidini bildiren firmalarımızla bilahare paylaşılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirleri ile Elektronik Sohbetler - Avustralya
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 14.09.2020 tarih ve 57370600 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ticaret Bakanlığından alınan ilgide kayıtlı yazıda, Avustralya da görev yapmakta olan Ticaret Bakanlığı temsilcileri ile Avustralya da iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşılacağı "Melburn ve Sidney Temsilcilerimiz İş Dünyamızla Buluşuyor" isimli elektronik sohbet toplantısının 17 Eylül 2020 Perşembe günü 10.00-11.30 saatleri arasında gerçekleştirileceği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Dijital Pazarlama Webinarı Daveti
Sayın Üyemiz, SanayiveTeknolojiBakanlığıKalkınmaAjanslarıGenelMüdürlüğüveFacebookişbirliğindeyereldedijital pazarlamaalanındakurumsalkapasiteninartırılmasıamacıylaOnlineWebinarProgramıserisidüzenlenecektir. Bukapsamda,temelhedefkitlesiolarakbelirlenenkamu,özelsektörvesiviltoplumkuruluşlarınınFacebook veInstagramüzerindendahafazlakişiyeetkilibirşekildeulaşabilmeleriamacıile30EylülÇarşambagünü14:00- 16:00saatleriarasında"Facebook-DijitalPazarlamaWebinarı"gerçekleştirilecektir. ProgramdaFacebookveInstagramReklamlarıEğitimiverilecekolup,farklıreklamtürleri,hedefkitleseçimi, bütçevezamanlama,reklamalanları,doğrugörselseçimiveölçümlemegibibaşlıklarüzerindedurulacaktır.Eğitim katılımcılarıayrıca,Facebookdestekekibinedoğrudanulaşabilmekiçinyapmalarıgerekenişlemlerhakkındada bilgilendirilecektir. Program ücretsizdir. Webinarakatılımiçinkontenjansınırıbulunmamaktaolup,aşağıdasunulanbağlantıdankayıtlaralınacaktır. DijitalPazarlamaWebinarı Tarih: 30Eylül2020, Çarşamba Saat: 14:00-16:00 KayıtLinki: https://attendee.gotowebinar.com/register/7463633772637712142 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
HES Kodu Sorgulaması
Sayın Üyemiz, -Çalışanlarınız ve toplum sağlığı için Hayat Eve Sığar (HES) kodu kullanımı daha da önem kazanmıştır. -Kendi iş yeriniz ve Kamu Kurum/Kuruluşlarına HES kodu olmadan giriş yapmayınız. -Linkteki rehberden HES kodunun nasıl alınacağını öğrenebilirsiniz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Helal Belgelendirme Konusunda Teknik Eğitim
Sayın Üyemiz, İlgi : Helal Akreditasyon Kurumu nun 08.09.2020 tarihli ve 32057160-770 sayılı yazısı. İlgide kayıtlı yazıda, Ticaret Bakanlığının ilgili kuruluşu olan Helal Akreditasyon Kurumunun (HAK) görevleri arasında helal uygunluk değerlendirme kuruluşlarını akredite etmenin yanı sıra helal belgelendirme özelinde sektör paydaşlarına ve profesyonellere yönelik eğitimler düzenlemek olduğu kaydedilmektedir. Bu kapsamda, helal uygunluk değerlendirme kuruluşlarında (belgelendirme kuruluşları) çalışan/çalışacak kişilere yönelik olarak 28 Eylül-1 Ekim 2020 tarihleri arasında teknik eğitim düzenleneceği belirtilmektedir. Yazıda devamla, anılan eğitim; İslam İşbirliği Teşkilatının (İİT) ilgili kuruluşu olan İslam Ülkeleri Standartlar ve Metroloji Enstitüsü (SMIIC) tarafından yayımlanan "OIC/SMIIC 1:2019 Helal Gıda İçin Genel Kurallar" ve "OIC/SMIIC 2:2019 Uygunluk Değerlendirmesi - Helal Belgelendirmesi Yapan Kuruluşlar İçin Kurallar" standartları ile söz konusu belgelerde atıfta bulunulan ISO standartlarının ilgili maddeleri başta olmak üzere diğer teknik metinleri içerdiği, 4 gün (toplam 16 saat) süre ile Microsoft Teams uygulaması üzerinden canlı çevrimiçi (online) katılım şeklinde tasarlanan eğitim programının kontenjanının 20 kişi ve katılım ücretinin 1.000 ₺/kişi olduğu ifade edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KVKK Semineri (İnternet Üzerinden)
Sayın Üyemiz, Kişisel verilerin işlenmesinde başta özel hayatın gizliliği olmak üzere kişilerin temel hak ve özgürlüklerini korumayı ve kişisel verileri işleyen gerçek ve tüzel kişilerin yükümlülükleri ile uyacakları usul ve esasları düzenlemeyi amaçlayan Kişisel Verilerin Korunması Kanunu (KVKK) ile kanun kapsamında kayıt olunması zorunlu olan Veri Sorumluları Sicil Bilgi Sistemi (VERBİS) hakkında 15 Eylül 2020 Salı günü saat 14:00 te internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin duyuru metni ekte sunulmaktadır. Kişisel Verileri Koruma Kurumu ve TOBB işbirliğinde gerçekleştirilecek olan seminerde KVKK ve bu kapsamda KOBİ lerin yükümlülükleri hakkında bilgi verilecek ve son kayıt tarihi büyük ve orta ölçekli işletmeler için 30/09/2020, mikro ve küçük ölçekli işletmeler için 31/03/2021 olan VERBİS kaydı ilgili ekran görüntüleri üzerinden anlatılacak olup, seminer sonunda KOBİ lerin konu hakkında soruları cevaplandırılacaktır. Katılımınız önemle rica olunur. Saygılarımızla, Eskişehir Ticaret Borsası
Gine-Bissau İle Kaju Ticareti
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 08.09.2020 tarihli ve 54304773 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Dışişleri Bakanlığından alınan yazıya atfen, Gine-Bissau Cumhurbaşkanı Sayın Umaro Sissoco Embalo nun 19-21 Haziran tarihlerinde ülkemizi ziyaret ettiği, Sayın Cumhurbaşkanımız ile Sayın Embalo arasında gerçekleşen görüşme sırasında konuk heyetçe ülkenin en önemli ihraç ürünü olan kaju fıstığında COVID-19 nedeniyle alıcı bulmakta zorluk yaşandığından bahisle, Türkiye nin Gine-Bissau dan daha fazla kaju satın almasından memnuniyet duyulacağının ifade edildiği bilgisi iletilmekte, ikili ticari ilişkilerin geliştirilmesi bakımından Gine-Bissau nun kaju fıstığında işbirliği yapmaya hazır olduğu bilgisinin ilgilenebilecek firmalarımızla paylaşılmasında fayda görüldüğü bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Özbekistan Yatırım Hukuku Hk
Sayın Üyemiz, İlgi: Türk Dili Konuşan Ülkeler İşbirliği Konseyinin 19.08.2020 tarih ve 2020-274 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda,Özbekistan Cumhuriyeti hükümeti tarafından belirlenen yeni yatırım kanunlarına ilişkin örneği ekte sunulan bilgiler iletilmektedir. İlgilenen firmalarımızın Özbekistan Cumhuriyeti Ankara Büyükelçiliği ne ( Tel: 03124413871 eposta: uzbekistanemb@gmail.com ) başvurması gerekmektedir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çin Halk Cumhuriyeti Bilgilendirme Etkinlikleri
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 03.09.2020 tarihli ve 46473657-724.01.01 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ticaret Bakanlığı nın ilgide kayıtlı yazısında, Çin in kalkınma sürecinde başta özel ekonomik bölgeler olmak üzere, yatırımcılara kapsamlı teşvik mekanizmalarının sağlandığı planlı yatırım bölgelerinin önemli rol oynadığı belirtilmektedir. Bu kapsamda Guangzhou Ticaret Ataşeliği ve Pekin Ticaret Müşavirliği koordinasyonunda Ticaret Bakanlığı, sektör çatı kuruluşları ve özel sektörümüzün temsilcilerinin de katılımıyla online olarak gerçekleştirilecek 2 etkinlik hakkında aşağıda yer alan bilgiler verilmektedir. 1. Hainan Serbest Ticaret Limanı Bilgilendirme Etkinliği Hainan Adası, Çin Hükümeti tarafından 1 Haziran 2020 tarihinde yayımlanan Hainan Free Trade Limanı master planı ile serbest bölge ilan edilmiştir. 9,2 milyon nüfus ve 35.000 kilometrekarelik alana sahip ada, dünyanın en büyük serbest bölgesi olacaktır. Aynı zamanda "duty free" olarak da hizmet vermesi öngörülen Ada‘dan B2C kapsamında yıllık kişi başı 100.000 RMB tutarında (yaklaşık 14.000 ABD Doları) kadar ürünün vergisiz olarak anakara Çin e girebilmesi mümkün olabilecektir. Diğer taraftan, söz konusu adanın önemli bir lojistik merkezi olarak da hizmet vermesi öngörülmektedir. Bu kapsamda, Hainan Provincial Bureau of Economic Development yetkilileri tarafından Guangzhou Ticaret Ataşeliği koordinasyonunda 15 Eylül 2020 tarihinde Türkiye saati ile 10.00 da bir online bilgilendirme toplantısı yapılması planlanmaktadır. Hainan Serbest Ticaret Limanı na yönelik bilgilendirme dokümanı Ek1 ve 2 de, anılan etkinliğe ilişkin program Ek-3 te yer almaktadır. Guangzhou Ticaret Ataşeliği, anılan serbest bölgenin Çin pazarına girme açısından önemli bir merkez teşkil etmesinin beklendiği değerlendirmesinde bulunmaktadır. Hainan Serbest Ticaret Limanı Bilgilendirme Etkinliği ne ilişkin katılım linki aşağıda yer almaktadır; https://zoom.us/j/92559943620?pwd=MXZWY2FxZ0Frb3RoZGNzdmF2MzJ0Zz09 ID:925 5994 3620 Passcode: 518066 2. Tianjin Pilot Serbest Ticaret Bölgesi Bilgilendirme Etkinliği Pilot serbest ticaret bölgeleri uygulamaları 2013 de Shanghai da kurulan bölge ile başlamış ve sonrasında diğer eyaletlerde kurulan pilot serbest ticaret bölgeleri ile bu sayı 18 e yükselmiştir. Söz konusu bölgelerde şirket kurma prosedürleri basitleştirilmiş olup, şirketlerin fiziksel bir mekana sahip olma zorunluluğu da bulunmamaktadır. Bu bölgelerde çok düşük ve hatta sıfır ihracat ve ithalat vergileri uygulanmakta, RMB ile diğer para birimleri arasında kolay geçiş yapılabilmekte ve gümrük işlemleri süratli bir şekildegerçekleştirilmektedir. Bunlara ek olarak kurulan "yeni bölgelerde" de yeni teşvikler yoluyla yeni endüstrilerin geliştirilmesi hedeflenmektedir. Çin in Tier 1 olarak adlandırılan gelişmiş şehirleri arasındaki Tianjin de yer alan Pilot Serbest Ticaret Bölgesi, ihracatçılarımız ve yatırımcılarımız açısından depolama, lojistik ve e-ticaret açısından birçok avantajı barındırmaktadır. Bu kapsamda, CCPIT Tianjin Başkanı ve Tianjin Pilot Serbest Ticaret Bölgesi Başkanı nın da katılımıyla, Pekin Ticaret Müşavirliği koordinasyonunda, 17 Eylül 2020 tarihinde Türkiye saati ile saat 10:00 da pilot serbest ticaret bölgeleri rejimine, yatırımcılara ve ihracatçılarımıza sunulan avantajların anlatılacağı bir online bilgilendirme toplantısının planlandığı belirtilerek, anılan etkinliğe ilişkin program Ek-4 te yer almaktadır. Pekin Ticaret Müşavirliği söz konusu programa sektör kuruluşlarımızın yanı sıra, pilot serbest ticaret bölgeler tarafından sunulan avantajları doğrudan ilgili yetkililerden edinmek amacıyla firma yetkililerimizin de katılım sağlamasının yararlı olacağı değerlendirmesinde bulunmaktadır. Tianjin Serbest Ticaret Bölgesi Bilgilendirme Etkinliği ne katılım linki aşağıda yer almaktadır; https://zoom.us/j/93646307842?pwd=WTBtSlBpdHlWOEY3bGx6UnJWSWVTUT09 Meeting ID: 936 4630 7842 Passcode: 081236 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tasarım Odaklı Yenilik Yarışması
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Birleşmiş Milletler Kalkınma Programı (UNDP) ve T.C. Sanayi ve Teknoloji Bakanlığı iş birliği, Avrupa Birliği (EU) finansmanı ile sürdürülen "Suriye Krizine Yanıt Olarak Türkiye de Dayanıklılık Projesi" neticesinde kurulması planlanan "Adana ve Mersin Yenilik Merkezleri" kapsamında Çukurova Yenilik ekosisteminde, ürün yeniliği alanındaki problemlere gerçekçi çözümler sağlayacak Tasarım Odaklı Yenilik Yarışması nın başvurularının açıldığı belirtilen bilgilendirme metni ekte gönderilmektedir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Özelleştirme Duyurusu
Sayın Üyemiz, T.C. Hazine ve Maliye Bakanlığı Özelleştirme İdaresi Başkanlığı (İdare) tarafından TOBB a yapılan müracaatla; ekte belirtilen taşınmazların 4046 sayılı Kanun hükümleri kapsamında “satış” yöntemiyle özelleştirileceği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Şirketlerin UETS Hesapları Hakkında
Sayın Üyemiz, İlgi : Adalet Bakanlığı nın 01.09.2020 tarihli ve 20844 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen ilgide kayıtlı yazıda,15 Mart 2018 tarihli Resmi Gazete de yayımlanan İcra ve İflâs Kanunu ve Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun un 48 inci maddesi ile 7201 sayılı Tebligat Kanunun, Elektronik Tebligatı düzenleyen 7/a maddesi değiştirilerek, bazı kurum ve kuruluşların 01.01.2019 tarihinden sonra Tebligat Kanununca yapılacak tebligatları elektronik olarak alması zorunlu tutulmuştur. Bu kapsamda sermaye şirketlerinin de tebligatlarını bu yolla alması zorunlu hale gelmiş, Ticaret Bakanlığı nca şirketler için birer UETS adresi oluşturulmuş ve şirketlere tebliğ edilmiştir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Kamuoyu Açıklaması
Sayın Üyemiz, TMO tarafından yapılan açıklamada, buğday ve arpa fiyatlarının belirlendiği dile getirilmiştir. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
HATIRLATMA - Asya Kalkınma Bankası İş Fırsatları Semineri (Webinar)
Sayın Üyemiz, İlgi : 20.08.2020 tarihli ve 7099 sayılı yazımız. İlgide kayıtlı yazıda, dünyanın en önemli bölgesel kalkınma bankaları arasında yer alan Asya Kalkınma Bankası nın (Asian Development Bank/ADB) yapısı, faaliyetleri ve finanse edilen projeler hakkında Türk iş dünyasına bilgi vermek amacıyla "Asya Kalkınma Bankası İş Fırsatları Semineri" nin 17 Eylül 2020 tarihinde 10:00-11:40 saatleri arasında ZOOM platformu üzerinden, Birliğimiz ve ADB işbirliğinde düzenleneceği belirtilmektedir. 1966 yılında kurulmuş olan ADB ye şu anda, aralarında Türkiye nin de yer aldığı 68 ülke üye olmuş olup, bu ülkelerin 49 u Asya-Pasifik bölgesinde bulunmaktadır. Merkezi Filipinler in başkenti Manila da olan bankanın aynı zamanda 31 ülkede ofisi bulunmaktadır. Bilindiği üzere Türkiye, Türk özel sektörüne yeni pazar olanaklarının sağlanması ve Orta Asya daki Türk Cumhuriyetlerinin kalkınmasına destek olunması amacıyla, Asya Kalkınma Bankası na 1991 yılında "donör ülke" statüsü ile üye olmuştur. Asya nın kalkınmakta olan ülkelerinde ADB tarafından finanse edilen projelerde 1997 yılından bu yana özellikle inşaat alanında faaliyet gösteren Türk firmaları Bankanın projelerine malzeme, ürün, hizmet ve danışmanlık sağlayabilmekte ve bu kapsamda ADB nin ihalelerine teklif verebilmektedir. Bu çerçevede, Türkçe-İngilizce simultane tercüme hizmeti sağlanacak olan Seminerde, ADB temsilcileri tarafından katılımcılara enerji ve ulaştırma altyapı sektörlerinde devam eden ve önümüzdeki dönemde gerçekleştirilmesi planlanan projeler hakkında bilgi verilecek, Bankanın iş yapma ve tedarik süreçleri hakkında açıklama yapılacaktır. Seminere katılacak firmalarımızın, ayrıca, ADB uzmanlarına soru sormaları imkânı da sağlanacaktır. Katılmak isteyen firmalarımızın kayıtlarını (İngilizce olarak) adb.tobb.org.tr adresinden en geç 11 Eylül 2020 Cuma günü mesai bitimine kadar tamamlamaları gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler-Brezilya
Sayın Üyemiz, İlgi : Ticaret Bakanlığı ndan alınan 07.09.2020 tarihli ve 29077148-743.02.01.01-E00057124334 sayılı yazı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen ilgide kayıtlı yazıda,İlgide kayıtlı yazıda, Ticaret Bakanlığı tarafından Ticaret Müşavir ve Ataşeleri ile Türk iş dünyasını bir araya getirmek üzere "Ticaret Müşavirlerimizle Elektronik Sohbetler" toplantıları düzenlendiği belirtilmekte ve 11 Eylül 2020 Cuma günü 15:30-17.00 saatleri arasında Brezilya Federal Cumhuriyeti nde görev yapmakta olan Ticaret Ateşemiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu etkinliğin programı ve kayıt linki ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tasarım Odaklı Yenilik Yarışması
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen ilgide kayıtlı yazıda,Birleşmiş Milletler Kalkınma Programı (UNDP) ve T.C. Sanayi ve Teknoloji Bakanlığı iş birliği, Avrupa Birliği (EU) finansmanı ile sürdürülen "Suriye Krizine Yanıt Olarak Türkiye de Dayanıklılık Projesi" neticesinde kurulması planlanan "Adana ve Mersin Yenilik Merkezleri" kapsamında Çukurova Yenilik ekosisteminde, ürün yeniliği alanındaki problemlere gerçekçi çözümler sağlayacak Tasarım Odaklı Yenilik Yarışması nın başvurularının açıldığı belirtilen bilgilendirme metni ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Avrupa Yeşil Mutabakat Çağrısının (European Green Deal Call)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Avrupa Komisyonu tarafından, 11 Aralık 2019 tarihinde dünya kamuoyu ile paylaşılan "Avrupa Yeşil Mutabakatı" ile, AB sanayisinin 2050 yılına kadar dönüşümünü öngören yeni bir strateji ortaya konmuştur. Bahse konu stratejiyle belirlenen hedeflerin hayata geçirilmesine katkı sağlamak ve bu alanda yapılacak ArGe ve inovasyon çalışmalarına destek olmak amacıyla, Avrupa Komisyonu tarafından Eylül 2020 de, Ufuk 2020 Programı kapsamında, "Avrupa Yeşil Mutabakat Çağrısının (European Green Deal Call)" açılması beklenmektedir. Bu çerçevede, 1 milyar avro bütçeli yeni çağrı bünyesinde, Avrupa nın iklim ve çevre ile ilgili zorluklarının üstesinden gelmek üzere 11 öncelikli alan altında 20 konu başlığı belirlenmiştir. Söz konusu çağrılara, araştırma kuruluşları, üniversiteler, finans kurumları, yatırımcılar, sivil toplum kuruluşları, ulusal ve yerel yönetimler, sosyal girişimciler ve gerçek kişiler başvuruda bulunabilecektir. Söz konusu çağrılar kapsamında desteklenecek alanlara ve çağrı koşullarına ilişkin olarak Sanayi ve Teknoloji Bakanlığı tarafından hazırlanan bilgilendirme dokümanı ekte yer almaktadır. Avrupa Yeşil Mutabakat Çağrısının etkin biçimde duyurulması ve ilgili paydaşların bu çağrıdan azami ölçüde faydalanabilmelerine yönelik olarak Bakanlık tarafından hazırlanan bilgilendirme sunumlarına "https://h2020.org.tr/tr/haberler/ufuk2020-programi-green-deal-yesilmutabakat-cagrisi-cevrimici-bilgigunu-gerceklesti" adresinden erişim sağlanabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Karayollarında Kullanıma Uygun Olmayan Araçlar
Sayın Üyemiz, Eskişehir Valiliğnden Borsamıza iletilen yazıda karayollarında kullanıma uygun olmayan araçlar hakkında bilgi yer almaktadır. Resmi Gazetedeki ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Birliğimiz tarafından Covid-19 pandemisi süresince bağlı Oda ve Borsalarımız başta olmak üzere ulusal ve uluslararası düzeyde bilgi alışverişi video konferans aracılığıyla sağlanmış olup, ilk günden bu yana üyelerimizi bilgilendirmek amacıyla çeşitli konularda webinarlar düzenlenmiş ve düzenlenmeye devam edilmektedir. Webinar duyurusu ulaştığı halde katılma imkanı bulamamış veya katılım imkanı bulduğu halde tekrarını izlemek isteyen üyelerimizingerçekleştirilen webinarların kayıtlarınahttp://tv.tobb.org.tr/webinaradresinden ulaşabileceği hususunu bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Online Kadın İhracatçı Programı hk.
Sayın Üyemiz, UPS Hızlı Kargo Taşımacılığı A.Ş. (UPS) tarafından, Kadın Emeğini Değerlendirme Vakfı (KEDV) ve Türkiye Kadın Girişimciler Derneği (KAGİDER) ortaklığında, Ticaret Bakanı Sayın Ruhsar Pekcan’ın destekleriyle Kadın İhracatçı Programı dizisi oluşturulmuştur. Ülkemizde, kadınlarımız arasında ihracat konusunda farkındalık yaratmayı, ihracat fikrini yaymayı ve girişimci kadınlarımızın işlerini dünyaya açmasını teşvik etmeyi amaçlayan Online Kadın İhracatçı Programı, 10 Eylül 2020 Perşembe günü saat 13.00’te düzenlenecektir. Kadın girişimcilerin küresel pazarlara ulaşımını sağlamak ve bölgelerinde sürdürülebilir kalkınma hedeflerine katkı sağlayabilmesi için düzenlenen programa katılım ücretsiz olup, bu programda kadın ihracatçılara sağlanacak destek ve kolaylıklar anlatılacak, e-ihracat eğitimi verilecektir. Daha önce ihracat yapmış ya da ihracata yeni başlayacak tüm girişimci kadınlar bu programa dahil olabilecektir. Katılmak için ZOOM programının indirilmesi ve aşağıda yer alan kayıt bağlantısından programa kayıt yapılması gerekmekte olup; etkinlik broşürü ve etkinlik programı aşağıdaki bağlantılarda yer almaktadır. Kayıt için:https://ups.zoom.us/webinar/register/WN_eQXmVE6rSeyCaL77VX9fEA Detaylı Bilgi İçin: Kazım Utangan Tel: 0530 881 66 13 E-posta: kip@ups.com Bilgilerinize sunarız. Saygılarımızla Eskişehir Ticaret Borsası
Sayın Üyemiz, TOBB’dan Borsamıza iletilen 28.08.2020 tarih ve 7401 sayılı yazıda, Avrupa Birliği ve Türkiye Cumhuriyeti tarafından finanse edilen ve Aile, Çalışma ve Sosyal Hizmetler Bakanlığı, İş Sağlığı ve Güvenliği Genel Müdürlüğü tarafından yürütülen "Madencilik Sektöründe İş Sağlığı ve Güvenliğinin Geliştirilmesi" Projesinin 21 Kasım 2019 tarihinde başladığı belirtilmiştir. Teknik Destek, Finansal Destek ve Rehberlik, Hibe Programı olmak üzere üç bileşenden oluşan ve yaklaşık 17.6 Milyon Avroluk bütçeye sahip Proje ile özellikle madencilik sektöründe proaktif yaklaşıma dayalı iyileştirilmiş çalışma koşullarının desteklenmesi, toplumsal farkındalığın artırılması ve tüm paydaşların konuyla ilgili bilgi seviyelerinin geliştirilmesi yoluyla daha iyi çalışma koşullarının oluşturulmasının amaçlandığı belirtilmiştir. Projenin açılış toplantısının 20 Ağustos 2020 tarihinde Aile, Çalışma ve Sosyal Hizmetler Bakanı Zehra Zümrüt SELÇUK un katılımları ile Online formatta düzenlenmiş olduğu, yeraltı kömür ve metal madenlerine yönelik 7.6 milyon Avro bütçeli Finansal Destek ve Rehberlik programı başvuruları da aynı gün başladığı belirtilmiştir. Programa en az 50 en fazla 250 çalışanı olup kömür üreten (NACE 05) veya en az 20 en fazla 250 çalışanı olup metal (NACE 07) cevheri üreten yeraltı maden işletmelerinin ana işveren ya da alt işverenlerinin 25.10.2020 tarihi saat 23:59 a kadar başvurabileceği belirtilmiştir. Finansal Destek ve Rehberlik Programı, seçilecek 70 kömür veya metal cevheri üreten yeraltı maden işletmesine İSG profesyoneli görevlendirilmesi, tahlisiye eğitimleri ve İSG Yönetim sistemi entegrasyonu için finansal destek verilmesini ve bu işyerlerinde iş sağlığı ve güvenliği alanında önleyici yaklaşımlar geliştirilerek sektör özelinde yaşanan kilit problemlere çözüm getirmeyi hedeflemektedir. İşverenlerin programa nereden, nasıl başvuracakları, dikkat etmeleri gereken hususlar ve ilgili kılavuzları içeren yönlendirici duyuruyahttps://www.ailevecalisma.gov.tr/isggm/duyurular/yeralti-maden-isletmelerine-yonelik-finansal-destek-ve-rehberlik-programi-basvurulari-baslamistir/ Başvuru süreci hakkındaki tüm sorular misgep@misgep.org adresinden ilgililere iletilebilmektedir. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Şirketlerin Genel Kurul Toplantılarına İlişkin Bilgilendirme
Sayın Üyemiz, Merkezi Kayıt Kuruluşu A.Ş.’den TOBB’a intikal eden yazıda ; koronavirüs önlemleri kapsamında şirketlerin genel kurul toplantılarına ilişkin bilgilendirme hususunu içeren yazı ektedir. Bilgilerinize sunulur.
TMO Kamuoyu Açıklaması ( Çeltik Alım Fiyatı)
Sayın Üyemiz, TMO 2020 yılı hasat dönemi çeltik alım fiyat ve politikaları hakkında kamuoyu açıklamasıektebilgilerinize sunulmuştur. Saygılarımızla,
Ticaret Müşavirleriyle Elektronik Sohbetler - Meksika
Sayın Üyemiz, İlgi : Ticaret Bakanlığının01.09.2020 tarihli ve 57032471 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen ilgide kayıtlı yazıda, Ticaret Bakanlığı na bağlı olarak dünyanın dört bir yanında ihracatımızın geliştirilmesi için çalışmakta olan Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere Ticaret Bakanlığı tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" toplantıları düzenlendiği bildirilmektedir. Bu kapsamda, 07 Eylül 2020 Pazartesi günü 17.00-18.30 saatleri arasında Meksika da görev yapmakta olan Ticaret Müşavirimiz ile ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılımıyla e-sohbet toplantısı gerçekleştirileceği belirtilmektedir. Ayrıntılı bilgi ektedir. Üyelerimize duyurulur.
Sayın Üyemiz, Dalaman Tarım İşletmesi Müdürlüğünden alınan yazıda, 2020 yılı istihsali 1.397.490 kg yağlık ayçiçeği mahsulü satış ihalesinin 08.09.2020 salı günü saat 14.00 te Dalaman Tarım İşletmesinde yapılacağı bildirilmektedir. İhale ilanı ektedir. İlgilenen üyelerimizin bilgisine sunulur. Saygılarımızla, Eskişehir Ticaret Borsası
KOBİGEL Programı Bilgilendirme Semineri
Sayın Üyemiz, İşletme başına 300.000 TL ye kadar geri ödemesiz, 700.000 TL ye kadar geri ödemeli olmak üzere toplam 1.000.000 TL ye kadar destek verilebilen"KOBİ Gelişim Destek Programı (KOBİGEL)"hakkında 9 Eylül 2020 Çarşamba günü saat 14:00 te internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. KOSGEB temsilcilerinin katılımı ile gerçekleştirilecek olan seminerde KOBİGEL desteğine yönelik bilgi verilecek olup, seminer sonunda KOBİ lerin konu hakkında sorularının cevaplandırılacaktır. Üyelerimizin bilgisine sunulur. Saygılarımızla, Eskişehir Ticaret Borsası
Sayın Üyemiz, T.C. Ticaret Bakanlığı Kolay İhracat Platformu 28 Ağustos 2020 tarihinde Ticaret Bakanımız Sayın Ruhsar Pekcan tarafından kamuoyuna açıklanmıştır. Kolay İhracat Platformu;yurtdışı pazarlara girişte gereksinim duyulan, pazarlama stratejilerine yön veren bilgilerin tek kanaldan ihracatçıya ulaştırılması ve hedef pazar tespiti kapsamında bir karar destek mekanizması sunulması amacıyla hazırlanmıştır. Kolay İhracat Platformu nda ülkeler/sektörler, dış ticaret mevzuatı, pazara giriş haritası, akıllı ihracat robotu modülleri yer almaktadır. Bu modüller aracılığıyla tüm veri kaynaklarından derlenen birçok veriler işlenip ihracatçıların kullanımına sunulmaktadır. Kolay İhracat Platformu nahttps://www.kolayihracat.gov.tr/adresinden ulaşılabilmektedir. Üyelerimizin bilgisine sunulur. Saygılarımızla,
Katma Değer Vergisi ve Özel Tüketim Vergisi Oranlarına İlişkin Cumhurbaşkanı Kararları
Sayın Üyemiz, 30 Ağustos 2020 tarihli ve 31229 sayılı Resmi Gazete’de yayımlanan 2912 sayılı Özel Tüketim Vergisi Kanunu ekinde yer alan listedeki bazı malların oranlarının yeniden tespitine ilişkin Karar ile 2913 sayılı Mal ve Hizmetlere Uygulanacak Katma Değer Vergisi Oranlarının Tespitine İlişkin Kararda Değişiklik Yapılmasına Dair Karar ekte bilgilerinize sunulmaktadır. Ek 1 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Mal ve Hizmetlere Uygulanacak Katma Değer Vergisi Oranlarının Tespitine İlişkin Kararda Değişiklik Yapılmasına Dair Karar
Sayın Üyemiz, Resmi Gazetede bahse konu Karar değişikliğinde özetle; 2007/13033 sayılı Mal ve Hizmetlere Uygulanacak Katma Değer Vergisi Oranlarının Tespitine İlişkin Karara geçici 6 ncı madde eklenerek,bu Madde kapsamında 31.12.2020 tarihine kadar geçerli olmak üzere değişiklik yapılmıştır. İlgili karar için lütfen tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Ödeneği Süresi Bir Ay Daha Uzatıldı
Sayın Üyemiz, Yeni koronavirüs (Covid-19) nedeniyle dışsal etkilerden kaynaklanan dönemsel durumlar kapsamında zorlayıcı sebep gerekçesiyle 30/6/2020 tarihine kadar (bu tarih dahil) kısa çalışma başvurusunda bulunmuş ve bu uygulamadan yararlanmış olan işyerlerinde kısa çalışma süresi Sayın Cumhurbaşkanımızın tensipleriyle 31 Temmuz 2020 tarihli ve 2810 sayılı Karar ile bir ay daha uzatıldı. Uzatmadan yararlanabilmek için işverenlerden yeni bir başvuru alınmayacak, 29/6/2020 tarihli ve 2706 sayılı Cumhurbaşkanı Kararı ylauzatılan bir aylık süreden sonra başlamak üzere bir ay daha bu haktan yararlanılabilecek. İlgili karara duyurumuz linkinden ulaşabilirsiniz. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, Cumhurbaşkanlığı İnsan Kaynakları Ofisi ve Birliğimiz arasında 8 Haziran 2020 tarihinde Yetenek Kapısı İş Birliği Protokolü imzalanmış olup bu kapsamda, Cumhurbaşkanlığı İnsan Kaynakları Ofisi tarafından "Staj Seferberliği" programı başlatılmıştır. Staj seferberliği programında üyelerimiz, tüm üniversite ve bölümlerden genç yeteneklerin yer aldığı stajyerHavuzuna erişim hakkına sahiptir. Üyelerimizin bu sisteme giriş yapabilmeleri için kayıt yaptırmaları gerekmektedir. Stajyer Havuzuna erişim sağlamak isteyen üyelerimizin sisteme giriş yapmak üzere yetkili bir kişiyi belirleyip ekte paylaşılan tabloya işleyerek 01.09.2020 tarihine kadar Birliğimize (nazli.akgun@tobb.org.tr) iletmesi gerekmektedir. Bilgilerinize rica ederiz.
Letonya Online İkili Görüşmeler Hk.
Letonya Ticaret ve Sanayi Odası’nın 27.08.2020 tarihli elektronik postası. Sayın Üyemiz, Letonya Ticaret ve Sanayi Odası’nın Birliğimize ilettiği ilgide kayıtlı elektronik postada, Letonya Ticaret ve Sanayi Odası ev sahipliğinde Avrupalı şirketlerin katılımıyla online ikili görüşmelerin gerçekleştirileceği bildirilmektedir. 25-26 Eylül 2020 tarihinde ağaç işleme, inşaat, metal işleme, tekstil ve kozmetik sektörlerinde; 9-10 Ekim 2020 tarihlerinde ise bilişim ve iletişim teknolojileri, elektronik, tasarım, ulaştırma ve lojistik, gıda işleme sektörlerinde gerçekleştirilecek olan ikili görüşmeler Cisco Webex programı üzerinden düzenlenecektir. Söz konusu etkinliğin detaylarına Birliğimiz web sayfası (www.tobb.org.tr) “Hizmetler” başlığı altındaki “Uluslararası İş İmkânları/Ülke Duyuruları/Letonya” bölümünden ulaşılabilmektedir. Bilgilerinize rica ederiz. Saygılarımızla, Eskişehir Ticaret Borsası
TİGEM 4.370 Ton Mahsul Ayçiçek Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,03.09.2020 günü saat 10.00’da Şanlıurfa Ticaret Borsasında İşletmemize ait 2020 yılı istihsali 4.370 ton ayçiçeğinin açık artırma usulü satış ihalesi yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinde yayınlanmıştır., bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Libya-Mutabakat Zaptı
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 14.08.2020 tarihli ve 56604722 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ticaret Bakanlığı ndan alınan ilgide kayıtlı ve bir örneği ekte sunulan yazıda, Türkiye ve Libya nın ilgili Bakanlıklarınca (Türkiye tarafı Ticaret Bakanlığı ve Libya tarafı Planlama Bakanlığı) müteahhitlik firmalarımızın geçmişten kaynaklanan sorunlarının firma-işveren idare arasında yapılacak görüşmeler neticesinde çözümünü sağlamak ve gerçekleştirilecek görüşmelerin sonuçlarının ifasını temin etmek üzere 2019 yılının başından itibaren, çeşitli toplantılar, ikili görüşmeler ve taslak metin teatileri yapıldığı bildirilmektedir. Bu çerçevede, 12-13 Ağustos 2020 tarihlerinde, Libya Planlama Bakanı ve beraberindeki heyetin ülkemizi ziyareti çerçevesinde, bir Mutabakat Zaptı (MoU) nın, Ticaret Bakanımız Sayın Ruhsar Pekcan ile Libya Planlama Bakanı Sayın Taher Cuheymi tarafından imza altına alındığı iletilmekte olup, bahse konu metnin Türkçe, İngilizce ve Arapça nüshaları ekte sunulmaktadır. İmzalanan MoU ile, Türk firmalarının Libya daki hakediş alacaklarından, teminat mektuplarına, makineekipman, şantiye veya yapılan projenin gördüğü zararlardan, fiyat artışlarına ve projelerin devam edip etmemesi, devam etmeyecek projeler için tasfiye süreçlerinin belirlenmesine kadar tüm konuların Libyalı işveren idareler ile ele alınıp kalıcı bir çözüm elde edilmesinin sağlanabileceği değerlendirilmektedir. Bahse konu MoU, Libya tarafınca gündeme getirilen, firma-işveren idare görüşmelerinin sonuçlarının ifa edilememesi hususunu bertaraf etme amacıyla, Libya Devletinin ilgili tüm Kurumlarının sürece katkı sağlamasını temin etmek üzere imza altına alınmıştır. Libya tarafı, Metnin yürürlüğe girmesini teminen Ulusal Mutabakat Hükümeti Başkanlık Konseyi Kararı alınmasına ihtiyaç duyulduğunu belirtmiş ve bu çerçevede Metne yürürlüğe girişe ilişkin bir madde eklenmiştir. Bu kapsamda, firmalarımızın Metnin yürürlüğe girmesinin ardından 90 gün içerisinde ellerindeki belgelerle Libyalı işveren idarelerle bir araya gelerek geçmişten kalan sorunları müzakere etmeleri gerekmektedir. Müzakerelerin neticesinde ortaya çıkacak olan sonuçların da imzalanan bu Metin sayesinde ifa edilmesi beklenmektedir. Bahse konu MoU nun yürürlüğe giriş tarihi Ticaret Bakanlığı tarafından takip edilmekte olup, bu konuda Birliğimize bilgilendirme yapılmasını takiben, Birliğimizce gerekli duyurular yapılacaktır. Öte yandan firmalarımızın sorunlarının, özel hukuk sözleşmelerinden kaynaklanan sorunlar olduğu ve bu sorunların firma-işveren idare görüşmeleri çerçevesinde çözümlenecek konuları ihtiva ettiği hususu dikkate alındığında, Metnin yürürlüğe girmesinden sonra öngörülen takvim çerçevesinde iş süreçlerinin takibinin firmalarımız tarafından hassasiyetle gerçekleştirilmesinin hayati önemi haiz olduğu değerlendirilmektedir. Bu çerçevede; 1. Metnin yürürlüğe girmesinin ardından 90 gün içerisinde, firmalarımızın ellerindeki belgelerle birlikte Libyalı işveren idarelerle bir araya gelerek geçmişten kalan sorunları müzakere etmeleri gerekmektedir. 2. Firmalarımızın Libyalı idarelerle yapacakları görüşmeler kapsamında işe devam etme imkânlarının olması durumunda, yeniden işe başlama sözleşmelerinde güvenlik ile ilgili gerekli maddelere mutlaka yer vermeleri ve özellikle mevcut tüm sigortalama imkânlarını değerlendirmeleri son derece önemlidir. 3. Firmalarımızın, Libyalı idareler ile yapılan görüşmeler sonucunda kesinleşen, iptal olan veya yeniden işe başlama sözleşmesi yapılan projelere ilişkin bilgileri de istatistiki izleme açısından Ticaret Bakanlığı na bildirilmek üzere, Birliğimiz ile paylaşması gerekmektedir. 4. MoU nun imzalanmasını takiben, Ticaret Bakanlığıyla iş birliği içerisinde bulunan ilgili firmalarımız için bilgilendirme toplantısı yapılması için Birliğimizce Ticaret Bakanlığıyla temas kurulmaktadır. Yapılan mutabakat ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Devlet Destekli Alacak Sigortası’nda Değişiklik
Sayın Üyemiz, Üyelerimizden gelen talepler ve Türkiye Odalar ve Borsalar Birliği nin girişimleri sonucunda 19 Ağustos 2020 tarih ve 31218 sayılı Resmi Gazete´de "Küçük ve Orta Ölçekli İşletmelere Yönelik Devlet Destekli Ticari Alacak Sigortası Tarife ve Talimat Tebliğinde Değişiklik Yapılmasına Dair Tebliğ" yayınlanmıştır. Konuya ilişkin yeni düzenlemeleri içeren bilgi notu ile karşılaştırma tablosu ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Montreal Liman İşçilerinin Grevi
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 20.08.2020 tarihli ve 30171052-120.99 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ticaret Bakanlığı nın Birliğimize ilettiği ilgide kayıtlı yazısı ile, Ottava Ticaret Müşavirliğimizden alınan bilgi notuna atfen, Montreal Limanı nda görev yapan 1125 işçinin 9 gündür grevde olduğu, limandaki yükleme, aktarma ve elleçleme işlemlerinde gecikmeler yaşandığı, Kanada nın doğusunda yer alan eyaletlerin dış ticaret işlemlerini olumsuz etkileyen söz konusu grevin sona erdirilmesi konusunda Kanada Kamu İşçileri Sendikası ile Liman İşverenleri Birliği arasındaki görüşmelerin devam ettiği bildirilmektedir. Ayrıca yapılan açıklamalarda uzlaşmaya kısa sürede varılacağı ifade edilmekte olup, Montreal Limanı üzerinden Kanada ile ticaret yapan firmalarımızın limandaki iş ve işlemlerdeki olası gecikmeleri dikkate almalarında fayda olduğu belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Asya Kalkınma Bankası İş Fırsatları Semineri (Webinar)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Asya Kalkınma Bankası (Asian Development Bank/ADB) dünyanın en önemli bölgesel kalkınma bankaları arasında yer almaktadır. 1966 yılında kurulmuş olan ADB ye şu anda, aralarında Türkiye nin de yer aldığı 68 ülke üye olmuş olup, bu ülkelerin 49 u Asya-Pasifik bölgesinde bulunmaktadır. Merkezi Filipinler in başkenti Manila da olan bankanın aynı zamanda 31 ülkede ofisi bulunmaktadır. Bilindiği üzere Türkiye, Türk özel sektörüne yeni pazar olanaklarının sağlanması ve Orta Asya daki Türk Cumhuriyetlerinin kalkınmasına destek olunması amacıyla, Asya Kalkınma Bankası na 1991 yılında "donör ülke" statüsü ile üye olmuştur. Asya nın kalkınmakta olan ülkelerinde ADB tarafından finanse edilen projelerde 1997 yılından bu yana özellikle inşaat alanında faaliyet gösteren Türk firmaları Bankanın projelerine malzeme, ürün, hizmet ve danışmanlık sağlayabilmekte ve bu kapsamda ADB nin ihalelerine teklif verebilmektedir. Bu çerçevede, Asya Kalkınma Bankası nın yapısı, faaliyetleri ve finanse edilen projeler hakkında Türk iş dünyasına bilgi vermek amacıyla "Asya Kalkınma Bankası İş Fırsatları Semineri" 17 Eylül 2020 tarihinde 10:00-11:40 saatleri arasında ZOOM platformu üzerinden, Birliğimiz ve ADB işbirliğinde düzenlenecektir. Türkçe-İngilizce simultane tercüme hizmeti sağlanacak olan Seminerde, ADB temsilcileri tarafından katılımcılara enerji ve ulaştırma altyapı sektörlerinde devam eden ve önümüzdeki dönemde gerçekleştirilmesi planlanan projeler hakkında bilgi verilecek, Bankanın iş yapma ve tedarik süreçleri hakkında açıklama yapılacaktır. Seminere katılacak firmalarımızın, ayrıca, ADB uzmanlarına soru sormaları imkanı da sağlanacaktır. Taslak programı ekte sunulan söz konusu Seminere katılmak isteyen firmalarımızın kayıtlarını (İngilizce olarak) adb.tobb.org.tr adresinden en geç 11 Eylül 2020 Cuma günü mesai bitimine kadar tamamlamaları gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Brunei’de Kampung Pandan Sağlık Merkezi projesi için yatırım çağrısı
Sayın Üyemiz, İlgi : Dışişleri Bakanlığı’nın 19.08.2020 tarih ve 31640088 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Brunei Darusselam Ankara Büyükelçiliği nden alınan notaya atfen, Brunei Sağlık Bakanlığı nı temsilen Brunei Ekonomik Kalkınma Kurulu (BEDB) na bağlı "Syarikat P Cube Sendirian Berhad" kuruluşun, Brunei Darussalam da Kampung Pandan, Kuala Belait bölgesinde kurulacak olan "Kampung Pandan Sağlık Merkezi" projesi için yatırımcı aradığı belirtilmektedir. Ekte bir örneği sunulan söz konusu duyuruda devamla, koşulları karşılayan başvuru sahiplerine Niyet Beyanı belgesi (EOI) teslim edilmeden önce gizlilik sözleşmesi tevdi edileceği; temin edilen Niyet Beyanı nın ise eksiksiz doldurularak 14 Eylül 2020 Pazartesi günü saat 10:00 a kadar rfp@pcube.com.bn e-posta adresine iletilebileceği kaydedilmektedir. Ayrıca, bahse konu projeyle ilgilenen yatırımcılarımızın, en az bir ticari kalkınma projesinde, en az üç yıllık imar ve işletme tecrübesi ile geçtiğimiz üç senede en az 4,000,000 Brunei Doları (21.590.633 TL) yıllık ciro yapmış olmaları gerektiği belirtilmektedir bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yatırımlarda Devlet Yardımları
Sayın Üyemiz, Yatırımlarda Devlet Yardımları Hakkında Kararda Değişiklik Yapılmasına Dair Cumhurbaşkanı Kararı Resmi Gazete de yayımlanarak yürürlüğe girmiştir. İlgili karara istinaden, Alpu, Günyüzü ve Han ilçelerimiz Alt bölge desteğinden yararlanabilecek olup, 2846 Karar numarası ile Resmi Gazete nin 21 Ağustos Cuma gün ve 31220 no.lu sayısında yayımlanan Cumhurbaşkanı kararına duyurumuz linkinden ulaşabilirsiniz. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
TİGEM 2000 Ton Mahsul Ayçiçek Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,27.08.2020 günü saat 10:00 da Şanlıurfa Ticaret Borsasında (buğday pazarı satış bürosunda) işletmemizin 2020 yılı istihsali 2.000 ton mahsul ayçiçeğinin 8 (sekiz parti halinde açık artırma suretiyle satış ihalesi yapılacaktır, bilgisi yer almaktadır. Ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Türkiye-Polonya Online İş Forumu
Sayın Üyemiz, İlgi : 13.07.2020 tarihli ve 34221550-720-6091 sayılı yazımız. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazımızla, Birliğimiz ve Polonya Ticaret Odası işbirliğinde 16 Eylül 2020 tarihinde ZOOM üzerinden Türkiye-Polonya Online İş Forumu nun düzenleneceği bildirilmiştir. Bahsi geçen Forum a kayıt tarihi 31 Ağustos 2020 Pazartesi günü mesai bitimine kadar uzatılmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Devlet Destekli Ticari Alacak Sigortasında Ciro Düzenlemesi
Sayın Üyemiz, Küçük ve orta ölçekli işletmelere (KOBİ) yönelik devlet destekli ticari alacak sigortası tarife ve talimatında, KOBİ lere sunulan alacak sigortası kriterlerinde düzenleme yapılarak, alacak sigortası sağlama kriterleri bir önceki mali yılda yurt içi satışlardan elde edilen ciro olarak değiştirilmiştir. Sigortacılık ve Özel Emeklilik Düzenleme ve Denetleme Kurumu’nun, Resmi Gazete’nin bugünkü sayısında yayımlanan söz konusu değişiklik tebliğine göre, KOBİ’lere alacak sigortası sağlama koşulları, KOBİ tanımı, nitelikleri ve sınıflandırılması hakkında yönetmelikte yer alan yıllık net satış hasılatının yanı sıra mali bilanço rakamı dikkate alınarak belirlenecektir. Düzenlemeye göre, daha önce KOBİ’lere alacak sigortası sağlama kriterleri arasında yer alan ve “bir önceki mali yıldaki yıllık net satış hasılatı” olarak belirlenmiş kriter, “bir önceki mali yılda yurt içi satışlardan elde edilen ciro” olarak değiştirildi. Buna göre, alacak sigortası sunulacak KOBİ’lerin bir önceki mali yılda yurtiçi satışlardan elde ettiği cirosunun 125 milyon TL’den az olması gerekmektedir. Yapılan düzenlemeyle ayrıca, Merkez’in, gerekli görmesi halinde, bu tutarı her bir başvuru için %20’sine kadar artırabilmesine imkân tanınmıştır. Düzenleme kapsamında, tarife ve talimat tebliğinin prim hesabına esas olan tablo ile azami kredi limitini belirleyen tabloya iki dipnot eklenmiştir. Buna göre, cironun, yukarıda belirlenen madde kapsamında artırılması durumunda, net prim ve azami teminat tutarı, tablonun en son satırı kullanılarak hesaplanacak ve alıcı başına 750,000 TL azami kredi limiti sağlanacaktır. Değişiklikle, sistem kapsamında düzenlenen sigorta sözleşmeleri için vergi ve diğer yasal yükümlülükler düşüldükten sonra kalan prim tutarı üzerinden uygulanacak komisyon oranı %12’den %15’e, çıkarılmıştır. Sigorta aracısına sigorta şirketi tarafından prim tutarının %9’u olarak belirlenen tutar ise %12’ye yükseltilmiştir. Söz konusu tebliğin yayınlandığı Resmi Gazete linktedir. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
Filipinler de New Clark City Projesi
Sayın Üyemiz, İlgi : Filipinler Ankara Büyükelçiliği’nin 10.08.2020 tarihli yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Filipinler Kalkınma İdaresi (Philippines Bases Conversion and Development Authority) tarafından Tarlac eyaletindeki Clark Özel Ekonomik Bölgesinde "New Clark City - NCC" adlı yeni bir şehrin kurulmasının planlandığı bildirilmektedir. Söz konusu şehrin, akıllı, sürdürülebilir ve afetlere dayanıklı bir metropol olarak planlandığı, içinde hükümet, eğitim kurumları, spor, eğlence ve karma kullanım alanları için tesislerin kurulacağı ifade edilmektedir. Yazıda devamla, anılan şehrin hafif sanayi, lojistik, depolama, soğuk depolama ve gıda işleme faaliyetleri için bir sanayi merkezi olarak tasarlandığı bildirilerek, üretim, sanayi, hafif sanayi, araştırma ve geliştirme, konut ve karma kullanımlı yapılar alanında faaliyet gösteren ve bahse konu proje ile ilgilenen firmaların Filipinler Ankara Büyükelçiliği ile (ankara.pe@dfa.gov.ph) iletişime geçebilecekleri belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türk-Rus 17.nci Dönem KEK Toplantısı
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 12.08.2020 tarihli ve 56545660 sayılı yazısı. İlgide kayıtlı yazıda, 19 Haziran 2020 tarihinde Türk-Rus Ticaret, Yatırımlar ve Bölgesel İşbirliği Çalışma Grubu Toplantısının gerçekleştirilmiş olduğu, anılan Toplantı kapsamında ekte örneği sunulan taslak Protokol metninin üzerinde mutabık kalındığı, söz konusu Çalışma Grubu Protokolünde yer alan maddelerin de 30 Eylül 2020 tarihinde Rusya Federasyonu nun St. Petersburg kentinde gerçekleştirilmesi öngörülen Türk-Rus KEK 17. Dönem Toplantısının Protokolüne derç edilmesinin planlandığı ifade edilmektedir. Bu çerçevede, 17. Dönem KEK Toplantısı hazırlıkları çerçevesinde, söz konusu toplantıda gündeme getirilmesinde fayda görülen konulara ilişkin bilgi talep edilmektedir. Bilgisi yer almaktadır. Bu itibarla,toplantı hazırlıklarında kullanılmak üzere, Rusya Federasyonu ile mal ve hizmet ticaretinde karşılaşılan problemler, pazara giriş engelleri, çözüm önerileri, ticaretin kolaylaştırılmasına yönelik tedbirler, ülkemizdeki yatırım imkânları, yatırım projeleri ve Rusya Federasyonu nda yatırımcılarımızın karşılaştıkları sorunlar gibi konulara ilişkin görüşlerinizin en geç 20 Ağustos 2020 günü mesai saati bitimine kadar Borsamıza (E-posta: eskisehirtb@tobb.og.tr) iletilmesi hususunda gereğini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Standart Tasarıları
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda, Türk Standardları Enstitüsü nden Birliğimize gönderilen elektronik postalarda; - Gaz regülatörleri - Yanıcı gazlar (doğal gaz) için - Giriş basıncı 200 mbar a (dahil) kadar (tkt 2020135589 ) - IOT Tabanlı Güvenlik Sistemleri (tkt 2020135405) - Tekstil - Tekrar kullanılabilir koruyucu yüz maskeleri - Tıbbi olmayan – Özellikler (TSE K 599) - Kahve-Öğütülmüş (tst 13423) - Pistonlu ve Denge Pistonlu Vanalar (tkt 2015105425) - Biyokütle Enerjisine Dayalı Kojenerasyon Sistemi Enerji Üretim Tesisi (TSE K 563/t1) başlıklarında TSE standart tasarılarının görüşe açıldığı bildirilmektedir, bilgisi yer almaktadır. Standart tasarılarına http://www.tobb.org.tr/standart adresinden ulaşılabilmektedir. Bilgilerinizi, ve varsa görüş ve önerilerinizi 20 Ağustos 2020 tarihine kadar eskisehirtb@tobb.org.tr adresine gönderilmesini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fas Tarafından Gümrük Vergilerinin Arttırılması
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 11.08.2020 tarihli ve 56510380 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgi yazıda, Rabat Ticaret Müşavirliği Kazablanka Ofisi nden alınan ve bir örneği ekte sunulan yazıya atfen, ülkemiz ile Fas arasında yürürlükte olan Serbest Ticaret Anlaşması nın 17 nci maddesine göre; ülkemizden ithali gerçekleşen bazı nihai tekstil ve hazır giyim ürünlerine karşı 31 Aralık 2021 tarihine kadar mevcut MFN oranının % 90 ı oranında gümrük vergisinin Fas tarafından yürürlüğe konulduğu hatırlatılmaktadır. Yazıda devamla, bu defa, Fas Gümrük ve Dolaylı Vergi İdaresi nin internet sitesinde yayımlanan 27 Temmuz 2020 tarihli ve 6074/211 sayılı sirkülerde özetle; 27 Temmuz 2020 tarihli ve 6903 sayılı Fas Resmi Gazetesinde yayımlanan "2020 Yılı Değiştirilmiş Finans Kanunu" uyarınca, ortak vergi rejimi kapsamında %30 oranına tabi olan tüm ürünler için ithalat vergisinin %40 a yükseltilmesinin öngörüldüğü belirtilmektedir. Bu kapsamda, Türkiye den ithali gerçekleşen ve %30 oranına tabi olan tekstil ve hazır giyim ürünlerine karşı uygulanan verginin 27 Temmuz 2020 tarihinden itibaren %40 oranı baz alınarak hesaplanacağı, sirkülerin ekinde Türkiye menşeli ve korunma önlemine tabi olan ürünlerin yeni uygulamaya göre güncellenmiş listesine yer verildiği hususları belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Proje Uzman Envanteri
Sayın Üyemiz, İlgi : Tarım ve Orman Bakanlığı ndan alınan 05.08.2020 tarihli, 2151175 sayılı yazı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Tarım ve Orman Bakanlığı Tarımsal Araştırmalar ve Politikalar Genel Müdürlüğü nden alınan ilgi yazıda; Avrupa Birliği Destekli "Balıkçılık Faaliyetlerinde Stok Değerlendirme Uygulamaları" başlıklı proje gerçekleştirildiği, söz konusu Proje ile balıkçılık faslında Avrupa Birliği müktesebatına uyum sağlamak, ülkemizin balık stoklarının tespiti ile ilgili altyapıyı güçlendirmek ve kurumsal kapasiteyi geliştirmek vs. amaçların olduğu bildirilmektedir. Bu Proje kapsamında ülkemizde balık stok araştırmaları, modellemeleri, balıkçılık yönetimi ile ilgili konularda çalışmakta olan uzman potansiyeli ile ilgili bir envanter oluşturulması, Kurum ve/veya Kuruluşlarda bu ve ilişkili alanlarda görev yapmakta olan araştırmacıların/kişilerin envantere girilmek üzere bilgilerini Bakanlıkları ile paylaşılması talep edilmektedir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan, Elektronik Ticarette Güven Damgası Tebliği Hakkında değişiklik
Sayın Üyemiz, Resmi Gazetede yayınlanan, "Elektronik ticarette güven damgası"tebliğindekideğişiklikler hakkında ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Ayrıntılı bilgi içinTIKLAYINIZ. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan, Türk Gıda Kodeksi Salça ve Benzeri Ürünler Tebliğinde Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede yayınlanan,Türk gıda kodeksi salça ve benzeri ürünler tebliğindekideğişiklikler hakkında ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Ayrıntılı bilgi içinTIKLAYINIZ. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Standart Değişikliği
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda, Türk Standardları Enstitüsü nden Birliğimize 01.07.2020 ile 30.07.2020 tarihlerinde iletilen e-postalarda; Grup Adı: Teknik Kurul - TSE EN 12697-1 Bitümlü karışımlar-Sıcak asfalt karışımları için deney yöntemleri - Bölüm1:Çözünür bağlayıcı içeriği - TS ISO 7181 Hidrolik akışkan gücü-Silindirler-Piston ve piston kol tarafı efektif alanı oranları - TS ISO 6406 Gaz tüpleri - Dikişsiz çelik gaz tüpleri - Periyodik muayene ve deneyler Grup Adı: Tesisat ve Basınçlı Kaplar Özel Daimi Komitesi - TS EN 1802 Gaz tüpleri - Taşınabilir - Dikişsiz alüminyum alaşımlı gaz tüpleri için periyodik muayene ve deney Grup Adı: TK22: Tesisat ve Basınçlı Kaplar Teknik Komitesi - TS ISO 6406 Gaz tüpleri - Dikişsiz çelik gaz tüpleri - Periyodik muayene ve deneyler Grup Adı: Sağlık İhtisas Grubu - TSE K 142 Kolloidal gümüş esanslı dezenfektan Türk standardlarının yürürlükten kaldırıldığını bildirilmektedir, bilgisi yer almaktadır Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 2.000 Ton Yağlık Mahsul Ayçiçek Satış İhalesi
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,20.08.2020 günü saat 10.00’da Şanlıurfa Ticaret Borsasında işletmemize ait 2020 yılı istihsali 2.000 ton mahsul ayçiçeğin açık artırma usulü satış ihalesi yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinde yayınlanmıştır, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Belucistan Yatırım Rehberi Hk.
Sayın Üyemiz, İlgi : Pakistan Büyükelçiliği nin 10.08.2020 tarihli ve 19 sayılı yazısı. İlgide kayıtlı yazıda, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Pakistan ın eyaletlerinden biri olan Belucistan ın maden, enerji, hayvancılık, tarım ve turizm sektörlerine yönelik yatırım potansiyeli hakkında genel bilgileri içeren bir rehber hazırlandığı bildirilmektedir. Belucistan Hükümeti Yatırım ve Ticaret Kurulu tarafından hazırlanan bahse konu rehber ekte sunulmaktadır. Yazıda devamla, söz konusu rehberin Belucistan da bulunan özel ekonomik bölgelere yönelik genel bilgileri de içerdiği bildirilmekte olup, konu hakkında yine Belucistan Hükümeti Yatırım ve Ticaret Kurulu tarafından hazırlanan videoya https://www.youtube.com/watch?v=Toswcwy3nhU adresinden ulaşılabileceği iletilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Mercimek, Nohut ve Kuru Fasulye Kalite Kriterleri
Sayın Üyemiz, Ticaret Bakanlığı,İç Ticaret Genel Müdürlüğünden Borsamıza gelen yazıda, 5300 sayılı Tarım Ürünleri Lisanslı Depoculuk Kanunu ve bu Kanuna dayanılarakçıkarılan Yetkili Sınıflandırıcıların Lisans Alma, Faaliyet ve Denetimine İlişkin Yönetmeliğin18 nci maddesi kapsamında lisanslı depolarda depolanan ürünler, yetkili sınıflandırıcılartarafından TSE standartlarına veya Bakanlığımızca belirlenen standartlara göre analiz edilereksınıflandırılmakta olup lisanslı depo işletmelerinde depolanacak kırmızı ve yeşil mercimekürünlerinin sınıflandırılmasında uygulanacak kalite kriterleri 01/07/2019 tarihinde, nohutürününün sınıflandırılmasında uygulanacak kalite kriterleri ise 18/06/2019 tarihindeonaylanarak ilan edilmiştir. Bu kapsamda, kırmızı ve yeşil mercimek ile nohut ürününe ilişkin kalite kriterlerindedeğişiklik öngören kriterler ile kuru fasulye ürününe ilişkin kalite kriterleri, 30/07/2020 tarihlive 56288994 sayılı Bakanlığımız onayı ile ekteki şekilde yürürlüğe konulmuştur, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
INOTEX 2020 Hk.
Sayın Üyemiz, İlgi : Dışişleri Bakanlığı nın 07.08.2020 tarihli ve 31593114 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, daha önce 6-9 Haziran 2020 tarihleri arasında Tahran da düzenlenmesi planlanan Dokuzuncu Uluslararası İnovasyon ve Teknoloji Fuarı nın (INOTEX 2020) 12-15 Ağustos 2020 tarihlerinde sanal ortamda düzenleneceği bildirilmektedir. Bahse konu fuara ilişkin bilgilerin yer aldığı broşür ekte sunulmakta olup, ayrıntılı bilgilere www.inotex.com internet adresinden ulaşılması mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB ETÜ - Tanıtım Günleri
Sevgili Gençler, İş dünyamızın üniversitesi TOBB ETÜ ile kariyerinize üniversitede başlayabilirsiniz. Mezun olmadan 1 yıl iş tecrübesi kazanabilir ve profesyonel hayata bir adım önde başlayabilirsiniz.www.etu.edu.tr
Sağlam KOBİ Dijitalleşme ve Afet Dayanıklılığı Programı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Google Türkiye veİdemaişbirliğinde COVID-19 döneminde afet ile mücadele ve iyileşme süreçlerinde KOBİ lere destek sağlama vizyonu ile KOBİ leri afetlere hazırlık, dayanıklılık ve iş sürekliliği kapasitelerini geliştirmek amacıyla "Sağlam KOBİ Dijitalleşme ve Afet Dayanıklılığı Programı" projesi hayata geçirilmiştir. Bu çerçevede KOBİ lerin dijitalleşmelerini sağlama ve afetlere hazırlama konularındahttps://dijital.saglamkobi.org/program-hakkindaadresinde yer alan program kapsamında 12 Ağustos – 8 Ekim tarihleri arasındawebinarlargerçekleştirilecektir. Webinarlarakatılım ücretsiz olup, katılmak için http://dijital.saglamkobi.orgadresinden kayıt olunması gerekmektedir. Ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ekvator Ginesi ile Ticaret Hk
Sayın Üyemiz, İlgi : Dışişleri Bakanlığı nın 06.08.2020 tarihli ve 31582354 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Malabo Büyükelçiliğimiz ile Ekvator Ginesi Adalar Bölgesi Ticaret, Tarım ve Orman Odası yetkilileri arasında bir görüşme gerçekleştiği bildirilmektedir. Bahse konu görüşmede, Bioko Adası nda çeşitli sektörlerde faaliyet gösteren Ekvator Ginesi şirketlerinin ülkemizdeki firmalarla ticari bağlantılar kurup geliştirmeyi arzu ettiklerini ifade ettikleri ve anılan ülke ile ticaret yapmak isteyen şirketler ve ürünleri hakkında tanıtıcı bilgi ve belge talebinde bulundukları belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kazakistan da Sanayi Projeleri
Sayın Üyemiz, İlgi: Sanayi ve Teknoloji Bakanlığının 13.07.2020 tarih ve 93000617-724.01.03 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda,İlgide kayıtlı yazıda, Türk Konseyi (TK) Sekretaryası Nota sına atıfla, TK VII. Zirvesinde TK üye/gözlemci devletler arasında yatırımların daha da artırılması ve ortak yatırımların teşviki için yeni mekanizmaların kurulması yönünde çağrıda bulunulduğu belirtilmekte olup, 06/05/2020 tarihinde düzenlenen Ekonomi/Ticaret Bakanları ve Gümrük İdareleri Başkanları Toplantısında, Kazakistan Milli Ekonomi Bakanı nın, Kazakistan da 2020-2024 yıllarında hayata geçirilmek üzere yaklaşık 100 milyar Dolarlık yatırım projeleri havuzunun Kazak Hükümeti tarafından kabul edildiği bildirilmektedir. İlgilenen firmalarımızın Sanayi ve Teknoloji Bakanlığı na ( e-posta: sinan.durmaz@sanayi.gov.tr) başvurması gerekmektedir. Ayrıntılı bilgi ekte bilgilerinine sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkmenistan Yatırımlar Web Sitesi Hk.
Sayın Üyemiz, İlgi: Ticaret Bakanlığının 27.07.2020 tarih ve 46473657-724.01.03 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Türkmenistan da başta petrolgaz ve enerji kaynaklarının işlenmesi alanlarında olmak üzere hayata geçirilmesi planlanan projeler ile ilgili olarak yatırımcıların ihtiyaç duyabileceği tüm bilgilerin çevrim içi derlendiği, Türkmenistan Maliye ve Ekonomi Bakanlığı tarafından hazırlanan www.invest.gov.tm internet sitesinin faaliyete geçirildiği bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Ürün Satışları Hakkında
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda, Çeşitli ürün satışlarına ait açıklama yer almaktadır. Açıklama ve ayrıntılar ekteki dokümanlarda bilgilerinize sunulmuştur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Ticaret Müşavirlerimizle Elektronik Sohbetler Sunumları
Sayın Üyemiz, İlgi : a) 03.07.2020 tarihli ve 5705 sayılı yazımız. b) 13.07.2020 tarihli ve 6065 sayılı yazımız. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazılarımız ile duyuruları yapılan; 7 Temmuz 2020 tarihinde Cezayir, 8 Temmuz 2020 tarihinde Fas, 14 Temmuz 2020 tarihinde Suudi Arabistan, 16 Temmuz 2020 tarihinde ise Birleşik Arap Emirlikleri nde görev yapmakta olan Ticaret Müşavirlerimiz ve anılan ülkelerde yerleşik iş insanlarımızın konuşmacı olarak katıldığı e-sohbet toplantılarının sunumları ilgili Ticaret Müşavirliklerimizden temin edilmiş olup, ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Kamuoyu Açıklaması ( Mısır Alım Fiyatı)
Sayın Üyemiz, TMO nin yapmış olduğu Kamuoyu Açıklamasında2020 yılı hasat dönemi mısır alım fiyat ve politikalarından bahsedilmiş olup ayrıntılı bilgi içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan, Gelir Vergisi Kanununda Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede yayınlanan, Gelir Vergisi Kanununda yapılan değişiklikler hakkında ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Ayrıntılı bilgi içinTIKLAYINIZ. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan, Mal ve Hizmetlerde Uygulanacak KDV Oranlarında Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede yayınlanan, mal ve hizmetlerde uygulanacak KDV oranlarında yapılan değişiklikler hakkında ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Ayrıntılı bilgi içinTIKLAYINIZ. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Dışişleri Bakanımızın Dominik Cumhuriyeti, Haiti ve Venezuela Ziyaretleri
Sayın Üyemiz, İlgi : Dışişleri Bakanlığı’nın 29.07.2020 tarih ve 31566850 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Dışişleri Bakanı Sayın Mevlüt Çavuşoğlu nun 5-17 Ağustos 2020 tarihleri arasında Dominik Cumhuriyeti, Haiti ve Venezuela ya resmi ziyaretlerde bulunması öngörüldüğü bildirilmektedir. Bu çerçevede, konunun ilgili üyelerinize duyurularak, Sayın Bakanımızın muhataplarıyla yapacağı görüşmelerde yararlanılmak üzere, ülkemizle Dominik Cumhuriyeti, Haiti ve Venezuela arasında geliştirilebilecek işbirliği alanları, ziyaret sırasında imzalanabilecek anlaşmalar ve gündeme getirilmesinde yarar görülen konulara ilişkin görüşlerinizin 4 Ağustos 2020 Çarşamba günü mesai saati bitimine kadar Borsamıza (E-posta: eskisehirtb@tobb.og.tr) iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Bakliyat, Pirinç ve Çeltik Satışları
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, Kurumun stoklarında bulunan bakliyat, pirinç ve çeltik ekte belirtilen esaslar ile 04-25 Ağustos 2020 tarihleri arasında peşin bedel ile satılacağı belirtilmiştir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Mediterranean Building Exhibition Hk
Sayın Üyemiz, İlgi : Tunus Büyükelçiliği nden alınan 28.07.2020 tarihli ve 273 sayılı yazı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Tunus un Ankara Büyükelçiliğinden alınan ilgide kayıtlı yazıda, Tunus ta 3-6 Mart 2021 tarihlerinde, "Mediterranean Building Exhibition (MEDIBAT)" adlı etkinliğin gerçekleştirileceği bildirilmektedir. Bahse konu etkinliğin, ekolojik yapılar ve yeni yapı teknolojilerin sunulmasına imkan vereceği ve bu alanda faaliyet gösteren firmaları bir araya getirerek iş birliği fırsatlarını geliştireceği ifade edilmektedir. Etkinlik kapsamında gerçekleştirilecek fuara ek olarak, Ekonomik, Bilim, Yenilik ve Girişimcilik Forumları, iş toplantıları ve workshopların da düzenleneceği bildirilmektedir. Bu çerçevede, bahsi geçen etkinliğe ilişkin detaylı bilgilere https://www.salon-medibat.com/en/ adresinden ulaşılabilmektedir Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KTO Karatay Üniversitesi Ahilik Bursu Protokolü Hk.
Sayın Üyemiz, KTO Karatay Üniversitesinden Borsamıza gönderilen yazıda, üniversite-sanayi iş birliği ile Türk eğitim sistemine âdeta yeni bir soluk getirmiştir. İş arayan değil, işte aranan ve iş kuran mezunlar yetiştirmeyi hedefleyen KTO Karatay Üniversitesinde öğrencilere geniş staj imkânının yanı sıra Sektör Danışmanlığı Projesi ile iş tecrübesi sunulmaktadır. Bu proje ile söz gelimi 4 yıllık bir programda olan öğrencimiz, 4 yıllık bir iş deneyimiyle mezun olmakta, iş hayatına daima daha önde başlamaktadır. Çift anadal (ÇAP) çeşitliliği bakımından Türkiye’nin sayılı üniversiteleri arasında yer alan KTO Karatay Üniversitesi; 31 lisans, 11 ön lisans ve 31 lisansüstü programı ile toplamda 73 programda eğitim-öğretim faaliyetlerini sürdürmektedir. KTO Karatay’da Hukuk Fakültesinden Tıp Fakültesine, Pilotajdan İslam İktisadı ve Finans Bölümüne dek aday öğrenciler için geniş bir bölüm yelpazesi bulunmaktadır. Türkiye’nin en geniş ve kapsamlı burs programlarını öğrencilerine sunarak gerçek bir vakıf üniversitesi misyonunu kararlılıkla sürdürmeye çalışıyoruz. Bu kapsamda iş dünyası için de “Ahilik Bursu” adı altında bir burs imkânı sağlıyoruz. Ahilik geleneğini günümüzde de yaşatmanın, günümüz ahilerinin yani günümüz iş adamlarının görevi olduğuna inanıyoruz. Böylece Ahilik Bursu ile Ahilik ilişkilerimizi daha da geliştirmeyi ve kuvvetlendirmeyi amaçlıyoruz. Üniversitemizle protokol yapan TOBB’a bağlı ticaret odaları, sanayi odaları, ticaret ve sanayi odaları ve ticaret borsalarının üyelerine, birinci derece yakınlarına ve eşlerine, ücretli kontenjandan kayıt yaptırmaları hâlinde % 15 oranında Ahilik Bursu indirimi sağlanmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İstanbul Ticaret Borsası Gıda İsrafını Engelleme Proje Yarışması
Sayın Üyemiz, İstanbul Ticaret Borsası ülkemizdeki gıda israfının önlenmesi bilincinin geliştirilmesini, kamuoyunda farkındalık oluşturulmasını ve gıda israfının önlenmesi için etkili bulunmasını hedefleyen proje yarışması başlatmıştır. Projenin kapsamı gıda israfında özellikle depolama, distribütörler, perakendeciler ile lokantalar, oteller, hastaneler, okullar, evler ve sair tüketici ayağında gıda israfının önlenmesi, ayrıca israf olacak gıdanın toplanması ve değerlendirilmesidir. Tüm üniversite öğrencileri yarışmaya katılabilirler. Yarışmanın son başvuru tarihi30 Kasım 2020’dir. Başvuru koşulları ve detaylı bilgi için lütfentıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Dalında Fıstık Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,27.07.2020 günü saat:14:00 da işletmemizin 2020 yılı istihsali 100.000 kg. yaş salkımlı, cumbalı fıstıkların dalında satış tekrarı 1 (bir) parti halinde pazarlık usulü teklif alma ile yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Islamic Food Processing Association (IFPA) Hk.
Sayın Üyemiz, İlgi : İslam Ticaret, Sanayi ve Tarım Odası nın 22.07.2020 tarihli ve 223 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, "Islamic Food Processing Association" (IFPA) isimli girişimin lansman etkinliği için, İslam Ticaret, Sanayi ve Tarım Odası (ICCIA) Genel Sekreterliği ile Islamic Organization for Food Security isimli kuruluşun işbirliği yaptığı bildirilmektedir. Bahse konu girişimin, gıda ile ilgili tüm alanlarda yatırımcıları ve iş insanlarını içeren kıtalar arası bir girişim olmasının beklendiği, İslam İşbirliği Teşkilatı üye ülkeleri için gıda güvenliğini sağlamak amacıyla önemli tarım ürünleri üreticileri ve gıda endüstrisinin geliştirilmesindeki tüm paydaşları bir araya getireceği belirtilmektedir. Yazıda devamla, söz konusu girişimin tanıtımının 27 Temmuz 2020 Pazartesi günü Türkiye saatiyle 12:00 de video konferans formatında gerçekleştirileceği bildirmektedir. Konuya ilişkin İslam Ticaret, Sanayi ve Tarım Odası ndan alınan yazı ekte iletilmekte olup, ilgilenenlerin ifpa@iofs.org.kz adresi üzerinden organizatörlerle iletişime geçmesi mümkündür, bilgisi yer almaktadır. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye İtalya JETCO Toplantısı Hk.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ticaret Bakanlığı ndan alınan bilgiye istinaden, 29 Temmuz 2020 tarihinde Ticaret Bakanımız Sn. RuhsarPekcan ve İtalya Dışişleri ve Uluslararası İşbirliği Bakanı Sn. Luigi Di Maio nun katılımlarıyla Türkiye İtalyaJETCO Toplantısı gerçekleştirilecektir. Bu kapsamda, söz konusu toplantıyı izlemek üzere aşağıda bulunan linkten erişim sağlanabilecek olup, izleyicilerin toplantıya bağlı kaldıkları sürece mikrofon ve kameralarının kapalı bulundurulması gerekmektedir. Bağlantı linki: https://stream.lifesizecloud.com/extension/4708519/59fa72ea-3de4-423e-917a-13071961d769 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Balyalı Kuru Yonca Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,29.07.2020 günü saat:14:00 da işletmemizin 2020 yılı istihsali 1.000 ton balyalı kuru yonca otunun 1 (bir) parti halinde açık artırma usulü ile satış tekrarı ihalesi yapılacaktır. ihale ile ilgili evraklar www.tigem.gov.tr elektronik adresinin ihaleler bölümünde yayınlanmıştır, bilgisi yer almaktadır. Saygılarımızla, Genel Sekreter Gültekin GÜLER
KOBİGEL - KOBİ Gelişim Destek Programı
Sayın Üyemiz, Ülkemizin ulusal ve uluslararası hedefleri doğrultusunda, KOBİ lerin ekonomideki paylarının ve etkinliklerinin arttırılması, rekabet güçlerinin ve sağladıkları katma değerin yükseltilmesi amacıyla KOSGEB tarafından KOBİGEL – KOBİ Gelişim Destek Programı yürürlüğe konulmuştur. Program kapsamında;  2020 – 01 Proje Teklif Çağrısı: "İmalat sanayi sektöründe dijitalleşme sürecine katkı sağlayabilecek yerli teknoloji geliştiricisi KOBİ lerin desteklenmesi"  2020 – 02 Proje Teklif Çağrısı: "İmalat sanayi sektöründe faaliyet gösteren KOBİ lerin üretim ve ilişkili iş süreçlerinde dijital teknolojilerden yararlanma düzeyinin arttırılması" teklif çağrıları yayınlanmıştır. Proje Teklif Çağrısı kapsamında işletme başına 300.000 TL ye kadar geri ödemesiz, 700.000 TL ye kadar geri ödemeli (teminat veya KGF kefaleti karşılığı) olmak üzere toplam 1.000.000 TL ye kadar destek verilebilecektir. Son başvuru tarihi 17 Eylül 2020 dir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çerezlik Ayçiçek Toplantısı
Sayın Üyemiz, Çerezlik ayçekirdeği nin kalite parametrelerinin belirlenerek sınıflandırılması ve lisanslı depolarda depolanması gerektiği hakkında 24.07.2020 cuma (yarın) saat 11:00 de Kayseri Ticaret Borsası tarafından video konferans yöntemi ile bir toplantı gerçekleştirilecektir. İlgilenen üyelerimizin 23.07.2020 perşembe (bugün) saat 13:00 e kadar 05057996585 numaralı telefondan borsamız personeli Egemen Akbulut ile irtibata geçmeleri gerekmektedir. İlgili yazı ekte bilgilerinize sunulmuştur. Bilgilerinize sunulur.
İş birliği Teklifi
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 20.07.2020 tarihli ve 55958788 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Tahran Ticaret Müşavirliğimizden alınan bir yazıya atfen, İran Tarım Seferberliği Bakanlığı ile bir toplantı gerçekleştirildiği ifade edilmektedir. Söz konusu toplantıda; bitki sağlığı ve güvenliği, geleneksel tıp, organik ürünler ve bitkisel ilaç alanında iki ülke arasında teknik iş birliği anlaşması imzalanmak istendiği, İran ın ihraç ürünleri olan safran, mantar, hurma, kuru üzüm, lavanta, gül, kekik, nar, çamfıstığı kabuğu vb. diğer bazı bitki ve bitkisel ürünler için ülkemizdeki ilgili kurumlarla iş birliği ve gerekli durumlarda ortak markalaşma çabalarına girmek istendiği belirtilmektedir. Ayrıca, nar çekirdeğinin yağını almak için ülkemizde teknolojisi bulunan bir şirketle İran da ortak yatırım yapılmasının arzu edildiği dile getirilmektedir. Ek olarak, meyve-sebze kurutma, kuruyemiş dezenfektanı, paketleme, ambalajlama ve otomatik hasat makinelerine ihtiyaç duyulduğu ve söz konusu makineleri Türkiye de üreten veya satan firmalarla tanışmak istedikleri, ülkemizin olumlu yatırım ortamı ve pazar olanakları nedeniyle Türkiye de ortak yatırım yapılabileceği vb. hususları üzerinde durulmaktadır. Yazıda devamla, yoplantıda belirtilen hususlarla ilgilenen firmalarımızın M. Hasan Ebrahimi - Zist Atisazan Sabz (zas_green@hotmail ; 0098 912 803 30 50) iletişim bilgileri kanalıyla irtibata geçmelerinin mümkün olacağı belirtilmiş olup, firmalarımızın İran tarafı ile irtibata geçmeden önce Tahran Ticaret Müşavirliğimizin web sitesini (https://ticaret.gov.tr/yurtdisi-teskilati/guney-asya/iran/raporlar) ziyaret etmeleri ve gerekli durumlarda Müşavirliğimizle temasa geçmelerinde fayda görülmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hollanda Sohbet Toplantısı
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 20.07.2020 tarih ve 55975723 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda, İlgide kayıtlı yazıda, Ticaret Bakanlığı tarafından, Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere "Ticaret Müşavirlerimizle Elektronik Sohbetler" adıyla on-line toplantıların düzenlendiği belirtilmektedir. Bu çerçevede, Hollanda da görev yapmakta olan Ticaret Bakanlığı temsilcileri ile Hollanda da yerleşik iş insanlarımızın konuşmacı olarak katılacağı e-sohbet toplantısının 23 Temmuz 2020 Perşembe günü 15.00-16.30 saatleri arasında gerçekleştirileceği ifade edilmektedir. Etkinliğe ilişkin program ile erişim linki Birliğimiz web sitesi (www.tobb.org.tr) sağ panelinde "Hizmetler" başlığı altındaki Uluslararası İş İmkânları/Yurtdışı Etkinlikler bölümünden temin edilebilmektedir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Lokanta/Restoran/Kafe/Kıraathane vb. İşyerlerinin Çalışma Saatleri Hakkında
Sayın Üyemiz, İçişleri Bakanlığı’nın 21.07.2020 tarihli Lokanta, Restoran, Kafe, Kıraathane vb. İşyerlerinin Çalışma Saatleri Hakkındaki ekte yer verilen genelgesi kapsamında, Koronavirüs Bilim Kurulu tarafından sektörel bazda yayımlanan rehberlerde belirtilen tedbirlere riayet edilmesi kaydıyla 21.07.2020 tarihinden itibaren lokanta, restoran, kafe, kafeterya, çorbacı, kokoreççi, çiğ köfteci, kıraathane, kahvehane, çay bahçesi, dernek lokali vb. işletmelerin çalışma saatlerine yönelik kısıtlamaların kaldırılmasına; belirtilen işletmelerin genel mevzuatları ve ruhsatlarında belirtilen saat aralıklarında faaliyette bulunabilmelerine karar verilmiştir. İlgili genelge ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Avrupa Birliği İşletmelerin ve KOBİ’lerin Rekabet Edebilirliği (COSME) Programı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Avrupa Birliğinin, "İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı (COSME)" kapsamında, Avrupa KOBİ lerinin AB dışındaki kamu alımlarına ulaşmasını amaçlayan "KOBİ lerin AB Dışındaki Kamu Alımlarına Katılmalarının Desteklenmesi" başlıklı bir proje teklif çağrısı yayınlanmıştır. Son başvuru tarihi 15 Eylül 2020 olan proje teklif çağrısına, proje başvuru dokümanları ve rehberine, Avrupa Komisyonunun "https://ec.europa.eu/research/participants/data/ref/other_eu_prog/cosme/wp-call/callfiche_cos-ppout-2020-2-03_en.pdf" internet sayfasından ulaşılabilmektedir. Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB, elektronik posta: abkoordinasyon@kosgeb.gov.tr), programın ulusal koordinasyonundan sorumlu kurum olarak yetkilendirilmiştir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Akkuyu Nükleer Santral Projesi - İhale Süreçleri
Sayın Üyemiz, İlgi : Enerji ve Tabii Kaynaklar Bakanlığı nın 08.07.2020 tarih ve 63067023-500-E.19026 sayılı yazısı Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Enerji ve Tabii Kaynaklar Bakanlığı, Nükleer Enerji ve Uluslararası Projeler Genel Müdürlüğü nden alınan ilgi yazıda; Akkuyu Nükleer A.Ş. ihalelerine katılmak isteyen Türk firmalarına ihale başvuruları konusunda yardımcı olunması ve bilgilendirme maksadıyla ana yüklenici tarafından İstanbul da Tedarikçi İlişkileri Birimi kurulduğu ve bilgilendirme hattı açıldığı bildirilmektedir. EK: Akkuyu Nükleer Santral Projesi - İhale Süreçleri Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler - Fransa
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 17.07.2020 tarihli ve 55933771 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Ticaret Bakanlığı na bağlı olarak dünyanın dört bir yanında ihracatımızın geliştirilmesi için çalışmakta olan Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere Ticaret Bakanlığı tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" toplantıları düzenlendiği bildirilmektedir. Bu kapsamda yazıda devamla, 21 Temmuz 2020 Salı günü 15.00-16.30 saatleri arasında Fransa da görev yapmakta olan Ticaret Müşavir ve Ataşelerimiz ile ülkede yerleşik iş insanlarımızın konuşmacı olarak katılımıyla e-sohbet toplantısı gerçekleştirileceği belirtilmektedir, bilgisi yer almaktadır. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Soğan/Patates İhracatı
Sayın Üyemiz, 19.07.2020 tarihli Resmi Gazetede belirtildiği üzere, İhracı Ön İzne Bağlı olan “Soğan ile Taze veya Soğutulmuş Patatesin” ön izin şartı kaldırılmıştır. Ayrıntılı bilgi için TIKLAYINIZ. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İhale İçin Niyet Beyanı
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 14.07.2020 tarihli ve 55836308 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda, İlgide kayıtlı yazı ekinde Birliğimize iletilen, Maputo Ticaret Müşavirliğimiz tarafından gönderilen bir yazıya atfen, Mozambik te faaliyet gösteren Güney Afrika Merkezli Sasol firmasının boru hattı inşası için kaplanmış boru alımına yönelik ilan ettiği niyet beyanı ilanı ekte sunulmuştur, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 500.000 KG. Yaş Salkımlı, Cumbalı Fıstık Satış Tekrarı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,21.07.2020 günü saat:14:00 da işletmemizin 2020 yılı istihsali 500.000 kg. yaş salkımlı, cumbalı fıstıkların dalında satış tekrarı 2 (iki) parti halinde kapalı zarf teklif alma usulü ile yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Geçit Kuşağı Tarımsal Araştırma Enstitüsüne ait sap satışına ait ihale ilanı
Sayın Üyemiz, Geçit Kuşağı Tarımsal Araştırma Enstitüsü Döner Sermaye İşletmesi, sap satışına ait ihale ilanı ile ilgili gerekli bilgiler ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Rize Çay Araştırma ve Uygulama Merkezi
Sayın Üyemiz, Rize Ticaret Borsasının Çay Araştırma ve Uygulama Merkezi (Çaymer) çay üretim tesislerinde ürettiği çayların satışına başlanmıştır. İlgilenen Üyelerimizin Bilgisine sunarız. Konu ile ilgili ayrıntılı bilgi için tıklayınız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hijyen ve COVID-19 Belgeleri Semineri (İnternet Üzerinden)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Türk Standardları Enstitüsü (TSE) nin hijyen ve COVID-19 çalışmaları hakkında 21 Temmuz 2020 Salı günü saat 10:30 da internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin duyuru metni ekte yer almaktadır. TSE Başkanı Prof. Dr. Sn. Adem Şahin in katılımı ile gerçekleştirilecek olan seminerde COVID-19 Güvenli Üretim, Hizmet ve Turizm Belgeleri ile COVID-19 Hijyen, Enfeksiyon Önleme ve Kontrol Kılavuzu anlatılacak olup, seminer sonunda KOBİ lerin soruları cevaplandırılacaktır. Tüm üyelerimize katılım ücretsizdir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Et Süt Kurumu Deri ve Sakatat Satışı
Sayın Üyemiz, Et Süt Kurumu Genel Müdürlüğünden Gönderilen yazıda,sırttan düşme büyükbaş hayvan derisi (kelle derisi dâhil), büyükbaş hayvan sakatatı ve yan ürünleri, küçükbaş hayvan derisi ve bağırsak ile küçükbaş hayvan sakatatı satışı yapılacaktır, bilgisi yeralmaktadır. Ayrıntılı bilgi için lütfen tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yabancıların Bosna-Hersek te İkameti ve Çalışmalarına İlişkin Mevzuata Dair Kitapçık
Sayın Üyemiz, İlgi : Dışişleri Bakanlığı nın 13.07.2020 tarihli ve 31509331 sayılı yazısı Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Bosna-Hersek te faaliyet gösteren bir firmamızın yerel Hukuk Müşaviri Adnan Hadzimusiç tarafından, Saraybosna Ticaret Müşavirliğiyle işbirliği ve Saraybosna Büyükelçiliğimizle istişare içinde ekte bir örneği sunulan "Bosna Hersek te Yabancıların İkameti ve Çalışması" isimli kitapçığın hazırlandığı bildirilmektedir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yeni Normalde Liderlik Eğitimi
Sayın Üyemiz, Türk-Alman Ticaret ve Sanayi Odasından Borsamıza gelen yazıda, dünya genelinde yaşanan COVID-19 salgını yalnızca günlük alışkanlıklarımızı değil, iş hayatımızı daderinden etkilemiştir. Pandemi öncesi bazı şirketlerin başlatmış olduğu dijitalleşme ve Home-Officedüzeni artık birçok şirket için vazgeçilmez bir unsur haline gelmiştir.Bu kapsamda yalnızca çalışanların değil, yöneticilerin ve liderlerin de kendilerini yenileme vegeliştirme ihtiyacı ortaya çıkmıştır.TD-IHK olarak, bu alışılmışın dışındaki düzende çalışanlarınızı ve ekiplerinizi daha verimli bir şekildeyönetmeniz ve olası krizleri başarıyla atlatabilmeniz için Koç ve Danışman Sayın Çiğdem Güven’lebirlikte hazırlamış olduğumuz eğitim programını duyurmak isteriz, bilgisi yer almaktadır. Eğitim Programı ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2020/03 Sayılı Il Hayvan Saglık Zabıtası Komisyon Kararları Hk.
Sayın Üyemiz, Tarım ve Orman Bakanlığı Eskişehir İl Müdürlüğünden Borsamıza gelen, 09.07.2020 tarih ve 2020/03 karar nolu Eskişehir İli Hayvan Sağlık ZabıtasıKomisyon Kararı yazısı ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Eskişehir Tarım Fuarı 2020, 2. Tarım, Hayvancılık ve Teknolojileri Fuarı
Sayın Üyemiz, 30 Eylül - 4 Ekim 2020 tarihlerinde ETO – TÜYAP Fuar Merkezi’nde gerçekleşecek olan Eskişehir Tarım Fuarı 2. Kez tüm Tarım sektörünü biraraya getirmeye hazırlanıyor. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
01.07.2020 Tarihinde Yürürlüğe Giren Kira Sözleşmeleri Hakkında Önemli Bilgilendirme
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda, 01.07.2012 de yürürlüğe giren 6098 sayılı Türk Borçlar Kanunu ile birlikte, mesken ve işyeri olarak kullanılan taşınmazların tabi olduğu hukuki rejim büyük ölçüde tek Kanun altında toplanmış ve ortak hükümlere tabi kılınmıştır. Bununla birlikte 14.04.2011 tarihli Resmi Gazetede yayımlanan "Yargı Hizmetlerinin Hızlandırılması Amacıyla Bazı Kanunlarda Değişiklik Yapılmasına Dair Kanun un" geçici 2 nci maddesiyle belli hükümlerin uygulanması ertelenmiştir. Anılan hükme göre: "Kiracının Türk Ticaret Kanununda tacir olarak sayılan kişiler ile özel hukuk ve kamu hukuku tüzel kişileri olduğu işyeri kiralarında, 11/1/2011 tarihli ve 6098 sayılı Türk Borçlar Kanununun 323, 325, 331, 340, 342, 343, 344, 346 ve 354 üncü maddeleri 1/7/2012 tarihinden itibaren 8 yıl süreyle uygulanmaz. Bu halde, kira sözleşmelerinde bu maddelerde belirtilmiş olan konulara ilişkin olarak sözleşme serbestisi gereği kira sözleşmesi hükümleri tatbik olunur. Kira sözleşmelerinde hüküm olmayan hallerde mülga Borçlar Kanunu hükümleri uygulanır". Bahsi geçen hüküm nedeniyle 01.07.2020 tarihinde yürürlüğe giren düzenlemeler, tacir olarak sayılan kişiler ile özel hukuk ve kamu hukuku tüzel kişilerine yapılan işyeri kiralarını kapsamaktadır. Bu kapsamda yürürlüğe giren düzenlemeler şu şekildedir: 1. Kira İlişkisinin Devri 8 (m. 323) Kiracısı tacir veya tüzel kişi olan işyerlerinde; Kiracı, kiraya verenin yazılı rızasını almadıkça, kira ilişkisini başkasına devredemeyecektir. Kiraya veren ise, işyeri kiralarında haklı sebep olmadıkça bu rızayı vermekten kaçınamayacaktır. Kiraya verenin yazılı rıza vermesi halinde, kira ilişkisi kendisine devredilen kişi (yeni kiracı), kira sözleşmesinde kiracının (eski kiracı) yerine geçer ve devreden kiracı, kiraya verene karşı borçlarından kurtulur. Ancak işyeri kiralarında devreden kiracı, kira sözleşmesinin bitimine kadar ve en fazla iki yıl süreyle devralanla birlikte müteselsilen sorumlu olur. 2. Sözleşmenin Bitiminden Önce Kiralananın Geri Verilmesi (m. 325) Kiracının, kiralanan yeri sözleşme süresinin dolmasından önce feshetmesi halinde, kira sözleşmesinden doğan borçlar, kiralananın benzer koşullarla kiraya verilebileceği makul bir süre için devam edecektir. Kiracının bu süre içerisinde kabul etmesi beklenebilecek, ödeme gücüne sahip ve kira ilişkisini devralmaya hazır yeni bir kiracı bulması hâlinde, kiracının kira sözleşmesinden doğan borçları da sona erecektir. Kiraya veren, yapmaktan kurtulduğu giderler ile kiralananı başka biçimde kullanmakla elde ettiği veya elde etmekten kasten kaçındığı yararları kira bedelinden indirmekle yükümlüdür. 3. Olağanüstü Fesih (m. 331)Eski Borçlar Kanunu ndan farklı olarak hem belirli hem de belirsiz süreli sözleşmelerde, taraflardan her biri, kira ilişkisinin devamını kendisi için çekilmez hâle getiren önemli sebeplerin varlığı durumunda, sözleşmeyi yasal fesih bildirim süresine uyarak her zaman feshedebilir. Hâkim, durum ve koşulları göz önünde tutarak, olağanüstü fesih bildiriminin parasal sonuçlarını karara bağlar. 4. Bağlantılı Sözleşme (m. 340) Sözleşmenin kurulması ya da sürdürülmesi, kiracının yararı olmaksızın, kiralananın kullanımıyla doğrudan ilişkisi olmayan bir borç altına girmesine bağlanmışsa, kirayla bağlantılı sözleşme geçersizdir. Bu düzenlemeden hareketle, kiracının yarar sağlayacağı ve doğrudan kiralanan yerin kullanımıyla bağlantısı olmayan sözleşmeler yapılamayacaktır. Söz gelimi depo, otopark, vale ve benzeri gereksinimleri olmayan bir işyerine ve kiracıya, bu hizmetler için ayrıca kira bedeli yansıtılmayacaktır. 5. Güvence (Depozito) Bedeli (m. 342) Kiracının ödeyeceği güvence bedeli 3 aylık kira bedelinden fazla olmayacaktır. Para niteliğinde olan güvence bedelleri bir bankada vadeli tasarruf hesabına yatırılacaktır. Bu hesaptaki para, kiraya verenin onayı olmaksızın çekilemeyecektir. Banka güvece bedelini ancak iki tarafın rızasıyla veya icra takibinin kesinleşmesiyle ya da kesinleşmiş mahkeme kararına dayanarak geri verilebilecektir. Kiraya veren, kira sözleşmesinin sona ermesini izleyen üç ay içinde kiracıya karşı kira sözleşmesiyle ilgili bir dava açtığını veya icra ya da iflas yoluyla takibe giriştiğini bankaya yazılı olarak bildirmemişse banka, kiracının istemi üzerine güvenceyi geri vermekle yükümlüdür. 6. Kiracı Aleyhine Değişiklik Yasağı (m. 343) Esasen eski Borçlar Kanunu nda da yer alan hüküm gereği; kira sözleşmelerinde kira bedelinin belirlenmesi dışında, kiracı aleyhine değişiklik yapılamayacaktır. 7. Kira Bedelinin Belirlenmesi (m. 344) Yenilenen kira dönemlerinde uygulanacak kira bedeline ilişkin anlaşmaları, bir önceki kira yılında tüketici fiyat endeksindeki oniki aylık ortalamalara göre değişim oranını geçmemek koşuluyla geçerli olacaktır. 5 yıldan uzun süreli veya beş yıldan sonra yenilenen kira sözleşmelerinde ve bundan sonraki her beş yılın sonunda, yeni kira yılında uygulanacak kira bedeli, hâkim tarafından tüketici fiyat endeksindeki oniki aylık ortalamalara göre değişim oranı, kiralananın durumu ve emsal kira bedelleri göz önünde tutularak hakkaniyete uygun biçimde belirlenecektir. Her beş yıldan sonraki kira yılında bu biçimde belirlenen kira bedeli, yukarıdaki ilkelere göre değiştirilebilecektir. Sözleşmede kira bedeli yabancı para olarak kararlaştırılmışsa, beş yıl geçmedikçe kira bedelinde değişiklik yapılamayacaktır. Ancak, Kanunun, "Aşırı ifa güçlüğü" başlıklı 138 inci maddesi hükmü saklı tutulmaktadır. Beş yıl geçtikten sonra kira bedelinin belirlenmesinde, yabancı paranın değerindeki değişiklikler de göz önünde tutularak hâkim tarafından hakkaniyetli bir bedel belirlenebilecektir. Bu noktada 20/2/1930 tarihli ve 1567 sayılı Türk Parasının Kıymetini Koruma Hakkında Kanun hükümleri saklı olduğunu hatırlatmak gerekir. Bir diğer ifadeyle Kanun, yabancı para cinsinden sözleşme yapma yasağına dair bir esneklik getirmemektedir. 8. Kiracı Aleyhine Düzenlemeler (m. 346) Kiracıya, kira bedeli ve yan giderler dışında başka bir ödeme yükümlülüğü getirilemeyecek; Özellikle, kira bedelinin zamanında ödenmemesi hâlinde ceza koşulu ödeneceğine veya sonraki kira bedellerinin muaccel olacağına ilişkin anlaşmalar geçersiz olacaktır. 9. Dava Sebeplerinin Sınırlılığı (m. 354)Dava yoluyla kira sözleşmesinin sona erdirilmesine ilişkin hükümler, kiracı aleyhine değiştirilemeyecektir. Bu hükümle birlikte Türk Borçlar Kanunu nda yer alan "dava yoluyla kira sözleşmesinin sonlandırılması" sebeplerinin, sınırlı sayıda olması sonucu doğmaktadır. 1.7.2020 tarihinden itibaren geçerli olacak bu düzenlemelerle ilgili olarak kiracısı veya kiralayanı olduğunuz taşınmazlarla ilgili gereken hassasiyetin gösterilmesi önem arz etmektedir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza intikal eden yazıda; TOBB ve Polonya Ticaret Odası işbirliğinde, tıbbi ekipmanlar, kozmetik, tekstil ürünleri (giyim), bio teknoloji ve ilaç, gıda ve tarım ürünleri, otomotiv, beyaz eşya ve ev kimyasalları (temizlik ürünleri) alanlarında faaliyet gösteren Polonyalı firmaların katılımıyla, 16 Eylül 2020 Çarşamba günü ZOOM üzerinden "Türkiye-Polonya İş Forumu ve İş Görüşmeleri" gerçekleştirileceği bildirilmiştir. Türkiye ve Polonya daki iş imkanları konusunda sunumların yer alacağı İş Forumu kapsamında Türk ve Polonyalı firmalar arasında, her iki taraftan gerekli talep olması halinde, belirtilen sektörlerde paralel ikili görüşmelerin düzenleneceği belirtilmiştir. İş Forumu Taslak Programı ekte yer almaktadır. İş Forum un sabahki oturumunda açılış konuşmaları ve sunumlara yer verileceği bildirilmiş olup, bu bölümde Türkçe-İngilizce simultane tercüme hizmeti sağlanacağı bilgisi verilmiştir. Forum un öğleden sonraki oturumunda firmalar arası gerçekleştirilecek ikili görüşmelerin ise İngilizce olacağı ifade edilmiştir. Türkiye-Polonya İş Forumu na katılmayı arzu eden firmaların kayıtlarını (İngilizce olarak)polonya.tobb.org.tradresinden en geç 21 Ağustos 2020 Cuma günü mesai bitimine kadar tamamlamaları gerekmektedir. Polonyalı şirketlerin profili, katılımcı listesi ve toplantı için teknik ayrıntılarının, katılım teyidi bildiren firmalarımızla bilahare paylaşılacağı belirtilmiştir. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Çin e İşlenmemiş Kabuklu veya Kabuksuz Antepfıstığı İhracatının Başlaması
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden Borsamıza gönderilen yazıda, Tarım ve Orman Bakanlığı ilgi yazısına atfen "Türkiye den Çin e İhraç Edilen Antepfıstığı için Bitki Sağlığı Gerekliliklerine İlişkin Protokol"ün, 17 Mart 2017 tarihli ve 30010 sayılı Resmi Gazete de yayımlanan Bakanlar Kurulu Kararı ile yürürlüğe girdiği bildirilmektedir. Yazıda, Çin Halk Cumhuriyeti (ÇHC) tarafından uygulamaya konan ilgili mevzuattaki gözetim/karantina gerekliliklerine ve ilgili Protokol ün şartlarına uymak kaydıyla,kabuklu veya kabuksuz işlenmemiş AntepfıstığınınÇHC ye ihracatının yapılabileceği belirtilmiştir. Anılan Protokol e söz konusu ülkeye ihracatta yetkilendirilen depo ve işletme tesisleri listesine, bitki sağlık sertifikası örneğine ve MBr/Fosfin Fumigasyon metodu ile ilgili bilgi/belgelere aşağıda verilen bağlantı adresinden ulaşılabilmektedir. https://www.tarimorman.gov.tr/Konu/2046/Cin_Antepfistigi_Ihracat
Ticari Dolandırıcılık Hakkında (Hong Kong)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza intikal eden yazıda; son dönemde ülkemizde yerleşik firmalar tarafından Hong Kong Ticaret Ataşeliğine iletilen e-postalarda, elektronik ithalat gerçekleştirmek amacı ile Hong Kong firmaları ile işbirliğinde bulunulduğu, buna karşın ödemenin yapılmasını müteakip ilgili Hong Kong firması ile irtibatlarının kesildiği bilgilerinin yer aldığı ifade edilmiştir. Yazıda devamla, önümüzdeki dönemde benzer mahiyette ticari dolandırıcılıkların yaşanmamasını teminen, ülkemizde yerleşik şirketlerin Hong Kong dan gerçekleştirecekleri tedariklerde ekte ismi paylaşılan web adresleri üzerinden alım yapmamalarının önem arz ettiği belirtilmiştir. Bilgilerinize sunarız. Saygılarımızla,
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza intikal eden yazıda; Türkiye ve İskandinav ülkeleri (Danimarka, İsveç ve Norveç) arasındaki işbirliğinin artırılması ve bu ülkelerdeki firmaların ortak Ar-Ge çalışmalarının desteklenmesi için Eurostars Programı Proje Teklif çağrısının açıldığı bildirilmiştir. Eurostars kapsamında, herhangi bir teknoloji alanı ve sektör ayrımı olmaksızın Ar-Ge odaklı faaliyetler yürüten KOBİ lerin ve büyük ölçekli işletmelerin uluslararası Ar-Ge projelerinin desteklendiği belirtilmiştir. Bu kapsamda, en az bir Türk ve bir İskandinav ülkesinden birer kuruluşun katılımıyla, pazara yönelik, yenilikçi ürün ve süreçlerin geliştirilmesi amacı taşıyan uluslararası Ar-Ge projeleri destekleneceği bilgisi verilmiştir. Proje konsorsiyumlarında Ar-Ge yoğun bir KOBİ nin koordinatör olarak yer almasının beklendiği bildirilmiş olup, ayrıca ilgili İskandinav firmaları ile iletişime geçmek ve ortak bulmak için, Türkiye Bilimsel ve Teknolojik Araştırma Kurumu (TUBİTAK) tarafından oluşturulan LinkedIn web sayfasına (https://www.linkedin.com/groups/8789769/) kayıt olunması gerekmektedir. Çağrı için son başvuru tarihinin 03 Eylül 2020 olduğu belirtilmiş olup, başvuruların Eurostars websitesinden (https://www.eurostars-eureka.eu) alınacağı bilgisi verilmiştir. TÜBİTAK, programın ulusal koordinasyonundan sorumlu kurum olarak yetkilendirildiği açıklanmıştır. Detaylı bilgi için kurumun Uluslararası İşbirliği Daire Başkanlığı ile (Eurostars Ulusal Proje Koordinatörü Elif Doğan Arslan, Tel: 0312 298 14 16 e-posta:eurostars@tubitak.gov.tr,www.ufuk2020.org.tr) irtibat kurulması gerekmektedir. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Ticaret Müşavirlerimizle Elektronik Sohbetler - Birleşik Arap Emirlikleri
Sayın Üyemiz, İlgi : a) 13.07.2020 tarihli ve 6065 sayılı yazımız. b) Ticaret Bakanlığı nın 13.07.2020 tarihli ve 21752 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgi (a) da kayıtlı yazımız ile 16 Temmuz 2020 Perşembe günü 15.00-16.30 saatleri arasında Birleşik Arap Emirlikleri nde görev yapmakta olan Ticaret Müşavirlerimiz ve anılan ülkelerde yerleşik iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantısı gerçekleştirileceğinin duyurusu yapılmıştır. Bu defa, Ticaret Bakanlığı nın ilgi (b) de kayıtlı yazısı ile bahse konu e-sohbet toplantısının Microsoft teams linkinin ekte yer aldığı şekilde değiştiği bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sohbetler - Suudi Arabistan ve Birleşik Arap Emirlikleri
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 10.07.2020 tarihli ve 21610 sayılı yazısı. İlgide kayıtlı yazıda, Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere Ticaret Bakanlığı tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" başlıklı toplantılar düzenlendiği bildirilmektedir. Yazıda devamla, 14 Temmuz 2020 Salı günü 14.00-15.30 saatleri arasında Suudi Arabistan; 16 Temmuz 2020 Perşembe günü ise 15.00-16.30 saatleri arasında Birleşik Arap Emirlikleri nde görev yapmakta olan Ticaret Müşavirlerimiz ve anılan ülkelerde yerleşik iş insanlarımızın da konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantıları gerçekleştirileceği ifade edilmekte olup, ayrıntılı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
World of Hunting and Nature Exhibition, Hungary 2021
Sayın Üyemiz, İlgi : Budapeşte Ticaret Müşavirliği nin 13.07.2020 tarihli elektronik postası. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Budapeşte Ticaret Müşavirliğimizin ilgide kayıtlı elektronik postasında, daha önce 1971 yılında Budapeşte de düzenlenmiş olan Macaristan Dünya Expo sunun 50. yılı münasebetiyle Macaristan ın, 2021 yılında "World of Hunting and Nature Exhibition, Hungary 2021" adlı Avcılık ve Doğa Expo sunu düzenleyeceği bildirilmektedir. Yazıda devamla, 25 Eylül-14 ekim 2021 tarihlerinde Budapeşte de organize edilmesi beklenen Expo nun insanlık ve doğa arasındaki bağlantıyı sembolize edecek şekilde "ONE WITH NATURE" sloganı ile düzenleneceğini ve doğanın sürdürülebilir şekilde kullanımıyla ilgili değerleri esas alacağını belirten Macar yetkililerinin, ülkelerin bu konudaki bilgi, tecrübe, gelenek ve kültürel değerlerini sergileyecekleri pavilyonları ile Expo ya katılımlarını beklediklerini ifade etmektedir. Ayrıca, ülke pavilyonlarının yanısıra özel sektör iş insanlarının ve örgütlerinin katılım sağlayacağı ayrı pavilyonların kurulmasının planlandığı, avcılık, doğa, su ve çevre yönetimi vb. alanlarda işbirliği imkanlarının geliştirilebileceği profesyonel etkinliklerden, B2B organizasyonlarına kadar farklı etkinliklere yer verilmesinin planlandığı bildirilmektedir. Öte yandan Expo kapsamında avcılık ve doğa teması ile Budapeşte başta olmak üzere ülke genelinde 660 etkinliğin gerçekleştirilmesi, Avrupa Binicilik Şampiyonasından okçuluk ve tazı yarışmalarına 19 çeşitli uluslararası etkinlik düzenlenmesinin, müzik ve kültürel etkinliklerin, gastronomi festivallerini kapsayan 14 adet çeşitli Macar etkinliğinin gerçekleştirilmesinin ve Yaban Hayatı Forumu gibi 4 adet küresel konferans düzenlenmesinin planlandığı belirtilmektedir. Yazıda devamla, bu çerçevede, Avrupa ülkelerinden Türk Konseyi üyesi ülkelerine kadar dünyanın farklı noktalarından katılımcıları biraraya getirmesi beklenen Expo ya katılımın ülkemizin tarihi ve kültürel değerlerinden gastronomiye, doğa sporlarından doğa turizmine, mal ve hizmet sektörlerine tanıtım fırsatı sağlayacağı ifade edilmektedir. Dolayısıyla, ülkemizin genel ve sektörel tanıtımı kapsamında ilgili firmaların ürün ve hizmetleri ile birlikte Expo ya katılımlarının faydalı olacağı belirtilmektedir. Söz konusu Expo ya ilişkin detaylı bilgilere https://onewithnature2021.org/en adresinden ulaşılabilmekte olup, Expo ya katılım hususunda ilgili linkte yer alan irtibat noktasıyla temas kurulması gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Hibe Satışları Hakkında
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, Süriyede yaşayan halka yardım amacıyla, ekmeklik buğday karşılığı 15.000 ton çuvallı un ihalesi yapılacağı bildirilmiştir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticari Dolandırıcılık Hakkında
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 09.07.2020 tarihli ve 55698096 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ticaret Bakanlığı nın ilgide kayıtlı yazısında, Hong Kong Ticaret Ataşeliği nden alınan yazıya atfen, son dönemde ülkemizde yerleşik firmalar tarafından Hong Kong Ticaret Ataşeliğine iletilen e-postalarda, elektronik ithalat gerçekleştirmek amacı ile Hong Kong firmaları ile işbirliğinde bulunulduğu, buna karşın ödemenin yapılmasını müteakip ilgili Hong Kong firması ile irtibatlarının kesildiği bilgilerinin yer aldığı ifade edilmektedir. Yazıda devamla, önümüzdeki dönemde benzer mahiyette ticari dolandırıcılıkların yaşanmamasını teminen, ülkemizde yerleşik şirketlerin Hong Kong dan gerçekleştirecekleri tedariklerde ekte ismi paylaşılan web adresleri üzerinden alım yapmamalarının önem arz ettiği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Standart Değişikliği
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Türk Standardları Enstitüsü nden TOBB a 01.06.2020 ile 30.06.2020 tarihlerinde iletilen e-postalarda; - TS 10324 Jeoteknik deney metotları-Kayaç süreksizliklerinin direkt makaslama mukavemetinin yerinde tayini - TS 3959 Grafit-Fotometrik yöntemlerle kimyasal analiz - TS 3961 Grafit-Kül miktarının tayini - TS EN ISO 21178 Hafif konveyör bantlar-Elektrik direncinin tayini - TS EN 730-1 Gaz kaynak donanımı-Emniyet cihazları-Bölüm 1:Bir alev(geri tepme) tutucu ile birleşik - TS EN 61215 Kristal silikon yapıda karasal fotovoltaik (PV) modüller-Tasarım yeterliliği ve tip onayı - TS İSO 16739-1 İnşaat ve tesis yönetimi endüstrilerinde veri paylaşımı için Endüstri Temel Sınıfları (IFC)- Bölüm 1: Veri şeması - TSE K 412 Plastik mantolama dübelleri - Dış cephe ısı yalıtımının sabitlenmesi amacıyla kullanılan - TS EN 521 Sıvılaştırılmış petrol gazı (lpg) yakan cihazlar için özellikler-Buhar basıncında sıvılaştırılmış petrol gazı kullanan, taşınabilir cihazlar - TS EN 1650+A1 Kimyasal dezenfektanlar ve antiseptikler-Gıda, sanayi, evsel ve endüstriyel alanlarda kullanılan kimyasal dezenfektanlar ve antiseptiklerde mantar oluşması veya mayalanmanın değerlendirilmesi-Deney yöntemi ve özellikler (faz 2, adım 1) Türk standardlarının yürürlükten kaldırıldığını, - TS 12432 Altıköşe Başlı Civatalar-Alıştırmalı-Çelik Konstrüksöyonlar İçin-Somunlu veya Somunsuz Türk standardlarının ilgili bakanlıkça zorunlu uygulamaya konulduğu bildirilmektedir. bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Otopark Yönetmeliği Hakkında
Sayın Üyemiz, İlgi: Türkiye Odalar ve Borsalar Birliği nin 30.06.2020 tarih ve 34221550-045.99-5547 sayılı yazısı Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, üyelerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliği nin girişimleri ile Çevre ve Şehircilik Bakanlığı, OtoparkYönetmeliğinin Geçici 4 üncü maddesinde belirtilen yürürlük tarihini, 30.06.2020 tarih ve 31171 sayılı ResmiGazete de yayımlanan "Otopark Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik" ile 31.12.2020tarihine kadar uzatmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Malatya Kayısısı İsminin Kullanılması Hakkında
Sayın Üyemiz, Malatya Ticaret ve Sanayi Odası ndan aldığımız 26.06.2020 tarih ve 777 sayılı yazıda (Ek), günümüz dünyasında kültürel değerlerin korunması ve bu yönde oluşan talebin karşılanmasına yönelik çalışmaların, son yıllarda Türkiye de de karşılığını bulduğu, çok sayıda kültürel değer ve ürünlerin menşeleriyle koruma altına alındığı belirtilmektedir. Bu kapsamda, "Malatya Kayısısı"nın belirli isim ve işaretlerle hem ülkemizde Türk Patent Kurumu nda hem de Avrupa Birliği Komisyonu nda tescilinin sağlandığı ifade edilmektedir. Malatya Ticaret ve Sanayi Odası nın, sınai mülkiyet hakkı sahibi olduğu "Malatya Kayısısı" ürününün hak ettiği değeri bulması, üreticinin ve ürünü pazara sunan tüccarların haklarının korunmasına adına gerekli cezai müeyyidelerin uygulanması için her türlü girişimde bulunacağı ifade edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOSGEB KOBİ Destekleri Semineri (İnternet Üzerinden)
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Ülkemizin ekonomik ve sosyal ihtiyaçlarının karşılanmasında KOBİ lerin payını ve etkinliğini artırmak amacıyla kurulan KOSGEB in, KOBİ lere yönelik destek ve hibeleri hakkında 16 Temmuz 2020 Perşembe günü saat 16:00 da internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin duyuru metni ekte yer almaktadır. Birliğimiz Başkanı Sn. Rifat Hisarcıklıoğlu ile KOSGEB Başkanı Sn. Prof. Dr. Cevahir Uzkurt un katılımı ile gerçekleştirilecek olan seminerde KOSGEB KOBİ destek ve hibeleri anlatılacak olup, seminer sonunda KOBİ lerin konu hakkında soruları cevaplandırılacaktır. Bilgisi yer almaktadır. Tüm üyelerimize katılım ücretsizdir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 1.000 Ton Balyalı Kuru Yonca Otu Satışı
Sayın Üyemiz; TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,22.07.2020 günü saat:14:00 da işletmemizin 2020 yılı istihsali 1.000 ton balyalı kuru yonca otunun 1 (bir) parti halinde açık artırma usulü ile satış ihalesi yapılacaktır. ihale ile ilgili evraklar www.tigem.gov.tr elektronik adresinin ihaleler bölümünde yayınlanmıştır,Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Trendyol da İşini Büyüt KOBİ Destek Programı
Sayın Üyemiz; TOBB ve Trendyol işbirliğinde, "Trendyol da İşini Büyüt KOBİ Destek Programı" başlatılmıştır. Programın amacı, Oda ve Borsalarımıza üye kuruluşların Trendyol da avantajlı koşullarda kendi bünyelerindeki veya üretimini yaptıkları mallarının satışa başlamasını sağlamaktır. Program kapsamında üyeleriniz, ürettiği veya satışını düşündükleri malları Trendyol üzerinden komisyonsuz satabilecektir. Trendyol da bir ay boyunca, 30 bin TL ye kadar sıfır komisyonla satış yapmak mümkündür. Destekten sadece Trendyol a ilk defa satıcı olma başvurusu yapacak KOBİ lerimiz faydalanabilecektir. Ayrıntılar için lütfen tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-İspanya I. Dönem JETCO Toplantısı
Sayın Üyemiz; İlgi: Ticaret Bakanlığı nın 07.07.2020 tarihli ve 76552293-724.01.01 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda, ilgide kayıtlı yazıda Türkiye-İspanya I. Dönem JETCO Toplantısı nın Ticaret Bakanı Sayın Ruhsar Pekcan ve İspanya Ticaret ve Turizm Bakanı Reyes Maroto Illera eşbaşkanlıklarında video konferans yöntemiyle 23 Temmuz 2020 tarihinde gerçekleştirileceği bildirilmektedir. Bu kapsamda, İspanya ile ilişkilerde gündeme getirilmesinde fayda görülen hususlar, sorunlar ve çözüm önerilerine dair bilgi notunun Bakanlığa iletilmek üzere en geç 12 Temmuz 2020 tarihine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Dalında Fıstık ve Badem Satışı Hk.
Sayın Üyemiz; TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,14.07.2020 günü saat:14:00 da işletmemizin 2020 yılı istihsali 4.300.000 kg. yaş salkımlı, cumbalı fıstık ve 120.000 kg. yaş salkımlı, cumbalı bademlerin dalında satışı 13 (onüç) parti halinde kapalı zarf teklif alma usulü ile yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
TMO Çeşitli Ürün Satışları Hk.
Sayın Üyemiz, TMO Genel Müdürlüğünden Borsamıza gönderilen yazıda, Kurumun stoklarında bulunan ekli listelerde yer alan mısır, pirinç, çeltik, bakliyat, ELÜS ve İthal ürün satışları ekte belirtilen esaslar ve fiyatlarla belirtilen tarihlerde satışı yapılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Suudi Arabistan Gümrük Vergileri
Sayın Üyemiz; İlgi : Ticaret Bakanlığı ndan alınan 24.06.2020 tarihli ve E-00055253636 sayılı yazı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,İlgi de kayıtlı yazıda, CiddeTicaret Ataşeliği nden Ticaret Bakanlığı na iletilen bir yazıda, Suudi Arabistan Krallığı tarafından bazı ürünlerde uygulanan gümrük vergisi oranlarının arttırıldığı ifade edilerek, söz konusu vergilerin 18 Haziran 2020 tarihinden itibaren yürürlüğe girdiği belirtilmiştir. Anılan ürünlere ilişkin güncel listeye Birliğimiz Dış Ticaret Müdürlüğü https://www.tobb.org.tr/Sayfalar/Detay.php?rid=2824&lst=DuyurularListesi adresinden ulaşılabilmekte olup, Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
UFUK2020 KOBİ Destekleri Semineri (İnternet Üzerinden)
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Türkiye koordinasyonu TÜBİTAK tarafından yapılan, Ar-Ge ve inovasyon faaliyetlerine hibe desteği sağlayan Avrupa Birliği Ufuk2020 Projesi kapsamında KOBİ lere özel olarak hazırlanan destek ve hibeler hakkında 8 Temmuz 2020 Çarşamba günü saat 10:00 da internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere katılmak için http://webinar.tobb.org.tr adresinden kayıt olunması gerekmekte olup, konuya ilişkin duyuru ekte yer almaktadır. Birliğimiz organizasyonunda, TÜBİTAK Avrupa Birliği Çerçeve Programları Müdürü Ufuk Atay ın katılımı ile gerçekleştirilecek seminerde Ufuk2020 KOBİ destek ve hibeleri anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Tüm üyelerimize katılım ücretsizdir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB Ticaret Merkezi hk.
Sayın Üyemiz; Ticaret Bakanlığı tarafından desteklenen Türkiye Ticaret Merkezleri (TTM), şirketlerin yurtdışı pazarlara girişte faydalanabilecekleri, ihracatın gelişmesine olanak sağlamak amacıyla mağaza/ofis/depo/showroom birimlerini bulunduran, şirketlere hukuki ve mali danışmanlık ile dağıtım ağlarının güçlendirilmesine yönelik hizmetlerin sunulduğu merkezlerdir. Birliğimiz tarafından Ticaret Bakanlığı nca belirlenen hedef ülkelerde TTM ler kurulması planlanmaktadır. Bu çerçevede ilk durak Amerika Birleşik Devletleri nin Şikago şehri olmuştur. Kuruluş çalışmaları tamamlanan TOBB TTM Şikago, dünyanın üçüncü en yoğun hava kargo taşımacılığının yapıldığı O hare Havalimanı yakınında konumlandırılmış, 8.100 m2 si depo alanı ve 1.160 m2 si ofis alanı olmak üzere toplam 10.300 m2 kapalı alan ile Şikago da Türk şirketlere hizmet verecektir. Türkiye Odalar ve Borsalar Birliği ve Ticaret Bakanlığı iş birliğiyle 2010/6 sayılı Tebliğ kapsamında faaliyetlerini sürdürmekte olan TOBB TTM Şikago, kullanıcı şirketlere ABD de özel olarak seçilmiş pazar segmentlerinde katma değerli hizmetler sunan ve sistemin tüm bileşenlerinin tek çatı altında toplandığı bir platform özelliği taşımaktadır. Profesyonel ekibiyle piyasadaki rakiplerine göre birçok konuda daha teknik, belirgin avantaj ve iyileştirmeler içeren olanakları bir arada sunmaktadır. TOBB TTM Şikago, öncelikli olarak makine ve teçhizat, elektrikli makina, otomotiv yan sanayi, mobilya ürünleri, plastik, kauçuk ve kimyasal ürünler, mermer, çimento ve diğer taşlar, tekstil ve hazır giyim, gıda ürünleri ve diğer hızlı tüketim malları, demir ve çelik ile demir ve çelikten eşyalar, hava taşıtları aksam ve parçaları, alüminyum ve alüminyumdan eşyalar sektörlerinde faaliyet göstermektedir. Konu ile ilgili ABD pazarına ilgi duyan üyelerimizin bilgilerini ekteki formata uygun olarak eskisehirtb@tobb.org.tr adresine bildirilmesini rica ederiz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşyerleri ve Ulaşım Araçları İçin COVID19 Çalışma Rehberi Afişleri
Sayın Üyemiz; İlgi : Sağlık Bakanlığı ndan alınan 24.06.2020 tarih ve 149 sayılı yazı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Sağlık Bakanlığı ndan alınan ilgi yazıda; Bilimsel Danışma Kurulu tarafından, "Çalışma Rehberi Afişi" ve "Kapasite Bilgisi Afişi" hazırlandığı bildirilerek, ekteki yazıda belirtilen sektörlere ilişkin faaliyet gösteren üyelerimizin afişleri internet ortamından temin edilerek bastırması ve işyerlerine asılması talep edilmektedir. İlgili bilgiler ekte bilgilerinize sunulmuştur. https://covid19bilgi.saglik.gov.tr/tr/calisma-rehberi-afisleri.html Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler - Fas ve Cezayir
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 03.07.2020 tarihli ve 55554744 sayılı yazısı. Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda, ilgide kayıtlı yazıda, Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere Ticaret Bakanlığı tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" başlıklı toplantılar düzenlenmeye başlandığı bildirilmektedir. Yazıda devamla, 7 Temmuz 2020 Salı günü 14.00-15.30 saatleri arasında Cezayir; 8 Temmuz 2020 Çarşamba günü ise 15.00-16.30 saatleri arasında Fas da görev yapmakta olan Ticaret Müşavirlerimiz ve anılan ülkelerde yerleşik iş insanlarımızın da konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantıları gerçekleştirileceği ifade edilmekte olup, ayrıntılı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kırsal Kalkınma Destekleri Semineri (İnternet Üzerinden)
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Tarım ve Orman Bakanlığı ile Tarım ve Kırsal Kalkınmayı Destekleme Kurumu nun KOBİ lere yönelik destek ve hibeleri hakkında 7 Temmuz 2020 Salı günü saat 16:00 da internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin duyuru metni ekte yer almaktadır. Tarım ve Orman Bakanlığı Tarım Reformu Genel Müdürü Hasan Özlü nün katılımı ile gerçekleştirilecek olan seminerde kırsal kalkınma destekleri anlatılacak olup, seminer sonunda KOBİ lerin konu hakkında soruları cevaplandırılacaktır. Tüm üyelerimize katılım ücretsizdir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO stoklarında bulunan kalibre edilmiş (2 kg lık paketli) Nohut ve Yeşil Mercimeklerin perakende ve toptan satışına 01.07.2020 tarihi itibariyle kişi ve kuruluş ayrımı yapılmaksızın peşin bedel mukabili olarak devam edilmektedir. Ayrıca Mersin ve Kırşehir TMO Şube Müdürlüklerinde stoklu yaklaşık 565 ton çuvallı kalibre nohudun peşin toptan satışına da kişi kuruluş ayrımı yapılmaksızın devam edilecektir. Ayrıntılı bilgiye www.tmo.gov.tr ve Şube Müdürlüklerinden ulaşabilirsiniz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Mısır, Pirinç, Çeltik Satışı
Sayın Üyemiz; TMO Genel Müdürlüğünden yapılan açıklamada, TMO mısır stokları, Adıyaman, Batman, Diyarbakır, Gaziantep, Şanlıurfa Şube Müdürlükleri stokları 1.250 TL/Ton, diğer şube stokları 1.300 TL/Ton ve İthal mısırlar ise 1.325 TL/Ton fiyatlarla besici ve yetiştiricilere, yem fabrikalarına, nişasta, mısır irmiği ve biyoetanol fabrikalarına satışa açılmıştır.Ayrıca 10.478 ton pirinç ve 12.379 ton çeltik TMO Elektronik Satış Platformu üzerinden satışa sunulmuştur. Ayrıntılı bilgi www.tmo.gov.tr adresinde yer almaktadır. Üyelerimize duyurulur. Saygılarımızla Gültekin Güler Genel Sekreter
Ticaret Müşavirleriyle Elektronik Sohbetler - ABD ve Kanada
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden (TOBB) alınan yazıda, Ticaret Müşavirleri ve Ataşeleri ile birlikte Türk iş dünyasını bir araya getirmek üzere Ticaret Bakanlığı tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" toplantılarının düzenlendiği bildirilmektedir. Yazıda devamla, 1 Temmuz 2020 Çarşamba günü 16.00-17.30 saatleri arasında Amerika Birleşik Devletleri; 2 Temmuz 2020 Perşembe günü yine 16.00-17.30 saatleri arasında Kanada da görev yapmakta olan Ticaret Müşavir ve Ataşelerinin katılımıyla e-sohbet toplantılarının gerçekleştirileceği belirtilmektedir. Microsoft Teams uygulaması üzerinden gerçekleştirilecek söz konusu toplantıya ilişkin detaylarahttps://bit.ly/2CX2NHxinternet adresinden ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Sayın Üyemiz, 30 Haziran 2020 tarih ve 31171 sayılı Resmi Gazetede yayımlanan; 2706 Sayılı Cumhurbaşkanı Kararı ile, kısa çalışma ödeneğinin 01.07.2020 tarihinden itibaren bir ay daha uzatılması düzenlenmektedir. Ayrıntılı bilgi için; https://www.resmigazete.gov.tr/eskiler/2020/06/20200630-4.pdf 30 Haziran 2020 tarih ve 31171 sayılı Resmi Gazetede yayımlanan; 2707 Sayılı Cumhurbaşkanı Kararı ile, her türlü iş veya hizmet sözleşmesinin ahlak ve iyi niyet kurallarına uymayan haller ve benzeri sebepler dışında işveren tarafından feshedilemeyeceği hükmünün bir ay süre ile daha uzatılması düzenlenmektedir. Ayrıntılı bilgi için; https://www.resmigazete.gov.tr/eskiler/2020/06/20200630-5.pdf Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Türkiye-Letonya I.Dönem JETCO Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gelen yazıda,Türkiye-Letonya I.Dönem JETCO Toplantısının Ticaret Bakanımız Sn. Ruhsar Pekcan ve Letonya Bakanı Sn.Janis Vitenbergs in eş başkanlıklarında videokonferans yöntemiyle 9 Temmuz 2020 tarihinde gerçekleşeceği belirtilerek söz konusu toplantının hazırlık çalışmalarında yararlanılmak üzere Letonya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 2 Temmuz 2020 Perşembe günü saat 12:00 ye kadareskisehirtb@tobb.org.trmail adresineiletilmesini rica ederiz. Saygılarımızla,
Yabancıların Cezayir de Kuracağı Şirketlere İlişkin Mevzuat Değişikliği
Sayın Üyemiz, TOBB’dan Borsamıza iletilen 29.06.2020 tarih ve 5504 sayılı alınan yazıda, Ticaret Bakanlığı nın yazısına atfen;04 Haziran 2020 tarihli Cezayir Resmi Gazetesinde yayımlanan Ek Bütçe Kanunu nun 49 ve 50. maddesiyle, ticaret veya imalat sanayinde faaliyette bulunan yabancı sermayeli şirketlere ilişkin hisselerin %51 inin Cezayir vatandaşlarına ait olma kuralının değiştirildiği belirtilmektedir. Söz konusu değişiklik neticesinde; Cezayir ulusal ekonomisi için stratejik olan sektörler (ulusal madenler; enerji sektörü; savunma sanayii; demiryolları, limanlar ve havalimanları; ilaç endüstrileri) dışında kalan tüm sektörlerde faaliyet gösteren yabancıların, hisselerinin %100 ü kendilerine ait olmak üzere şirket kurmalarının mümkün hale geldiği bildirilmektedir. Bilgilerinize sunarız. Saygılarımızla,
2020 Yılı Kurban Hizmetlerinin Uygulanmasına Dair Tebliğ
Sayın Üyemiz, Kurban kesmek isteyenlerin uyması gereken kuralların düzenlendiği 26.06.2020 tarih ve 31167 sayılı Resmi Gazetede yayımlanan tebliğektedir. Bilgilerinize rica ederiz. Saygılarımızla, Eskişehir Ticaret Borsası
2020 Nefes Kredisi Başvuruları Sona Ermiştir
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nin 25.06.2020 tarih, 34221550-853.02-5429 sayılı yazısı ile; İçinde bulunduğumuz dönemde işletmelerimizin finansman ihtiyacına destek olmak üzere 27.04.2020 tarihinde TOBB’un katkıları ile Kredi Garanti Fonu (KGF) ve Denizbank arasında imzalanan protokol kapsamında Denizbank’ın tüm şubelerinde başlatılarak başarı ile yürütülen 2020 Nefes kredisi projesinin sona erdiği bildirilmiştir. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
İkinci El Motorlu Kara Taşıtlarının Ticareti Hakkında Yönetmelik
Sayın Üyemiz, Ticaret Bakanlığı İç Ticaret Genel Müdürlüğü nden TOBB a intikal eden 70897689-439.99 sayılı yazıekinde; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İkinci El Motorlu Kara Taşıtlarının Ticareti Hakkında Yönetmelikte yapılması öngörülendeğişiklikleri içeren Yönetmelik metni ve karşılaştırma cetveli ekte gönderilmekte olup, söz konusu metneilişkin görüşlerinizin 29/06/2020 Pazartesi tarihi saat 12:00 ye kadar eskisehirtb@tobb.org.tr mail adresineiletilmesini rica ederiz. EKLER: 1- Ticaret Bakanlığı İç Ticaret Genel Müdürlüğü nün yazısı (1 sayfa) 2- İkinci El Motorlu Kara Taşıtlarının Ticereti Hakkında Yönetmelik (12 sayfa) 3- İkinci El Motorlu Kara Taşıtlarının Ticareti Hakkında Yönetmelik Taslağı Karşılaştırma Tablosu Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Güven Damgası
Sayın Üyemiz, İnternetten alışverişte TR-GO logolu güven damgasına sahip e-ticaret sitelerini gönül rahatliğıyla tercih edebilirsiniz. TOBB Tanıtım kampanyası başladı. Ticaret Bakanlığımızın yetkilendirmesiyle Türkiye Odalar ve Borsalar Birliği elektronik ticaretin sağlıklı ve güvenli büyümesine destek oluyor. Link için tıklayınız.
E-Fatura Uygulamasına Geçiş
Sayın Üyemiz, E-Fatura uygulamasına geçmek zorunda olan mükelleflerden faaliyetleri gereği aynı zamanda müstahsil makbuzu düzenlemek zorunda olanlar, 01/07/2020 tarihine kadar gerekli başvuruları yaparak e-Müstahsil Makbuzu uygulamasına geçiş yapmak zorundadır. Geçiş Tavimine, linke tıklayarak ulaşabilirsiniz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
VERBİS e kayıt sürelerinin uzatılması hakkında
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Kişisel Verileri Koruma Kurumu nun 23/06/2020 tarihli ve 2020/482 sayılı Kararı ile 6698 sayılı KişiselVerilerin Korunması Kanunu nda VERBİS e son kayıt süreleri Borsamızca TOBB a yapılan talep doğrultusunda, çatı kuruluşumuzun etkin girişimleri sonucunda ekte mevcut tabloda yer alan şekilde uzatılmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
"Yetenek Kapısı" Çevrimiçi Kariyer Platformu
Sayın Üyemiz; Cumhurbaşkanlığı İnsan Kaynakları Ofisi tarafından hizmete sunulan "Yetenek Kapısı" çevrimiçi kariyer platformu (www.yetenekkapisi.org); işverenlerin ihtiyaç duydukları yetenekleri henüz eğitimleri devam ederken keşfetmelerine, öğrenci/mezunlar ile zaman ve mekândan bağımsız şekilde iletişim kurmalarına imkân sağlamaktadır. Birliğimiz, Cumhurbaşkanlığı İnsan Kaynakları Ofisi ile 8 Haziran 2020 tarihinde İş Birliği Protokolü imzalamış olup "Yetenek Kapısı" çevrimiçi kariyer platformunu desteklemektedir. Bu kapsamında hem Oda ve Borsalarımızın hem de Oda ve Borsalarımıza üye firmaların "Yetenek Kapısı" kariyer platformuna üye olmaları önem arz etmektedir. "Yetenek Kapısı"nda oluşturulacak hesap ile ülkemizdeki ve yurt dışındaki üniversitelerin kariyer merkezleri ile iletişim kurulabilmekte, şirketlerin ve kurumların iş/staj ilanları istenilen üniversite ve bölümlerden öğrencilerin/mezunlarının başvurusuna açılabilmekte, özgeçmişler incelenerek adaylar ile sistem üzerinden iletişim kurulabilmektedir. Yetenek Kapısı; eğitimli gençler arasındaki marka bilinirliğinin artırılmasına, aynı zamanda kariyer etkinliklerinin düzenlenerek üniversitelerin düzenlediği kariyer fuarlarından haberdar olunmasına ve kayıt yaptırılabilmesine imkan sağlamaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Meksika Siber Dolandırıcılık Vakaları Hak.
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 16.06.2020 tarihli ve 68460249-951.01.04 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı nın ilgide kayıtlı yazısı ile, Meksiko Ticaret Müşavirliğimizden alınan bir yazıya atfen,Meksika da yerleşik şahısların Türk firmasının veya yurt dışındaki müşterisinin e-posta hesapları üzerindenyapılan ticari yazışmaları ele geçirmesi ve izlemesi sonucunda ödeme işleminin verilen bir hesap numarasınayapılmasının talep edilmesi yöntemiyle gerçekleştirilen siber dolandırıcılık vakalarında artış olduğunungözlemlendiği, Meksika da banka hesaplarına yapılan ödemelerde ödeme emrinde yer alan alıcı ismi ile resmihesap isminin veya hesap numarasının uyuşmasının zorunlu olmadığı, mevzuat açığının firmalarımızınmağduriyetine sebep olduğu bildirilmektedir.İlgi yazı ekinde sunulan söz konusu yazıda, firmaların elektronik haberleşme sistemlerinin "hacklenme" vesiber saldırıya karşı korunacak şekilde yönetilmesi ve ödeme işlemi gerçekleştirilmeden evvel hesapbilgilerinin müşteri ile telefon görüşmesi aracılığıyla teyit edilmesi hususları belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Mahsul Buğday Ve Selektöraltı Buğday Satış İhalesi
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,İşletmemiz 2019 yılı istihsali; 3.012,40 ton mahsül buğday ve 523,10 ton selektöraltı buğdayın borsaşartlarında peşin bedel ve pazarlık usulü ile 13 (onüç) parti halinde satılacaktır,bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
LGS ve YKS Tedbirleri Kapsamında Sokağa Çıkma Kısıtlaması
Sayın Üyemiz, İç İşleri Bakanlığının yayınladığı genelgeyle,yeni tip koronavirüs salgınının görüldüğü andan itibaren, Sağlık Bakanlığı ve Bilim Kurulunun önerileri, Cumhurbaşkanımız Sn. Recep Tayyip Erdoğan’ın talimatları doğrultusunda salgının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme, sosyal izolasyonu temin, mesafeyi koruma ve yayılım hızını kontrol altında tutma amacıyla birçok tedbir kararı alınarak uygulamaya geçirildi. Bu çerçevede, önümüzdeki günlerde yapılacak olan Liselere Geçiş Sınavı ve Yükseköğretim Kurumlar Sınavının halk sağlığı açısından en uygun koşullarda gerçekleştirilmesi amacıyla bazı tedbirlerin alınması gerektiği belirtildi. Bu kapsamda alınan tedbirler şu şekilde sıralandı: 1- Liselere Geçiş Sınavı (LGS); 20 Haziran 2020 Cumartesi günü birinci oturumu 09.30’da başlayıp 10.45’de tamamlanacak, ikinci oturumu 11.30’da başlayıp 12.50’de tamamlanacak olan Liselere Geçiş Sınavı (LGS) öncesi ve sonrasında oluşabilecek yoğunluğu ve bulaşma riskini azaltmak, sınavın sorunsuz bir şekilde yapılmasını temin etmek amacıyla; 20 Haziran 2020 Cumartesi günü 09.00 ile 15.00 saatleri arasında aşağıda belirtilen istisnalar hariç olmak üzere 81 ilimiz sınırları içinde bulunan vatandaşlarımızın sokağa çıkmaları kısıtlanacaktır. 2- Yükseköğretim Kurumları Sınavı (YKS); Birinci oturumu 27 Haziran 2020 Cumartesi günü saat 10.15’te başlayıp 13.00’de tamamlanacak, ikinci oturumu 28 Haziran 2020 Pazar günü saat 10.15’te başlayıp 13.15’de tamamlanacak ve üçüncü oturumu 28 Haziran 2020 Pazar günü 15.45’te başlayıp 17.45’de tamamlanacak olan Yükseköğretim Kurumları Sınavı (YKS) öncesi ve sonrasında oluşabilecek yoğunluğu ve bulaşma riskini azaltmak, sınavın sorunsuz bir şekilde yapılmasını temin etmek amacıyla; 27 Haziran 2020 Cumartesi günü saat 09.30 ile 15.00 arasında ve 28 Haziran 2020 Pazar günü 09.30 ile 18.30 saatleri arasında aşağıda belirtilen istisnalar hariç olmak üzere 81 ilimiz sınırları içinde bulunan vatandaşlarımızın sokağa çıkmaları kısıtlanacak. 3- Gerek LGS gerekse YKS sınavlarına girecek adayların sınav binasına ulaşımlarının toplu taşıma ile sağlanması halinde kendilerinin yanı sıra bir yakını, özel araçlarla gelinmesi halinde ise araç sürücüsü ile birlikte bir yakını sokağa çıkma kısıtlamasına tabi olmayacak. 4- LGS ve YKS sınavlarına girecek adayların T.C. Kimlik Kartı başvurularının alınması amacıyla tüm il/ilçe nüfus müdürlükleri; LGS sınavı öncesine denk gelen 18 Haziran 2020 Perşembe ve 19 Haziran 2020 Cuma günleri saat 20.00’a kadar, LGS sınavının yapılacağı 20 Haziran 2020 Cumartesi günü 07.00-13.00 saatleri arasında, YKS sınavı öncesine denk gelen 25 Haziran 2020 Perşembe ve 26 Haziran 2020 Cuma günleri saat 20.00’a kadar, YKS sınavının yapılacağı 27 Haziran 2020 Cumartesi günü 07.00-13.00 saatleri arasında, YKS sınavının yapılacağı 28 Haziran 2020 Pazar günü 07.00-16.00 saatleri arasında açık bulundurulacak. 5- LGS ve YKS sınavlarının yapılacağı günlerde başta sınava girecek adaylar ve yakınları ile sınav görevlilerinin (otobüs, minibüs, dolmuş, taksi vs.) gibişehir içi toplu ulaşımlarında herhangi bir aksama olmaması için Belediyelerce gerekli tedbirler alınacak ve ihtiyaca göre sefer sayıları artırılacak. 6- Şehirlerarası toplu ulaşım araçlarından (uçak, otobüs, tren, vapur, feribot vs.) biletleme yapmış olanlar sokağa çıkma kısıtlamasına tabi olmayacak. 7- AçıkOlacakİş Yeri, İşletmeveKurumlar a) Sokağa çıkma kısıtlaması uygulanacak gün ve saatlerde; ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri, market, bakkal, manav, kasap, kuruyemişçi ile tatlı üretiminin yapıldığı/satıldığı iş yerleri (vatandaşlarımız zorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın fırın, unlu mamul ruhsatlı iş yerleri, market, bakkal, manav, kasap, kuruyemişçi ile tatlıcılara gidip gelebilecektir.), b) İlaç, tıbbi cihaz, tıbbi maske ve dezenfektan üretimi, nakliyesi ve satışına ilişkin faaliyetleri yürüten iş yerleri, c) Kamu ve özel sağlık kurum ve kuruluşları, eczaneler, veteriner klinikleri ve hayvan hastaneleri, ç) Zorunlu kamu hizmetlerinin sürdürülmesi için gerekli kamu kurum ve kuruluşları ile işletmeler (Havalimanları, limanlar, sınır kapıları, gümrükler, karayolları, huzurevleri, yaşlı bakım evleri, rehabilitasyon merkezleri, Nüfus Müdürlükleri, Acil Çağrı Merkezleri, AFAD Birimleri, Vefa Sosyal Destek Birimleri, Göç İdaresi, PTT vb.), d) Akaryakıt istasyonları, e) Valilikler/Kaymakamlıklar tarafından yerleşim merkezleri için her 50.000 nüfusa bir adet ve il sınırları içinden geçen şehirlerarası karayolu ve varsa otoyol üzerinde her 50 km için bir adet olmak üzere belirlenecek sayıda (kura ile tespit edilecek) lastik tamircisi, f) Doğalgaz, elektrik, petrol sektöründe stratejik olarak faaliyet yürüten büyük tesis ve işletmeler (rafineri ve petrokimya tesisleri ile termik ve doğalgaz çevrim santralleri gibi), g) İçme suyu dolum tesisleri ile içme suyu, gazete ve mutfak tüpü dağıtımını yapan şirketler, ğ) Hayvan barınakları, hayvan çiftlikleri ve hayvan bakım merkezleri, h) Sağlık hizmetlerinin kapasitesini arttırmaya yönelik acil inşaat, donanım vb. faaliyetleri yürüten işletme/firmalar, ı) Bulunduğu yerin İl/İlçe Hıfzıssıhha Kurulu tarafından izin verilmesi şartı ile makarna, un ve unlu mamuller, süt, et, balık üretimi gibi temel gıda maddelerinin üretiminin yapıldığı tesisler ve kâğıt, kolonya üretimi başta olmak üzere hijyen malzemeleri ile bu malzemelerin üretimi için ihtiyaç duyulacak hammaddelerin üretiminin yapıldığı tesisler, i) Yurt içi ve dışı taşımacılık (ihracat/ithalat/transit geçişler dâhil) ve lojistiğini yapan firmalar, j) Oteller ve konaklama yerleri, k) Gıda, temizlik ve ilaç gibi sektörlere ambalaj sağlayan üretim tesisleri, l) Çalışanları inşaat/maden alanında bulunan şantiyede konaklayarak yapımı veya çalışması devam eden büyük inşaatlar ile madenler (Bu madde kapsamında inşaat ve konaklama aynı şantiye alanı içinde ise izin verilir, başka bir yerden çalışanların gelmesine ve şantiyede kalanların başka bir yere gitmelerine izin verilmez. Çalışma alanı sadece inşaat alanı/maden sahaları ile sınırlıdır.), m) Gazete, radyo ve televizyon kuruluşları ile gazete basım matbaaları, n) Daha önceden sözleşmeye/taahhüde bağlanmış ve belirlenen süre içerisinde yetiştirilmesi gereken ihracata konu; mal, malzeme, ürün, araç-gereç üreten iş yerleri ve tesisler (mevcut zorunluluklarını ispatlamaları ve anılan şartlara uymaları kaydıyla), o) Zirai amaçlı akaryakıt satışı yapılan Tarım Kredi Kooperatifleri, ö) Valilikler/Kaymakamlıklar tarafından tespit edilecek ihtiyaca göre kura ile belirlenecek; zirai ilaç, tohum, fide, gübre vb. tarımsal üretime ilişkin ürün satışı yapan işletmeler, p) Sebze/meyve toptancı halleri, 8- İstisnaKapsamında Olan Kişiler a) Bu Genelgenin (7) numaralı başlığında yer alan “Açık Olacak İşyeri, İşletme ve Kurumlarda” yönetici, görevli veya çalışanlar, b) Kamu düzeni ve güvenliğinin sağlanmasında görevli olanlar (Özel güvenlik görevlileri dâhil), c) Acil Çağrı Merkezleri, Vefa Sosyal Destek Birimleri, Kızılay ve AFAD’da görev alanlar, ç) Cenaze defin işlemlerinde görevli olanlar (din görevlileri, hastane ve belediye görevlileri vb.) ile birinci derece yakınlarının cenazelerine katılacak olanlar, d) Elektrik, su, doğalgaz, telekomünikasyon vb. kesintiye uğramaması gereken iletim ve altyapı sistemlerinin sürdürülmesi ve arızalarının giderilmesinde görevli olanlar, e) Ürün ve/veya malzemelerin nakliyesinde ya da lojistiğinde (kargo dahil), yurt içi ve yurt dışı taşımacılık, depolama ve ilgili faaliyetler kapsamında görevli olanlar, f) Yaşlı bakımevi, huzurevi, rehabilitasyon merkezleri, çocuk evleri vb. sosyal koruma/bakım merkezleri çalışanları, g) Otizm, ağır mental retardasyon, down sendromu gibi “Özel Gereksinimi” olanlar ile bunların veli/vasi veya refakatçileri, ğ) Demir-çelik, cam, ferrokrom vb. sektörlerde faaliyet yürüten iş yerlerinin yüksek dereceli maden/cevher eritme fırınları ile soğuk hava depoları gibi zorunlu olarak çalıştırılması gereken bölümlerinde görevli olanlar, h) Bankalar başta olmak üzere yurt çapında yaygın hizmet ağı olan kurum, kuruluş ve işletmelerin bilgi işlem merkezlerinin çalışanları (asgari sayıda olmak kaydıyla), ı) Bitkisel (gül, çay, meyve, hububat, kesme çiçek vb.) ve hayvansal (süt, et, yumurta, balık vb.) ürünlerin üretimi, sulaması, işlenmesi, ilaçlaması, hasatı, pazarlanması ve nakliyesinde çalışanlar, i) Küçükbaş-büyükbaş hayvanları otlatanlar, arıcılık faaliyetini yürütenler, j) 30.04.2020 tarih ve 7486 sayılı Genelgemiz kapsamında oluşturulan Hayvan Besleme Grubu Üyeleri ile sokak hayvanlarını besleyecek olanlar, k) İkametinin önü ile sınırlı olmak kaydıyla evcil hayvanlarının zorunlu ihtiyacını karşılamak üzere dışarı çıkanlar, l) Zorunlu sağlık randevusu olanlar (Kızılay a yapılacak kan ve plazma bağışları dahil), m) Yurt, pansiyon, şantiye vb. toplu yerlerde kalanların gereksinim duyacağı temel ihtiyaçların karşılanmasında görevli olanlar, n) İş sağlığı ve güvenliği nedeniyle iş yerlerinden ayrılmaları riskli olan çalışanlar (iş yeri hekimi vb.), o) Veteriner hekimler, ö) Servis hizmeti vermek üzere dışarıda olduklarını belgelemek şartı ile teknik servis çalışanları, p) İşyerlerinin kapalı olduğu saatlerde/günlerde sürekli olarak işyerlerini bekleyenler, r) Belediyelerin toplu taşıma, temizlik, katı atık, su ve kanalizasyon, ilaçlama, itfaiye ve mezarlık hizmetlerini yürütmek üzere hafta sonu çalışacak personel, s) Madencilik, inşaat ve diğer büyük yatırım projelerinde kullanılmakta olan patlayıcıların imalat ve lojistiğinde çalışanlar, ş) Mahkeme kararı çerçevesinde çocukları ile şahsi münasebet tesis edecekler (mahkeme kararını ibraz etmeleri şartı ile), t) Serbest muhasebeci mali müşavirler, yeminli mali müşavirler ve bu meslek mensupları ile beraber çalışanlar, Belirtilen istisnalar dışındaki tüm vatandaşlarımızın evlerinde kalması esastır. Bu Genelgenin (7) numaralı “Açık Olacak İşyeri, İşletme ve Kurumlar” başlığının (ı) maddesi kapsamındakilere yönelik kararlar, İl/İlçe Hıfzıssıhha Kurullarınca; LGS sınavı için en geç 19.06.2020 Cuma günü saat 13.00 a, YKS sınavı için en geç 26.06.2020 Cuma günü saat 13.00 a kadar alınacaktır. Söz konusu tedbirlere ilişkin Valiler/Kaymakamlar tarafından ilgili mevzuat uyarınca gerekli kararların ivedilikle alınması, uygulamada herhangi bir aksaklığa meydan verilmemesi ve mağduriyete neden olunmaması sağlanacak. Alınan kararlara uymayan vatandaşlara Umumi Hıfzıssıhha Kanununun 282’nci maddesi gereğince idari para cezası verilecek. Aykırılığın durumuna göre Kanunun ilgili maddeleri gereğince işlem yapılması, konusu suç teşkil eden davranışlara ilişkin Türk Ceza Kanununun 195 inci maddesi kapsamında gerekli adli işlemler başlatılacaktır, bilgisi yer almaktadır. Üyelerimize duyurulur, Saygılarımızla, Gültekin Güler Genel Sekreter
TİGEM 3.012,40 ton mahsul buğday ve 523,10 ton selektöraltı buğday satıs ıhalesı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,İşletmemiz 2019 yılı istihsali; 3.012,40 ton mahsül buğday ve 523,10 ton selektöraltı buğdayaçık artırma usulü 13 (onüç) parti halinde satılacaktır,bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Türk-Alman Ticaret ve Sanayi Odası Tarafından Düzenlenecek Webinar
Sayın Üyemiz, Türk-Alman Ticaret ve Sanayi Odası tarafından Haziran ayında düzenlenecek Webinar lara ait bilgiler aşağıda bilgilerinize sunulmuştur. 18.06.2020, 15.00 Deutschland (16:00 Türkiye) Covid 19 und die Auswirkungen auf das Miet- und Baurecht in der Türkei (türkischsprachig) Covid 19 un Türk kira ve insaat hukukuna etkileri Zoom Registrierungslink / Zoom kayıt linki: https://zoom.us/meeting/register/tJApdOmrrT8oG9efSasZ3oZZIkSe3U6eyKbV 22.06.2020, 10:00 Deutschland (11:00 Türkiye) Arbeitskreis Zoll, Schwerpunkt Maschinenbau; Gümrük Çalışma Grubu, Makine Sanayi Sektörü Zoom Registrierungslink / Zoom kayıt linki: https://zoom.us/meeting/register/tJYld-igqj4qE9xBEoetahfK3RfZvZmQshtn 23.06.2020, 15:00 Deutschland (16:00 Türkiye) Best practice Monster Notebook: Markenetablierung im Ausland (türkischsprachig) Türkiye`den dünyaya açılan bir marka örneği: Monster Notebook Zoom Registrierungslink / Zoom kayıt linki: https://zoom.us/meeting/register/tJYod-mgqz4tHddpsdQ9cgQhxZpptdQBrKKv 30.06.2020, 15:00 Deutschland (16:00 Türkiye) Die Bedeutung des Istanbul Arbitration Center (Mediationszentrum/Schlichtungszentrum) und Online – Mediation in Coronazeiten (türkischsprachig) İstanbul Tahkim Merkezi’nin önemi ve Corona sürecinde Online – Tahkim Registrierungslink / Zoom kayıt linki: https://zoom.us/meeting/register/tJMqd-ChrDIqHtz9dRoPMhemvu4eVNa1BJwl Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,2020 yılına ait 32.464 dekar hububat sapı satışı yapılacaktır,bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Ticaret Müşavirlerimizle Elektronik Sohbetler - İran
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 12.06.2020 tarihli ve 18291 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere Ticaret Bakanlığı tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" başlıklı toplantılar düzenlenmeye başlandığı bildirilmektedir. Yazıda devamla, 16 Haziran 2020 Salı günü 14.00-15.30 saatleri arasında İran İslam Cumhuriyeti nde görevli Ticaret Müşavir ve Ataşelerimizin katılımıyla "ABD Yaptırımları Çerçevesinde İran ile Ticaret" e-sohbet toplantısı gerçekleştirileceği ifade edilmekte olup, ayrıntılı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
SGK Genel Yazısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Sosyal Güvenlik Kurumu Başkanlığının 01/06/2020 tarihi ve 41481264-207.02-E.6383458 sayılı Genel Yazısında; Çin in Wuhan kentinde ortaya çıkan ve ülkemizde de 11/03/2020 tarihinden itibaren görülen yeni tip koronavirüs (COVID-19) salgını nedeniyle, 5510 sayılı Kanunun Ek 17 nci maddesi kapsamında geriye dönük prim teşviki, destek ve indirimlerden yararlanma başvurusunu yasal süreci içinde yapan işverenlerin, bu taleplerine ilişkin düzenleyecekleri iptal/asıl/ek nitelikteki aylık prim ve hizmet belgelerinin/muhtasar ve prim hizmet beyannamelerini en son Kuruma verme tarihlerinde değişiklik yapılmasına ihtiyaç duyulduğu belirtilerek; - 5510 sayılı Kanunun Ek 17 nci maddesinin birinci fıkrası kapsamında 2018/Nisan ayı ve sonrasına ilişkin olmak üzere geriye yönelik teşvikten yararlanma veya teşvik değişikliği için; Altı aylık yasal süre içinde Kuruma başvurduğu halde talepte bulunduğu aylara ilişkin asıl/ek/iptal nitelikteki aylık prim ve hizmet belgelerini/muhtasar ve prim hizmet beyannamelerini 01/06/2020 tarihi itibariyle halen sisteme yüklemeyen işverenlerin, sözkonusu asıl/ek/iptal nitelikteki aylık prim ve hizmet belgelerini/muhtasar ve prim hizmet beyannamelerini en geç 30/06/2020 tarihine kadar (bu tarih dahil) sistemi yüklemesi gerektiği, - 5510 sayılı Kanunun Ek 17 nci maddesinin ikinci fıkrası kapsamında 2018/Mart ayı ve öncesine ilişkin olmak üzere geriye yönelik teşvikten yararlanma veya teşvik değişikliği için; 2018/ Mart ayı ve öncesine ilişkin yasal süresi içinde (01/06/2018 ve öncesi) teşvikten yararlanma veya teşvik değişikliği talebinde bulunan işverenlerin, bu başvurularına ilişkin iptal/asıl/ek nitelikteki aylık prim ve hizmet belgelerini/muhtasar ve prim hizmet beyannamelerini en geç 30/06/2020 tarihine kadar (bu tarih dahil) "e-SGK/İşveren/E-Bildirge V2/Aylık Prim Hizmet Belgesi Girişi" ekranları vasıtasıyla Kuruma göndermeleri gerektiği, Dolayısıyla 2018/Mart ayı ve öncesine ilişkin teşvikten yararlanma veya teşvik değişikliği talebini yasal süresi içinde yapan işverenlerin 30/06/2020 tarihinden sonra "e-SGK/İşveren/E-Bildirge V2/Aylık Prim Hizmet Belgesi Girişi" Kuruma gönderecekleri iptal/asıl/ek nitelikte aylık prim ve hizmet belgeleri/muhtasar ve prim hizmet beyannameleri işleme alınmayacağı ifade edilmektedir. Böylece Birliğimizin girişimleri sonucu geriye yönelik teşvik değişiklik taleplerine ilişkin düzenlenecek APHB lerin SGK ya gönderilme süresi 01/06/2020 tarihinden 30/06/2020 tarihine uzatıldığı bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Plastik Poşetlerin Ücretlendirilmesi Uygulaması Hk.
Sayın Üyemiz, İlgi : Çevre ve Şehircilik Bakanlığı nın 20.05.2020 tarihli ve 293 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Çevre ve Şehircilik Bakanlığı nın ilgi yazısında; 27.12.2017 tarih ve 30283 sayılı Resmi Gazete de yayımlanarak yürürlüğe giren Ambalaj Atıklarının Kontrolü Yönetmeliği dahilinde plastikten yapılmış, mal veya ürünlerin satış noktalarında tüketicilere taşıma amacıyla temin edilen saplı veya sapsız torbaların ambalaj olarak kabul edildiği hatırlatılmaktadır. İlgi yazıda, Bakanlıkça belirlenen "Plastik Poşetlerin Ücretlendirilmesine İlişkin Usul ve Esaslar"ın Genel Esaslar başlıklı 5inci maddesinde plastik poşetlerin yüzeylerinde yer alması gereken öğeler, kalınlıklarına dair parametreler ve barkod taşımaları hususlarında hükümler yer almakta olduğu, plastik poşetlerin ücretlendirilmesine tabi plastik poşetlerin söz konusu maddede yer alan bu hükümler doğrultusunda üretilmeleri gerektiği ifade edilmiştir. Bu kapsamda, ücretlendirme uygulamasına tabi plastik poşetlerin söz konusu Usul ve Esaslarda belirlenmiş olan özelliklerde üretimi ve piyasaya sürülmesi önem arz etmekte olduğu bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB Covid-19 Ekonomik Etki Ölçüm Anketi
Sayın Üyemiz, COVID-19 salgının ülkemiz ekonomisine etkilerini ölçmek amacıyla TOBB tarafından anket uygulamaları gerçekleştirilmekte olup, burada elde edilen verilerden yola çıkarak sorunlara ilişkin çözüm önerileri ve politikalar geliştirilecektir. Bu çalışmalardan bir tanesi olan ve COVID-19 salgının dünya ekonomisine etkilerini ölçmek amacıyla gerçekleştirilen çalışmanın Türkiye’ye özgü kısmı, TOBB ve Dünya Bankası işbirliğinde “COVID-19 İş Dünyası Etki Araştırması Anketi” ile gerçekleştirilecektir. Söz konusu anketehttp://www.tobb.org.tr/covid19adresinden ulaşılabilmektedir. Bu kapsamda "COVID-19 İş Dünyası Etki Araştırması Anketi"ni doldurarak araştırmaya katılmanızı rica eder, salgının etkilerini azaltmak amacıyla gerçekleştirilen bu çalışmaya verdiğiniz bilgiler ve işbirliğiniz için teşekkür ederiz. Saygılarımızla Gültekin GÜLER Genel Sekreter
E-Ticaret Eğitimi
Sayın Üyemiz, TOBB un organize ettiği, KOBİ lerimize yönelik sertifikalı e-ticaret eğitimi düzenlenecek olup katılım ücretsizdir. Ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Singapur İş Federasyonu’nun Duyurusu
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 05.06.2020 tarih ve 54304773-724.01.03 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Singapur Ticaret Müşavirliği nden alınan yazıya atfen, Singapur da oda/birliklerinçatı örgütü olarak faaliyet göstermekte olan Singapur İş Federasyonu (Singapore Business Federation)tarafından firmalar arası eşleştirme hizmetlerine ilişkin bir bilgilendirmeye yer verildiğibelirtilmektedir. Yazıda devamla, Covid-19 salgını sebebiyle ortaya çıkan talebi karşılamaya yönelik olarak işletmelerinhem yerli firmalar hem de yurtdışında faaliyet gösteren firmalar ile iletişimlerini kolaylaştırmakamacıyla "Covid-19 Firma Eşleştirme Hizmeti (Covid-19 Business Matching Service)" uygulamasınınbaşlatıldığı; ilk olarak cerrahi maskeler, termometreler, dezenfektanlar, koruyucu gözlükler veeldivenler gibi kişisel koruyucu ekipmanlar ile medikal ürünlerin tedarik ve talebine yönelik olarakuygulamanın olacağı, ilerleyen aşamalarda ise daha fazla ürün kategorisinde eşleştirme yapılmasınınplanlandığı ifade edilmektedir. Bu çerçevede, söz konusu uygulama ile ilgilenen alıcı ve/veya tedarikçi firmaların online bir form ilebaşvurarak veri tabanına dahil olabilecekleri belirtilmekte olup, sistemde eşleşme oluşması halinde dealıcı ve tedarikçi firmaların irtibatlandırılacağı ifade edilmektedir. Alım yapma talebinde bulunan firmalar ve tedarik sunmak isteyen firmaların başvuru yapabileceğiformlar "Covid-19 Business Matching Service" başlık altında https://www.sbf.org.sg/ sayfasında yeralmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 1.000 Ton Mahsul Dane Mısır Ve 150,9 Ton Mahsül Yağlık Ayçiçek Satış İhalesi
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,İşletmemiz 2019 yılı mahsulü Beyazkule ve Gümüşsu harman bölgelerinde bulunan toplam 1.000 ton 2. ürün mahsul dane mısır ve 150.9 ton yağlık ayçiçeği borsa şartlarında 3 (üç) parti halinde peşin bedel vepazarlık usulü ile satılacaktır,bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
TİGEM 187 Ton Yapağı Satış İhalesi
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,İşletmemizin 2020 yılı istihsali 182.000 kg koyun yapağısı ve 5.000 kg kırpıntı koyunyapağısı olmak üzere toplamda 187.000 Kg yapağının borsa şartlarında 14 (ondört) parti halindepazarlık usulü ile satılacaktır,bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
TİGEM 3.573,85 ton mahsul buğday ve 523,10 ton selektöraltı buğday Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,İşletmemiz 2019 yılı istihsali; 3.573,85 ton mahsul buğday ve 523,10 ton selektöraltı buğday borsaşartlarında peşin bedel ve açık artırma usulü 15 (onbeş) parti halinde peşin bedel ve açık artırma usulü ilesatılacaktır,bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Kırsal Kalkınma Destekleri Kapsamında Tarıma Dayalı Yatırımların Desteklenmesi Hakkında Tebliğ
Sayın Üyemiz, Resmî Gazetede yayınlanan,Kırsal Kalkınma Destekleri Kapsamında Tarıma Dayalı Yatırımların Desteklenmesi Hakkında Tebliğ ve ayrıntılarılinkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çiğ Süt Desteği Ve Süt Piyasasının Düzenlenmesi Uygulama Tebliği
Sayın Üyemiz, Resmî Gazetede yayınlanan,çiğ süt üretiminin desteklenmesi hakkında yayınlanan uygulama tebliğive ayrıntılarılinkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çin ve Rusya Sohbet Toplantıları
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 05.06.2020 tarih ve 00054789609 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Ticaret Bakanlığı tarafından, Ticaret Müşaviri ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere "Ticaret Müşavirlerimizle Elektronik Sohbetler" adıyla online toplantıların düzenlendiği belirtilmektedir. Bu çerçevede Çin Halk Cumhuriyeti ve Rusya Federasyonu nda görev yapan Ticaret Müşaviri ve Ataşelerinin konuşmacı olarak iştirak edeceği iki ayrı bilgilendirme toplantısı gerçekleştirilecektir. Hazırlanan programa göre, Çin Halk Cumhuriyeti için Bilgilendirme Toplantısının 10 Haziran 2020 Çarşamba günü 11.00-12.30 saatleri arasında, Rusya Federasyonu için Bilgilendirme Toplantısının ise, 11 Haziran 2020 Perşembe günü 14.00-15.30 saatleri arasında düzenlenmesi planlanmıştır. Bahse konu etkinliklerin programları ve toplantı erişim bağlantıları Birliğimiz web sitesi (www.tobb.org.tr) sağ panelinde "Hizmetler" başlığı altındaki Uluslararası İş İmkanları/Yurtdışı Etkinlikler bölümünde yer almaktadır, bilgisi yeralmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs (COVID­19) Tedbirleri / İşletmeler, Park/Piknik Alanları ve Sosyete Pazarlarının Açılmasına ilişkin ek açıklamalar
Sayın Üyemiz, Eskişehir Valiliğinden Borsamıza gönderilen yazıda,, Sağlık Bakanlığı ve Bilim Kurulunun önerileri doğrultusunda Koronavirüs (COVID­19) salgınının yayılmasını önlemek ve salgını kontrol altında tutmak amacıyla alınan kararlar ile geçici süreli olarak faaliyetleri durdurulan/kısıtlanan işletmeler ile park/piknik alanları, mesire yerleri ve sosyete pazarlarının belirlenen/belirlenecek kurallar dahilinde açılmasına ilişkin İl Umumi Hıfzıssıhha Kurulunun aldığı kararlara ilişkin ek açıklamalar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Koronavirüs (COVID­19) Tedbirleri / İşletmeler, Park/Piknik Alanları ve Sosyete Pazarlarının Açılması
Sayın Üyemiz, İlgi: a)İçişleriBakanlığıİllerİdaresiGenelMüdürlüğünün30/05/2020tarihlive8556sayılıyazısı. b)İlUmumiHıfzıssıhhaKurulunun30/05/2020tarihlive49no.lukararı. c)Valiliğimizin30/05/2020tarihlive2020/30sayılıkararı. Eskişehir Valiliğinden Borsamıza gönderilen yazıda,SağlıkBakanlığıveBilimKurulununönerileridoğrultusundaKoronavirüs(COVID­19) salgınınınyayılmasınıönlemekvesalgınıkontrolaltındatutmakamacıylaalınankararlar ilegeçicisüreliolarakfaaliyetleridurdurulan/kısıtlananişletmelerilepark/piknikalanları, mesireyerlerivesosyetepazarlarınınbelirlenen/belirlenecekkurallardahilinde açılmasınailişkinİlUmumiHıfzıssıhhaKurulununilgi(b)ileValiliğimizinilgi(c)kararı yazımızekindegönderilmiştir. 1Haziran2020Pazartesigünüitibariylefaaliyetlerinebaşlamasıöngörülenişletmelere, SağlıkBakanlığıBilimselDanışmaKurulutarafındanhazırlanan“COVID­19Salgın YönetimiveÇalışmaRehberi”ndeyeralanveilgilibakanlıklarilekurumlartarafından yapılan/yapılacakyeni/ilavedüzenlemelerdegözönündetutularakkendiişletmeleriiçin özelolarakbelirlenen/belirlenecekişletme/faaliyetkuralları,ilçekaymakamlıklarınca ilgiliişletmeci/esnafatebliğedilecektir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
COVID-19 Bilgilendirme Faaliyetleri
Sayın Üyemiz, İlgi: İçişleriBakanlığıİllerİdaresiGenelMüdürlüğünün29/05/2020tarihlive8536sayılıyazısı. Eskişehir Valiliğinden Borsamıza gönderilen yazıda,İçişleriBakanlığıİllerİdaresiGenelMüdürlüğününilgiyazısıekindealınanAile,Çalışma ve Sosyal Hizmetler Bakanlığı İş Sağlığı ve Güvenliği Genel Müdürlüğünün 22/05/2020 tarihli ve 1207828 sayılı yazısı ile COVID­19 hastalığının yayılmasının önlenmesi ve çalışma hayatının tüm unsurları ile istihdamın korunması kapsamında iş sağlığı ve güvenliği önlemlerinin göz önünde tutulabilmesi için alınan tedbirlerle ilgili olarak yol gösterici rehber ve broşürlerin hazırlandığı, hazırlanan rehber ve broşürlere https://ailevecalisma.gov.tr/covid19 ve ww.ailevecalisma.gov.tr/isggm internet adreslerinden, https://facebook.com/isggm ww.instagram.com/isggmd ve www.twitter.com/isggmd sosyal medya hesaplarından ulaşılabileceği bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
COVID­19 Salgın Yönetimi ve Çalışma Rehberi
Sayın Üyemiz, İlgi: İçişleriBakanlığıİllerİdaresiGenelMüdürlüğünün29/05/2020tarihlive8535sayılıyazısı. Eskişehir Valiliğinden Borsamıza gönderilen yazıda, İçişleriBakanlığıİllerİdaresiGenelMüdürlüğününilgiyazısıekindealınanSağlık Bakanlığının27/05/2020tarihlive803sayılıyazısıileBilimselDanışmaKurulutarafından hazırlanan"COVID­19SalgınYönetimiveÇalışmaRehberi"ileafişvebroşürlere HalkSağlığıGenelMüdürlüğününresmiinternetsayfasından, https://covid19bilgi.saglik.gov.tr/tr/salgin­yonetimi­ve­calisma­rehberi.htmlve https://covid19bilgi.saglik.gov.tr/tr/calisma­rehberi­afisleri.htmlinternetadreslerinden ulaşılabileceğiveCOVID­19hastalığınayönelikgelişmelerkapsamındagerekli güncellemelerinveeklemelerindeyapılmasınadevamedileceğibildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Almanya`da şirket halefi, şirket devirleri zoom web semineri daveti
Sayın Üyemiz, Türk-Alman Ticaret ve Sanayi Odasından Borsamıza gönderilen yazıda,Almanya’da yatırım yapmak isteyen girişimciler ve şirketler için yapılması gerekenlerin anlatılacağı seminerde örnek uygulamalar üzerinden şirket devirlerini konu alacakları dile getirilmiştir. Örnek uygulamalarla birlikte bu konuyu09 Haziran 2020 tarihinde saat 15:00’te (Türkiye saati ile 16:00)Avukat Sayın Melis Ersöz Koca, Avukat ve Noter Sayın Roland Krause ve Avukat Sayın Serhat Koca ile yapılacak web seminerinde tartışılacaktır. Katılmak için lütfen seminerimize kaydolun:https://bit.ly/3gS7dPd Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
TİGEM 1.000 Ton Mahsul Mısır ve 150.9 Ton Mahsul Ayçiçek Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,İşletmemiz 2019 yılı mahsulü Beyazkule ve Gümüşsu harman bölgelerinde bulunan toplam 1.000 ton2. ürün mahsul dane mısır ve 150.9 ton yağlık ayçiçeği borsa şartlarında 3 (üç) parti halinde peşin bedel ve açıkartırma usulü ile satılacaktır,bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Rusya Federasyonu nda Koronavirüs Salgınıyla Mücadelede Alınan Tedbirler
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 22.05.2020 tarihli ve 54510511 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı ndan alınan ilgide kayıtlı yazıda, Rusya Federasyonu nda koronavirüs salgınıyla mücadele kapsamında alınan önlemlere ilişkin tablo iletilmektedir. Moskova Ticaret Müşavirliği tarafından hazırlanan bahse konu tablo ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Dijital Tarım Pazarı (DITAP)
Sayın Üyemiz, Eskişehir İl Tarım ve Orman Müdürlüğünden Borsamıza gönderilen yazıda,Tarımda dijitalleşme adına çok önemli bir proje olan, tüm üreticiler ile alıcılarınbuluşabilmesine, çiftçimizin alın teri ile ürettiği ürünleri değer fiyattan satabilmesine vetüketicilerimizin de kaliteli ürünü daha uygun fiyatlarla satın alabilmesine olanak sağlayacakonline platform Sayın Bakanımız tarafından Dijital Tarım Pazarı (DİTAP), 29 Nisan 2020tarihinde kamuoyuna tanıtılmış ve kullanıma açılmıştır. DİTAP sistemine kayıt gönüllülük esasına göre tamamen ücretsiz olup,www.ditap.gov.tr ve www.dijitaltarimpazari.gov.tr web adresi üzerinden Çiftçi KayıtSistemine (ÇKS) kayıtlı üreticiler (satıcılar) ile Ticaret Bakanlığının MERSİS ve ESBİSsistemlerine kayıtlı olan alıcılar e-devlet şifresi ile giriş yaparak kayıt olabileceklerdir. DİTAP Projesinin etkinliğinin ve kullanışlılığının artırılarak, projenin birçokavantajından faydalanmak için üreticilerin ve alıcıların sisteme kayıt olmaları ve aktifolarak kullanmaları gerekmekte olduğu bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Devlet Destekli Ticari Alacak Sigortası Sistemi
Sayın Üyemiz, Birliğimizin uzun yıllardır takibi sonucunda, Halk Sigorta tarafından üyelerimize yönelik "Devlet Destekli Ticari Alacak Sigortası" imkanı hayata geçirilmiştir. Bu kapsamda, söz konusu sisteme ilişkin uygulamada yaşanan sorunların 09.06.2020Salı günü mesai bitimine kadar eskisehirtb@tobb.org.tr mail adresine gönderilmesini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 1.000 Ton Mahsul Mısır ve 150.9 Ton Mahsul Ayçiçek Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,İşletmemiz 2019 yılı mahsulü Beyazkule ve Gümüşsu harman bölgelerinde bulunan toplam 1.000 ton2. ürün mahsul dane mısır ve 150.9 ton yağlık ayçiçeği borsa şartlarında 3 (üç) parti halinde peşin bedel ve açıkartırma usulü ile satılacaktır. bilgisi yer almaktadır. İhale hakkında ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Hindistan Sohbet Toplantısı
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 01.06.2020 tarih ve 29077148-743.02.01.01 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Ticaret Bakanlığı tarafından, Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere "Ticaret Müşavirlerimizle Elektronik Sohbetler" adıyla online toplantıların düzenleneceği belirtilmektedir. Bu çerçevede, ilk olarak Hindistan da görev yapmakta olan Ticaret Bakanlığı temsilcileri ile Hindistan da yerleşik 3 iş insanımızın konuşmacı olarak katılacağı "Hindistan da İş Yapabilme, Markalaşma ve Ticari Fırsatlar" sohbet toplantısının 5 Haziran 2020 Cuma günü 10.00-11.30 saatleri arasında gerçekleştirileceği ifade edilmektedir. Etkinliğe ilişkin program ile toplantı erişim linki Birliğimiz web sitesi (www.tobb.org.tr) sağ panelinde "Hizmetler" başlığı altındaki Uluslararası İş İmkânları/Yurtdışı Etkinlikler bölümünden temin edilebilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Van TSO Dünya Kahvaltı Günü Hk.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Van Ticaret ve Sanayi Odası ndan Birliğimize intikal eden 20.05.2020 tarih ve 2020-392 sayılı, 7 Haziran 2020 tarihinde Van da gerçekleştirilmesi planlanan "Dünya Kahvaltı Günü Etkinlikleri"nin COVID-19 salgını sebebiyle twitter ve instagram gibi sosyal medya platformları aracılığıyla gerçekleştirileceğine dair yazı ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
6102 sayılı Türk Ticaret Kanunu nun Geçici 13 ncü Maddesinin Uygulanmasına İlişkin Usul ve Esaslar Hakkında Tebliğ Hak.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,17 Mayıs 2020 tarihli ve 31130 sayılı Resmi Gazete de 6102 sayılı Türk Ticaret Kanunu nun Geçici 13 ncü Maddesinin Uygulanmasına İlişkin Usul ve Esaslar Hakkında Tebliğ yayınlanmıştır. Bu tebliğde sermaye şirketlerinin, 30.09.2020 tarihine kadar 2019 yılı net dönem karının yalnızca yüzde yirmi beşinin nakden dağıtımına karar verilebileceği, geçmiş yıl karları ve serbest yedek akçelerin dağıtıma konu edilemeyeceği düzenlenmektedir. Devlet il özel idaresi, belediye, köy ile diğer kamu tüzel kişilerinin ve sermayesinin yüzde ellisinden fazlası kamuya ait fonların, doğrudan veya dolaylı olarak sermayesinin yüzde ellisinden fazlasına sahip olduğu şirketlerin Tebliğ dışında olduğu düzenlenmektedir. Ayrıca bu düzenlemenin istisnaları ve bu istisnalardan yararlanılabilmesi için Bakanlıktan uygun görüş alınması gerektiği düzenlenmektedir. Tebliğin yer aldığı Resmi Gazete linki aşağıda yer almaktadır. https://www.resmigazete.gov.tr/eskiler/2020/05/20200517-7.pdf Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOBİ lere yönelik devlet desteği
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,KOBİ lerin Ar-Ge ve yenilik faaliyetleri sonucu geliştireceği ve potansiyel müşterisi hazır olan yenilikçi ürünlerin/süreçlerin, bir Müşteri Kuruluş eşliğinde ortaya çıkarılacağı ortaklı projelerin desteklenerek gerek iş birliklerinin artırılması gerekse Ar-Ge destekleri için ayrılan kamu kaynaklarının daha etkin kullanımının sağlanması amacıyla "Siparişe Dayalı Ar-Ge Projeleri için KOBİ Destekleme Çağrısı (Sipariş Ar-Ge 2020)" açılmıştır. Çağrı tanıtım broşürü ekte sunulmaktadır. Bahse konu çağrı kapsamında bir "Müşteri Kuruluş" ve en az bir "Tedarikçi Kuruluş" ortak başvuru yapabilecek olup, proje bütçesinin üst sınırı 2.500.000 TL olarak belirlenmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Kuru İncir Satışı
Sayın Üyemiz, TMO Genel Müdürlüğü tarafından yapılan açıklamada,Mart ayında başlayan toptan kuru incir satışlarımıza Haziran ayında da devam edilecek olup satışlarımız öncelikli olarak talep toplama usulü ileyapılacağı bildirilmektedir. Ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Taşınmaz Kira İhale İlanı
Sayın Üyemiz, T.C.Kültür ve Turizm Bakanlığı Vakıflar Genel Müdürlügünden Borsamıza gelen yazıda, Kütahya Vakıflar Bölge Müdürlügü Kütahya, Afyonkarahisar, Eskişehir ve Uşak İllerinde bulunan boş 16 adet vakıftaşınmaz sözleşme tarihinden itibaren 31.12.2021 tarihine kadar kiraya verilmek üzere 2886Sayılı Yasa hükümlerine göre Açık Teklif Usulü ile ihaleye çıkartılmış olup, Açık TeklifUsulü kiralama ihaleleri ekte gönderilen ihale ilanında yazılı gün ve saatte Kütahya daKütahya Vakıflar Bölge Müdürlüğümüz hizmet binasında yapılacağı bildirilmiştir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türk-Rus Ticaret, Yatırımlar ve Bölgesel İşbirliği Çalışma Grubu
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 01.06.2020 tarihli ve 68876019-724.99 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda, İlgide kayıtlı yazıda, Türk-Rus KEK 14. Dönem Toplantısında oluşturulan "Ticaret, Yatırımlar veBölgesel İşbirliği Çalışma Grubu"nun üçüncü toplantısının önümüzdeki dönemde video konferansyöntemiyle gerçekleştirilmesi öngörüldüğü belirtilerek, söz konusu toplantıda gündeme getirilmesindefayda görülen konulara ilişkin bilgi talep edilmektedir.Bu itibarla, konunun ilgili üyelerinize duyurularak, "Ticaret, Yatırımlar ve Bölgesel İşbirliği ÇalışmaGrubu"nun toplantı hazırlıklarında kullanılmak üzere, Rusya Federasyonu ile mal ve hizmet ticaretindekarşılaşılan problemler, pazara giriş engelleri, çözüm önerileri, ticaretin kolaylaştırılmasına yöneliktedbirler, ülkemizdeki yatırım imkânları, yatırım projeleri ve Rusya Federasyonu nda yatırımcılarımızınkarşılaştıkları sorunlar gibi konulara ilişkin görüşlerinizin en geç 5 Haziran 2020 cuma günü mesaisaati bitimine kadar Borsamıza (E-posta: eskisehirtb@tobb.org.tr) iletilmesi hususu rica ederiz Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Arabuluculuk ve tahkim webinarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,birliğimiz tarafından "Ticari Uyuşmazlıklarda Alternatif Çözüm Yöntemleri: Arabuluculuk ve Tahkim" konularında 4 Haziran 2020 Perşembe günü saat 14:00 de http://webinar.tobb.org.tr adresinde internet üzerinden bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin duyuru ekte yer almaktadır. İki oturum halinde gerçekleştirilecek seminerin saat 14:00 de başlayacak ilk oturumunda "Ticari Uyuşmazlıklarda Arabuluculuk", saat 15:00 de başlayacak ikinci oturumunda ise "Ticari ve Yatırım Uyuşmazlıklarında Tahkim" konuları ele alınacaktır. Seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacak olup seminere katılım ücretsizdir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Çeltik Kırım İmalatı
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda,Çorum Şube Müdürlüğünce Osmancık Ajans Amirliği depolarında bulunan 187 ton 3551 kodlu Osmancık-97 çeşidi ile 247 ton Özgür CL çeşidi çeltiğin imalata verilmesi uygun görülmüştür. Bu kapsamda çeltik kırımına ilişkin Teknik Şartname ve ayrıntılı bilgi ekteki dokümanlarda bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Hububat, bakliyat ve pirinç satışı
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, Kurumun stoklarında bulunan ekli listede (Ek-1) yer alan mısır, pirinç ve çeltikler aşağıda belirtilen esaslar ve ekte (Ek-2) yer alan fiyatlarla 01 – 30 Haziran 2020 tarihleri arasında peşin bedel mukabili satılacaktır. Toptan ve perakende olarak satışa sunulan paketli pirinç ve bakliyatın satış fiyatları (Ek-2) 01 Haziran 2020 tarihinden itibaren Genel Müdürlüğümüzün ikinci bir talimatına kadar geçerli olacaktır. Lisanslı depolarda bulunan Elektronik Ürün Senedi (ELÜS) kapsamındaki stoklar, liman şube müdürlüklerindeki ithal mısırlar, ile Ek-1/C listedeki toptan satışa açılan pirinç ve çeltikler, TMO ELEKTRONİK SATIŞ PLATFORMU sistemi üzerinden talep toplanmak suretiyle TMO Genel Müdürlüğü Ticaret Dairesi Başkanlığınca tahsis edilecektir. Bu ürünlere ilişkin talep başvuruları şubelerinize elden değil www.tmo.gov.tr adresindeki TMO ELEKTRONİK SATIŞ PLATFORMU sistemi üzerinden yapılacağı bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COVID-19 Sonrası Türkiye-AB İktisadi ve Ticari İlişkileri
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,11 Haziran 2020 Perşembe günü, saat 15:00-16:30 arası Avrupa Birliği (AB) Türkiye Delegasyonu Başkanı Büyükelçi Sayın Christian Berger ve Türkiye Odalar ve Borsalar Birliği (TOBB) Başkanı Sayın M. Rifat Hisarcıklıoğlu nun katılımıyla "COVID-19 Sonrası Türkiye-AB İktisadi ve Ticari İlişkileri" hakkında webinar gerçekleştirilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gelir Vergisi Genel Tebliği
Sayın Üyemiz, Resmî Gazetede yayınlanan,Gelir Vergisi Genel Tebliği ile ilgili yapılan değişiklikler ve ayrıntıları linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gelir Vergisi Kanununun Geçici 67 nci Maddesinde Yer Alan Tevkifat Oranları Hk
Sayın Üyemiz, Resmî Gazetede yayınlanan,Gelir Vergisi Kanununun Geçici 67 nci Maddesinde Yer Alan Tevkifat Oranları hakkındaki kararın yürürlüğe konulması ile ilgili genelge ve ayrıntıları linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gelir Vergisi Genel Tebliğinde Değişiklik Yapılması Hakkında
Sayın Üyemiz, Resmî Gazetede yayınlanan,Gelir Vergisi Genel Tebliğinde Değişiklik Yapılmasına Dair Tebliğ ve ayrıntıları linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2019 Yılında Yapılacak Tarımsal Desteklemelere İlişkin Kararda Yapılan Değişiklik Hk.
Sayın Üyemiz, Resmî Gazetede yayınlanan,2019 Yılında Yapılacak Tarımsal Desteklemelere İlişkin Kararda Yapılan Değişiklik ve ayrıntıları linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Banka ve Sigorta Muameleleri Vergisi Nispetlerinin Tespiti Hakkında Yapılan Değişiklik
Sayın Üyemiz, Resmî Gazetede yayınlanan,banka ve sigorta muameleleri vergisi nispetlerinin tespiti hakkında yapılan değişiklik ile ilgili genelge ve ayrıntıları linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COVID-19 Kapsamında Kamu Kurum ve Kuruluşlarında Normalleşme ve Alınacak Tedbirler
Sayın Üyemiz, Resmî Gazetede yayınlanan, "COVID-19 Kapsamında KamuKurum ve Kuruluşlarında Normalleşmeve Alınacak Tedbirler" konulu genelge ve ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Yerleri İçin Salgın Yönetimi ve Çalışma Rehberi
Sayın Üyemiz, T.C. Sağlık Bakanlığı, Bilimsel Danışma Kurulu tarafından hazırlanan işyerleri için Salgın Yönetimi ve Çalışma Rehberi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Sellektöraltı Buğday Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda09.06.2020 gunu saat 10.00 da ısletmemızın 2019 yılı uretımı 3.573,85 ton mahsul buğday ve 523,10 ton selektöraltı buğday satıs ıhalesı, sanlıurfa tıcaret borsasında (bugday pazarı burosu satıs salonunda) yapılacaktır. ıhale ıle ılgılı gereklı evraklarhttps://www.tigem.gov.tr/Ihale/Detay/a89c5301-c82b-4fa5-95f4-90ed3089c1cfınternet sıtemızın ıhaleler bolumunde yayınlanmıştır bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Kuzey Makedonya Hükümetinin Stratejik Yatırım Duyurusu
Sayın Üyemiz, İlgi : Dışişleri Bakanlığı nın 20.05.2020 tarihli ve 31322579 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgide kayıtlı yazıda, Kuzey Makedonya Hükümeti tarafından ekonomik büyüme, istihdam artışı, yeniteknolojilerin kullanımı ve yatırımı teşvik amacıyla "Stratejik Yatırım" statüsü verilebilecek projeler içinbaşvuru sürecinin başlatıldığı ve birçok alanda gerçekleştirilebilecek projeler için son başvuru tarihinin 31Ocak 2021 olduğu belirtilmektedir. Detaylı bilgi http://www.economy.gov.mk/doc/2810 adresinde yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Dünya Hububat ve Bakliyat Raporu
Sayın Üyemiz, TMO tarafından hazırlanan "Dünya Hububat ve Bakliyat Raporu" Mayıs sayısı yayınlanmıştır. Rapor ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2020 Yılı Bitki Sağlığı Uygulama Programı
Sayın Üyemiz, İlgi : 12.05.2020 tarihli, 1339618 sayılı ve "2020 Yılı Bitki Sağlığı Uygulama Programı" konulu yazınız Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Tarım ve Orman Bakanlığı ndan alınan "ilgi" yazıda; Bakanlıkları tarafından 2020 yılında ülkemizde gerçekleştirilecek bitki sağlığı uygulama programı ve esaslarını içeren 2020 Yılı Bitki Sağlığı Uygulama Programı nın hazırlandığı ve https://www.tarimorman.gov.tr/GKGM/Menu/86/Bitki-Sagligi-Ve-Karantina linkinden ulaşılabileceği bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Dünya Kahvaltı Günü
Sayın Üyemiz, Van TSO dan Borsamıza gönderilen yazıda,7 Haziran 2020 tarihinde ilimizde yapılması planlanan Dünya KahvaltıGünü etkinlikleri Pandemiye dönüşen Covid-19 virüsü nedeniyle ne yazıkki bu yıl bir araya gelinerek kutlanamayacaktır. Dünya Kahvaltı Günününbu yıl ilk defa kutlanacak olması ve insanlarımızı bir nebze de olsa busalgın hastalığın psikolojik etkinlerinden uzaklaştırmak amacıyla sosyalmedya platformları aracılığıyla kutlanacağı bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COSME Başvurular ve Proje Önerileri
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı ndan (KOSGEB) Birliğimize intikal eden 28/04/2020 tarihli ve 60014838-745.01.01 -E.3970 sayılı; ülkemizde KOSGEB Koordinatörlüğünde sürdürülen "KOBİ lerin Rekabet Edebilirliği Programı (COSME)" kapsamında "Social Economy Missions" proje teklif çağrısını içeren yazı ekte gönderilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kazandıran Restoran Destek Çeki Kampanyası
Sayın Üyemiz, TOBB ve Yemeksepeti tarafından düzenlenenKazandıranRestoranDestekÇekiKampanyası, küçük işletme niteliğindeki restoranların bozulan nakit akışını düzeltmeye destek olmak amacıyla başlatılmıştır. Kampanyaya katılan restoranlar, Yemeksepeti kullanıcılarına hediye çeki satarak, satıştan elde edilen geliri vade beklemeden ve komisyonsuz hemen alabileceklerdir. Ayrıntılı bilgi için tıklayınız. İlgili Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fas Tarafından Sıcak Haddelenmiş Sac İthalatına Karşı Kesin Korunma Önlemi
Sayın Üyemiz, İlgi : a) 25.10.2019 sayılı ve 10700 sayılı yazımız. b) Ticaret Bakanlığı ndan alınan 13.05.2020 tarihli ve E-00054361158 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgi(a) da kayıtlı yazımızda, Fas tarafından "Sıcak Haddelenmiş Sac" ile ilgili 22 Ekim 2019 tarihinden itibaren 200 gün boyunca % 25 ek vergi uygulanacağı bildirilmişti. Bu defa, Ticaret Bakanlığı ndan alınan ve ekte bir örneği sunulan yazıda, Fas tarafından sıcak haddelenmiş sac ithalatı için söz konusu önlemin %25 lik ek vergi şeklinde kesin önleme dönüştürüldüğü, ilgili önlemin 3 yıl boyunca uygulanacağı, ilk yıldan sonra % 25 lik ek verginin her yıl % 1 oranında düşürülmesine karar verildiği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO ya Ürün Teslimi Hakkında
Sayın Üyemiz / Üreticilerimiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, Yeni Tip Koronavirüs salgınının alım döneminde devam etmesi halinde alınan tedbirler kapsamında, kronik hastalığı bulunan, 20 yaş altı ve 65 yaş üstü üreticilerimizin ekteki muhtar onaylı "Ürün Teslimat Belgesi" ile belirleyecekleri kişi eliyle ürün teslimatı yapabilecekleri bildirilmiştir. ayrıntılı bilgi ve "Ürün Teslimat Belgesi" ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
81 İl Valiliğine 65 Yaş ve Üzeri Vatandaşlarımız İçin Seyahat İzin Belgesi Genelgesi
Sayın Üyemiz, İç İşleri Bakanlığınca yayınlanan genelge ilesokağa çıkmaları kısıtlanan 65 yaş ve üzerindeki vatandaşlarımıza (üç yıl içinde organ ve kemik iliği nakli olanlar, immün yetmezliği olanlar ile böbrek yetmezliği nedeniyle diyalize giren hastalar hariç) seyahat izin belgesi almak ve gittikleri yerlerde en az 30 gün kalmak şartı ile istedikleri yerleşim yerine gidebilecek. Bu kapsamda, 65 yaş ve üzeri vatandaşlarımıza seyahatlerinde bir kişi refakat edebilecek. 65 yaş ve üzeri vatandaşlar; Seyahat İzin Belgesitaleplerini, 21 Mayıs Perşembe günü, saat 09.00’dan itibaren elektronik ortamda E-Devlet, İçişleri Bakanlığı, E-Başvuru Sistemi ve Alo 199 Vefa Destek Hattı üzerinden yapılabileceği belirtilmiştir. Ayrıntılı bilgi için lütfen tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Meteorolojik Uyarı
Sayın Üyemiz; İlimizde 21-26 mayıs tarihleri arasında serin ve yağışlı sistemle birlikte hava sıcaklıklarının hissedilir derecede azalması, yerel dolu yağışı, sel, su baskınları bekleniyor. mağduriyet yaşanmaması adına, gerekli önlemlerin alınması önemle rica olunur. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
81 İlde 22.05.2020 Saat 24.00 İle 26.05.2020 Saat 24.00 Arasında Uygulanacak Sokağa Çıkma Kısıtlaması
Sayın Üyemiz, İç İşleri Bakanlığının yayınladığı genelgeyle, yaklaşmakta olan Ramazan Bayramı süresince Koronavirüs (Covid-19) salgınının halk sağlığı açısından oluşturabileceği riskleri yönetebilmek adına alınabilecek ek tedbirler 18.05.2020 Pazartesi günü Sayın Cumhurbaşkanımızın Başkanlığında toplanan Cumhurbaşkanlığı Kabinesinde değerlendirilmiş; Bilim Kurulunun önerileri ve Koronavirüsle mücadelede edinilen tecrübeler ışığında, 81 ilimizde Ramazan Bayramı arifesine denk gelen 23 Mayıs 2020 Cumartesi gününden başlayarak 24-25-26 Mayıs 2020 tarihlerinde sokağa çıkma kısıtlaması uygulanmasına karar verildiği belirtilmiştir. Genelgenin ayrıntıları ve istisnaları için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
81 İl Valiliğine Şehir Giriş-Çıkış Tedbirleri Genelgesi
Sayın Üyemiz, İç İşleri Bakanlığının 81 il valiliğineŞehir Giriş-Çıkış Tedbirlerikonulu ek genelge gönderdi. Genelge ile büyükşehir statüsündeki 14 il ile Zonguldak’a kara, hava ve deniz yolu ile (toplu ulaşım aracı, özel araç vb.) yapılacak tüm giriş/çıkışlar15 günlük süreyle 19 Mayıs 2020 Salı günü saat 24.00 dan 03 Haziran 2020 Çarşamba günü saat 24.00’a kadar geçici süreyle durdurulacak. Ayrıntılı bilgi içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB, Amazon.com.tr ve Boğaziçi Üniversitesi iş birliğiyle BiTıkla Avrupa Sanal Eğitim
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,TOBB,Amazon.com.trve Boğaziçi Üniversitesi iş birliğiyle Eylül 2019’da hayata geçirilen “BiTıklaAvrupa” eğitim programı, Türk firmalarının ürünlerini Amazon’un Avrupa’daki 5 pazaryeri (Almanya, Fransa, İngiltere, İspanya, İtalya) üzerinden tüm AB ülkelerine e-ihracat yoluyla sunmalarına destek olmayı amaçlamaktadır. Eğitimler kapsamında dijitalleşmeyle gelişen müşteri beklentileri, e-ticarette başarılı olabilmek için dikkat edilmesi gereken unsurlar ve Amazon üzerinden Avrupa’ya e-ihracat yapmanın tüm adımları (sisteme kayıt, ürün listeleme, fiyatlandırma, lojistik modeller, satışları artırma yolları, masraf kalemleri, reklam verme vb.) detaylı bir şekilde ele alınmaktadır. Ülkemizde ve dünyada kamu sağlığını tehdit eden Covid-19 salgını nedeniyle tüm sektörlerin ticari faaliyetlerinde sıkıntı çektiği bu dönemde, e-ticaret ve e-ihracat büyük bir fırsat sunmaktadır. KOBİ lerimizi bu yönde desteklemek amacıyla BiTıklaAvrupa programı eğitimleri20 Mayıs ve 27 Mayıs 2020 tarihlerindesanal eğitim seminerleri olarak düzenlenecektir. Sanal eğitimler tüm illerden TOBB çatısı altında bulunan tüm odalarımızın üye firmalarının katılımına açık ve ücretsizdir. Programla ilgili tüm detaylar ve katılım başvurusu içinwww.bitiklaavrupa.comweb sitesini ziyaret edebilirsiniz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye Bankalar Birliği Yönetim Kurulundan Kamuoyu Duyurusu
Sayın Üyemiz, Türkiye Bankalar Birliği Yönetim Kurulu tarafından 18 Mayıs 2020 tarihinde uygulanacak “Sokağa Çıkma Kısıtlaması” kararına istinaden, kısıtın uygulanacağı illerdeki şubeler ve bankacılık işlemleriyle ilgili aşağıdaki kararlar alınmıştır: ·Bakanlık kararı gereği 15 ilde 18 Mayıs Pazartesi günü banka şubeleri kapalı olacaktır. · Kısıtlama kapsamındaki 15 ilde yerleşik olan ve edimlerini yerine getirmek isteyen müşteriler, her türlü bankacılık işlemini şube dışı kanalları kullanarak yerine getirebilecektir. · Bankalara, bu müşterilerin edimlerinin 20 Mayıs 2020 tarihine ötelenmesi tavsiye edilmiştir. · Ayrıca, bankalardan 15 ilde yerleşik müşterilerin 18 Mayıs 2020 tarihli ödemelerine ilişkin olarak Türkiye Bankalar Birliği Risk Merkezi’ne yapılan bildirimlerin Risk Merkezi Genelgesi’nin Mücbir Haller Uygulamasına göre yapılması istenmiştir. · 15 il dışındaki şubelere çek ibrazında müşterilerin hamil sıfatı ile işlem yapılmasını talep etmesi halinde, hesapta para varsa ödemesi gerçekleştirilecek, hesapta karşılık yoksa hamil ile konuşularak ve hak kaybı olmadığı belirtilerek, 18 Mayıs tarihinde çek hakkında işlem yapılmayacaktır.Hamil tarafından 20 Mayıs 2020 Çarşamba günü ibraz edilecek çekin ise hesapta bakiye olması halinde ödemesi yapılacak yoksa düzenlemelere göre işlemin gerçekleştirileceği bilgisi çek hamiline açıklanacaktır. · Bu açıklamaya rağmen çek hamili, 18 Mayıs’ta ibraz ettiği çekin karşılığı olmaması halinde buna dair şerh verilmesinde ısrar ettiği durumda, muhatap banka tarafından konuya ilişkin mevzuat hükümlerine göre uygulama gerçekleştirilecektir. Bu durumda, bankalardan 15 ilede yerleşik müşterilerin 18 Mayıs 2020 tarihli ödemelerine ilişkin olarak Türkiye Bankalar Birliği Risk Merkezi’ne bildirimleri Risk Merkezi Genelgesi’nin Mücbir Haller Uygulamasına göre yapılacaktır. Türk Ticaret Kanununun 811. Maddesinde; (1) Kanunen belirli olan süreler içinde çekin ibrazı veya protesto edilmesi veya buna denk bir belirlemenin yapılması, bir devletin mevzuatı veya herhangi bir mücbir sebep gibi aşılması imkânsız bir engel nedeniyle gerçekleştirilememişse, bu işlemler için belirli olan süreler uzar. (2) Hamil, mücbir sebebi gecikmeksizin kendi cirantasına ihbar etmeye ve bu ihbarı çeke veya alonja kaydedip, bunun altına, yerini ve tarihini yazarak imzalamakla zorunludur. 723 üncü madde hükümleri burada da uygulanır.” hükmü yer almaktadır. Bu hükme göre, son ibraz süresi 18 Mayıs 2020 olan çekler için bu madde kullanılabilecek olup, ibraz süresi son gün olmayan çekler için sorun bulunmamaktadır. · Öte yandan senetler ile ilgili olarak Türkiye Noterler Birliği tarafından yapılan açıklamada, vadesi 18 Mayıs 2020 tarihine rastlayan senetlerin protesto işlemlerinin 21 Mayıs 2020 tarihinde gerçekleştirileceği belirtilmiştir. Uygulamanın yukarıdaki kararlar çerçevesinde yapılması durumunda, alacaklıların ve borçluların durumu olumsuz etkilenmeyecektir. Üyelerimizin bilgisine sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
SGK Genelgesi.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Sosyal Güvenlik Kurumu nun 07/05/2020 tarihi ve 2020/12 sayılı genelgesinde; Çin in Vuhan kentinde ortaya çıkan yeni tip Koronavirüs (COVID-19) ün çok hızlı bir küresel yayılım göstererek neredeyse tüm dünya ülkelerini etkilediği ve Dünya Sağlık Örgütünce pandemik (salgın) bir hastalık olarak ilan edildiği. ülkemizinde söz konusu salgından olumsuz yönde etkilendiği, 5510 sayılı Sosyal Sigortalar ve Genel Sağlık Sigortası Kanununun 15 inci maddesinde; "4 üncü maddenin birinci fıkrasının (a) ve (b) bentleri kapsamındaki sigortalının, iş kazası ve meslek hastalığı dışında kalan ve iş göremezliğine neden olan rahatsızlıklar, hastalık halidir." hükmünün yer aldığı, Buna göre; COVID-19 virüsünün bulaşıcı bir hastalık olduğu dikkate alındığında, söz konusu salgına maruz kalan ve sağlık hizmet sunucularına müracaat eden sigortalılara hastalık kapsamında provizyon alınması gerektiği hususları belirtilmiştir. Bu kapsamda Koronavirüs (COVID-19) bulaşıcı hastalık olarak değerlendirildiği için bu vakalarla ilgili olarak Sosyal Güvenlik Kurumuna iş kazası veya meslek hastalığı bildirimi yapılmayacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Akreditifli İşlemlerde Manuel Menşe Şahadetnamesi Düzenlenmesi
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgi : a) 03.04.2020 tarihli ve 3486 sayılı yazımız. b) Ticaret Bakanlığı ndan alınan 05.05.2020 tarihli elektronik posta. İlgi(a) da kayıtlı yazımızda, özetle, 8 Nisan 2020 tarihinden itibaren Menşe Şahadetnamesi ve Özel Menşe Şahadetnamesi (FORM-A) nin sadece MEDOS üzerinden elektronik olarak düzenlenip onaylanacağı bildirilmişti. Diğer taraftan, Odalarımızdan muhtelif tarihlerde alınan şifahi geri bildirimlerde 8 Nisan 2020 tarihinden önce veya hemen akabinde açılmış akreditiflerde yer alan ilgili maddeler uyarınca manuel onaylanmış Menşe Şahadetnamesi talebinde bulunulduğu açıklanmıştır. Birliğimizce konu hakkında Ticaret Bakanlığı ile iletişime geçilmiş olup, söz konusu Bakanlıktan alınan ilgi(b) de kayıtlı elektronik postada, ihracatçılarımızın mağduriyet yaşamaması için bir kereye mahsus olması ve açılmış akreditiflerde menşe şahadetnamelerinin ıslak mühür/ıslak imza kullanılarak manuel düzenlemesi veya MEDOS sisteminde mevcut olmayan ibarelerin yer alması şartının bulunması halinde ilgili belgenin manuel düzenlenmesinin uygun olacağı açıklanmıştır. Bu itibarla, 8 Nisan 2020 tarihinden önce veya hemen akabinde açılmış akreditiflerde manuel Menşe Şahadetnamesi onay talebi ile MEDOS ta teknik nedenlerden dolayı belge üzerine tatbik edilemeyen bazı hususların söz konusu olması halinde, bahse konu durumu kanıtlayan tevsik edici dokümanlar alınmak kaydı ile istisnai olarak manuel belge onayı yapılmasının uygun olduğu değerlendirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esaslar Hakkında
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,COVID-19 salgını nedeniyle alınan önlemler kapsamında Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esaslar a ilişkin aşağıda yer alan tedbirler uygulanacaktır: Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esasların Yetki belgesinin yenilenmesi başlıklı 12 nci maddesi gereğince düzenleyicilerin, belge süresinin sona ereceği tarihten en geç altı ay öncesinde üyesi olduğu odaya başvurmaları gerekir. Fuar Düzenleme Yetki Belgesi 31 Aralık 2020 tarihinde sona erecek olan düzenleyicilerin bu yıla mahsus olmak üzere yenileme başvurularını 30 Ağustos 2020 tarihine kadar yapmasına izin verilmesi, Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esasların Yetki belgesi başvurusu yapan firmalarda aranacak şartlar başlıklı 8 inci maddesi gereğince firmaların "En az iki yüz elli bin Türk Lirası ödenmiş sermayeye sahip bulunması ve bu sermayeyi özvarlığı içinde koruması" gerekmektedir. Bu konunun tespiti için Yetki Belgesi sahibi firmalardan en az iki yüz elli bin Türk Lirası sermayenin öz varlık içinde korunduğuna dair mali durumunu 2 yılda bir talep edilmesine karar verilmişti. Ancak içinde bulunulan şartlar göz önüne alındığında bu raporun 2020 yılı için talep edilmemesi, 2020 yılında düzenlenmek üzere Fuar Takviminde yer alan ancak içinde bulunulan süreçten dolayı, fuarlarını 2021 yılına ertelemek isteyen düzenleyicilerin başvurularının kabul edilmesi, Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esasların Fuar Sonuç Raporu başlıklı 20 nci maddesi gereğince düzenleyicilerin, fuar sonuç raporlarını 15 gün içinde Birliğe gönderilmesi gerekmektedir. Anılan maddenin ikinci fıkrasında "Raporun belirtilen süre içerisinde gönderilmemesi ya da gönderilen raporun içerdiği bilgilerin ve/veya eklerin eksik olması durumunda düzenleyiciye Birlik tarafından ihtar verilir." hükmü yer almaktadır. Ancak içinde bulunulan dönemde süresi içinde Birliğe intikal etmeyen fuar sonuç raporları için müeyyidenin uygulanmaması. Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esaslar uyarınca oda ve borsalara yapılacak olan iptal, erteleme ve takvime ekleme başvuru evraklarının ilerleyen dönemlerde fiziki olarak teslim edilmesi şartıyla elektronik ortamda iletilmesinin uygun olduğu. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Buğday Sapı Satış İhalesi
Syın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda, TİGEMtoplam 274.612 dekar alanda istihsaledilecek ihtiyaç fazlası buğday sapı, 51 (ellibir) parti halinde satış yapılacağı bildirilmiştir. Ayrıntılı bilgi ekteki dokümanlardan elde edilecektir. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
2020 I. Geçici Vergi Dönemine (Ocak-Şubat-Mart) Ait Gelir ve Kurum Geçici Vergi Beyannamelerinin Verilme ve Ödeme Süreleri Uzatıldı.
Sayın Üyemiz, 12 Mayıs 2020 tarihli ve 130 Sıra No.lu Vergi Usul Kanunu Sirküleri ile 18 Mayıs 2020 günü sonuna kadar verilmesi gereken 2020 I. Geçici Vergi Dönemine (Ocak-Şubat-Mart) ait Gelir ve Kurum Geçici Vergi Beyannamelerinin verilme süreleri ile bu beyannameler üzerine tahakkuk eden vergilerin ödeme süreleri 28 Mayıs 2020 Perşembe günü sonuna kadar uzatılmıştır. Söz konusu Sirkülere ulaşmak içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
16-17-18 ve 19 Mayıs 2020 Tarihleri Arasında İlimizde Uygulanacak Olan Sokağa Çıkma Kısıtlaması Hakkında Alınan İl Umumi Hıfzıssıhha Kurul Kararı
Sayın Üyemiz, İl Umumi Hıfzıssıhha Kurulunun 16-19 Mayıs Tarihleri Arasında Uygulanacak Sokağa Çıkma Yasağına İlişkin 12.05.2020 Tarihli Kararını görüntülemek için lütfen tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Halal Expo Nigeria (Erteleme)
Sayın Üyemiz, a) 25.02.2020 tarihli ve 1929 sayılı yazımız. b) Abuja Ticaret ve Sanayi Odası nın 12.05.2020 tarihli ve 15693 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,ilgi (a) da kayıtlı yazımız ile duyurusu yapılan "Halal Expo Nigeria" etkinliğinin 13-15 Ekim 2020 tarihlerineertelendiği Abuja Ticaret ve Sanayi Odası nın ilgi (b) de kayıtlı yazısı ile Birliğimize bildirilmiş olup, bahsekonu yazı ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Nisan Ayı Fenolojik Değerlendirme Yayımlandı
Sayın Üyemiz, TMOMerkez ve Taşra teşkilatı teknik personelinin sahadan birebir gözlem, meterolojik veri ve teknik bilgilerle hazırladığı"Fenolojik Değerlendirme – Hububat ve Bakliyatta Yağış, Ekiliş ve Gelişim Analizi"Nisan sayısı yayımlandı. Rapor ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14 Büyükşehir ve Zonguldak a Giriş/Çıkışların Kısıtlanması 19 Mayıs Saat 24.00 a Kadar Uzatıldı
Sayın Üyemiz, İç işleri Bakanlığının, 81 İl Valiliğine “Şehir Giriş/ Çıkış Tedbirleri” konulu genelge gönderdi. Genelge ileAnkara, Balıkesir, Bursa, Eskişehir, Gaziantep, İstanbul, İzmir, Kayseri, Kocaeli, Konya, Manisa, Sakarya, Samsun, Vanve Zonguldak olamak üzere toplam 15 İle yapılacak kara, hava ve deniz yolu ile (toplu ulaşım aracı, özel araç vb.) gerçekleştirilecek tüm giriş/çıkış kısıtlılığının devam edeceği. Buna karşılık Adana, Denizli, Diyarbakır, Kahramanmaraş, Mardin, Ordu, Şanlıurfa, Tekirdağ ve Trabzonillerimize hava, kara ve deniz yoluyla yapılacak giriş/çıkış kısıtlaması kaldırıldırıldığı bildirildi. Ayrıntılı bilgi içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Hububat ve Bakliyat Alımında Uygulanacak Randevu Sistemi Hakkında Kamuoyu Açıklaması
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, 2020 dönemi hububat (buğday, arpa, çavdar, tritikale ve yulaf) ve bakliyat alımlarını geçtiğimiz yıllarda olduğu gibi randevulu olarak yapacaktır. Lisanslı Depolarda yapılacak alımlarda randevu şartı aranmayacak olup, randevulu alım ile ilgili usul ve esasları içerir duyuru metni yazının ekinde sunulduğu belirtilmiştir. Randevulu alım ile ilgili usul ve esaslar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 3.940 Baş Reforme Kuzu Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda, damızlık fazlası 3.940 baş reforme erkek kuzu 8 parti halinde satışihale duyurusu yapılmaktadır. İlgili ihale ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
65 Yaş ve Üzeri/20 Yaş Altı/Kronik Rahatsızlığı Bulunan Kişilerin Sokağa Çıkma Kısıtlaması İstisnası Genelgesi
Sayın Üyemiz, İç İşleri Bakanlığı tarafından yayınlanan genelgede,81 ilde sokağa çıkmaları kısıtlanan 65 yaş ve üzeri ile kronik rahatsızlıkları olan vatandaşların ve ihtiyaç duyulan hallerde refakatçilerinin 10 Mayıs Pazar günü, 11.00-15.00 saatleri arasında yürüme mesafesiyle sınırlı olmak, sosyal mesafe kuralına riayet etmek ve maske takmak kaydıyla dışarı çıkabilecek. Sokağa çıkmaları kısıtlaması bulunan 14 yaş ve altı çocukların 13 Mayıs Çarşamba günü; 15-20 yaş arasındaki gençlerin ise 15 Mayıs Cuma günü, 11.00-15.00 saatleri arasında yürüme mesafesiyle sınırlı olmak, sosyal mesafe kuralına riayet etmek ve maske takmak kaydıyla istisna olarak dışarı çıkmalarına izin verileceği bildirilmiştir. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
24 İlde 8.5.2020 Saat 24.00 İle 10.5.2020 Saat 24.00 Arasında Uygulanacak Olan Sokağa Çıkma Kısıtlaması
Sayın Üyemiz, İç İşleri Bakanlığımız tarafından alınan tedbirlerin, bulaşın yayılım hızının düşürülmesine olan etkisinin en üst noktaya taşınabilmesi amacıyla; Büyükşehir statüsündeki 23 ilimiz ile Zonguldak ilini kapsayacak şekilde, İl İdaresi Kanununun 11/C maddesi ile Umumi Hıfzıssıhha Kanununun 27 ve 72 nci maddeleri uyarınca il valileri tarafından aşağıdaki ek tedbirin alınması gerekmektedir. Bu kapsamda; 08.05.2020 tarihi saat 24.00 ile 10.05.2020 tarihi saat 24.00 arasında aşağıda belirtilen istisnalar hariç olmak üzere Büyükşehir statüsündeki Adana, Ankara, Balıkesir, Bursa, Denizli, Diyarbakır, Eskişehir, Gaziantep, İstanbul, İzmir, Kahramanmaraş, Kayseri, Kocaeli, Konya, Manisa, Mardin, Ordu, Sakarya, Samsun, Şanlıurfa, Tekirdağ, Trabzon, Van ve Zonguldak olmak üzere toplam 24 ilimiz sınırları içinde bulunan vatandaşlarımızın sokağa çıkmaları kısıtlanacaktır. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Hububat ve Bakliyat Satış Duyurusu
Sayın Üyemiz, TMO Genel Müdürlüğünden Borsamıza gönderilen yazıda, Elektronik Satış yoluyla hububat ve bakliyat satışı yapılacağı bildirilmiştir. Ayrıntılı bilgi ekteki dokümanlarda bilginize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs Salgınıyla Mücadelede Rusya Federasyonunca Alınan Tedbirler
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 29.04.2020 tarihli ve 54123342 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,ilgide kayıtlı yazıda, Rusya Federasyonu nda koronavirüs salgınıyla mücadele kapsamında alınan ve ihdas süreci halihazırda yürütülmekte olan tedbirlere ilişkin Moskova Ticaret Müşavirliğimizce güncellenen tablo iletilmektedir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Kamuoyu Açıklaması
Sayın Üyemiz, TMO nin yapmış olduğu Kamuoyu Açıklamasında2020 yılı hasat dönemi hububat ve bakliyat alım fiyat ve politikalarından bahsedilmiş olup ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23 Büyükşehir ve Zonguldak a Giriş/Çıkışların Kısıtlanması 19 Mayıs Saat 24.00 a Kadar Uzatıldı
Sayın Üyemiz, İç işleri Bakanlığının, 81 İl Valiliğine “Şehir Giriş/ Çıkış Tedbirleri” konulu genelge gönderdi. Genelge ile Adana, Ankara, Balıkesir, Bursa, Denizli, Diyarbakır, Eskişehir, Gaziantep, İstanbul, İzmir, Kahramanmaraş, Kayseri, Kocaeli, Konya, Manisa, Mardin, Ordu, Sakarya, Samsun, Şanlıurfa, Tekirdağ, Trabzon, Van ve Zonguldak olamak üzere toplam 24 İle yapılacak kara, hava ve deniz yolu ile (toplu ulaşım aracı, özel araç vb.) gerçekleştirilecek tüm giriş/çıkışlar 15 gün süreyle kısıtlandı. Buna karşılık Aydın, Antalya, Erzurum, Hatay, Malatya, Mersin ve Muğla illerimize hava, kara ve deniz yoluyla yapılacak giriş/çıkış kısıtlaması kaldırıldırıldı. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşe Devam Desteği - Küçük İşletme Can Suyu Kredisi
Sayın üyemiz, Halkbak tarafından, Küresel bir salgına dönüşen ve etkileri ülkemizde de hissedilen Korona virüsü ile mücadele kapsamında, küçük işletme düzeyinde olan ve ihtiyaç duydukları kredi kaynaklarına ulaşmakta zorluk çeken Sanayi, Ticaret, Sanayi ve Ticaret Odaları ile Ticaret Borsaları ve Deniz Ticaret Odalarına kayıtlı şahıs firmalarının desteklenmesi amacıylaEkonomik İstikrar Kalkanı tedbirlerikapsamında‘‘İşe Devam Desteği-Küçük İşletme Can Suyu Kredisi’’oluşturulmuştur. Krediden yararlanacak “şahıs firmasının”; Sanayi, Ticaret, Sanayi ve Ticaret Odası, Ticaret Borsası ve Deniz Ticaret Odaları’na kayıtlı olması, Yıllık cirosunun 3.000.000 TL’yi aşmaması, İktisadi faaliyetlerine devam etmesi ve firmanın 01.04.2020 tarihinden evvel kurulmuş olması, Bankamız Esnaf Destek Paketi’nden faydalanmamış olması, İflas, fesih, iflas erteleme, iflas erteleme tedbir ve konkordato kararı olmaması ve aktif takip kaydının bulunmaması, önkoşullarını taşıması gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Traktör Ve Biçerdöver Satışı İhalesi
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,06.05.2020 tarihinde yapılacak olan traktör ve biçerdöver satışı ihalesi satışihale duyurusu yapılmaktadır. İlgili ihale ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
TİGEM Yapağı Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda,11.05.2020 tarihinde yapılacak olan 187 ton yapağı satışihale duyurusu yapılmaktadır. İlgili ihale ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Et ve Süt Kurumu Dondurulmuş Karkas Sığır Eti Satış Duyurusu
Sayın Üyemiz, Et ve Süt Kurumu Genel Müdürlüğünden Borsamıza gönderilen yazıda, Türkiye genelinde faaliyet gösteren Yemek Şirketleri ve Kırmızı Et Sanayi alanında fiilen faaliyet gösteren firmalara27.04.2020tarihinden itibaren Dondurulmuş Çeyrek Karkas Sığır Eti satışı yapılacaktır. Dondurulmuş Çeyrek Karkas Sığır Eti satış fiyatımız peşin olarak28,00 TL/Kg + KDVolup, Kredi Kartı ile tek çekim29,00 TL/Kg+ KDV, 30 gün vadeli ödemelerde ise29,00 TL/Kg.+ KDV. fiyatla ve mal bedeli tutarının en az %10 fazlası kadar Banka Teminat Mektubunun ilgili Kombina Müdürlüğüne tevdi edilmesi ile gerçekleştirilecektir. Satışla ilgili tüm detaylar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Rail Baltica İhalesi Hk.
Sayın Üyemiz, İlgi : Vilnius Ticaret Müşavirliği nin 16.04.2020 tarihli e-posta yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Vilnius Ticaret Müşavirliğimizin ilgide kayıtlı yazısı ile, Rail Baltica isimli Finlandiya, Estonya, Letonya, Litvanya ve Polonya yı demiryolu hattıyla bağlamak için devam eden büyük bir demiryolu altyapı projesinin bulunduğu bildirilmekte olup, projenin 2026 yılında tamamlanmasının ve 5.8 milyar Euro ya mal olmasının beklendiği belirtilmektedir. Ayrıca,https://www.railbaltica.org/procurement/e-procurement-system/adresinden de ulaşılabileceği üzere söz konusu projede enerji sistemleri için bir ihale açıldığı, ihaleye teklif verme süresinin 11 Mayıs a kadar olduğu bildirilmektedir. Yazıda devamla, ölçeği, kapsamı ve yapısı itibariyle ülkemiz müşavirlik ve müteahhitlik firmaları için oldukça ciddi fırsatlar barındırdığı ifade edilen projenin ihale şartlarına http://www.railbaltica.org/procurement/e-procurement-system/ adresinden ulaşılabileceği belirtilmektedir. Söz konusu projenin ihale sürecinde Letonya dan hukuki destek almak isteyen şirketlerimiz Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Letonya" bölümünden hukuk firmalarının listesine ulaşabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2020/10 Sayılı İthalatta Yerinde Gümrükleme İşlemleri Genelgesi
Sayın Üyemiz, İlgi : 15.04.2020 tarihli ve 53904587 sayılı Ticaret Bakanlığı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,ilgi de kayıtlı yazıda, 21.02.2020 tarihli ve 31046 sayılı 1. mükerrer Resmi Gazete de yayımlanan Gümrük İşlemlerinin Kolaylaştırılması Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik ile ithalatta yerinde gümrükleme uygulamasının iş akışları revize edilmiştir. Bu kapsamda, ithalatta yerinde gümrükleme işlemlerini daha detaylı açıklamak üzere hazırlanan "İthalatta Yerinde Gümrükleme İşlemleri" konulu 2020/10 sayılı Genelge eki kılavuzuna "https://www.ticaret.gov.tr/gumruk-islemleri/yetkilendirilmis-yukumlu-statusu/belgeler" adresi üzerinden ulaşılabilmesi mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fas Kamu İhaleleri Hakkında Alınan COVID-19 Tedbiri
Sayın Üyemiz, İlgi : Ticaret Bakanlığı ndan alınan 22.04.2020 tarihli ve E-00054008223 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda, ilgi de kayıtlı ve ilişikte bir örneği sunulan yazıda, Fas genelinde COVID-19 salgınına karşı 20 Mart 2020 tarihinde başlayıp 20 Mayıs 2020 tarihine kadar sürecek olan olağanüstü sağlık hali ve sokağa çıkma yasağı gibi önlemlerden dolayı, kamu ihaleleri yüklenicilerinin söz konusu süre içerisinde devam eden projelerinin olumsuz etkilenmesi halinde, bu durumun mücbir sebep olarak kabul edilmesi kararının ilgili idari otorite tarafından alındığı belirtilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fas ta Gümrük Muafiyeti Başvurularının Elektronik Olarak Gerçekleştirilmesi
Sayın Üyemiz, İlgi : 15.04.2020 tarihli ve 53880045 sayılı Ticaret Bakanlığı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,ilgi de kayıtlı yazıda, Rabat Ticaret Müşavirliği tarafından yapılan bilgilendirmede, Fas Ekonomi, Finans ve İdarenin Reformu Bakanlığı, Gümrükler ve Dolaylı Vergiler İdaresi tarafından yayımlanan 9 Nisan 2020 tarihli ve 6035/200 Gümrük sirküleri uyarınca, tarife kotaları ve tercihli anlaşmalar kapsamındaki gümrük muafiyetlerinden yararlanan eşyanın ithalinin gerçekleştirilmesinde gümrük muafiyeti başvurularının, (Demandes de Franchise Douanière) 8 Nisan 2020 tarihi itibariyle gümrüklerde kullanılan elektronik uygulama olan PORTNET sistemi üzerinden yapılmaya başlanacağı ifade edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
31 İlde 30.04.2020-03.05.2020 Tarihlerinde Uygulanacak Sokağa Çıkma Kısıtlaması
Sayın Üyemiz, İç İşleri Bakanlığının 81 İl Valiliğine yeni tip Kovid 19 salgını ile mücadele kapsamında “Sokağa Çıkma Kısıtlaması Genelgesi” gönderdi. Genelge ile büyükşehir statüsündeki 30 il ile Zonguldak’ta 30 Nisan Perşembe günü saat 24.00 ile 03 Mayıs Pazar günü saat 24.00 arasında sokağa çıkma kısıtlaması uygulanacak. Uygulama hakkında ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fas a Gerçekleştirilecek İhracatta Uygunluk Kontrolleri
Sayın Üyemiz, İlgi : a) 20.02.2020 tarihli ve 1771 sayılı yazımız. b) Ticaret Bakanlığı ndan alınan 21.04.2020 tarihli ve E-00053982737 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgi(a) da kayıtlı yazımızda, Fas a ithal edilen sanayi ürünlerinin yerel mevzuat çerçevesinde uygunluk kontrollerinin 1 Şubat 2020 tarihinden itibaren dış kaynak kullanılarak gerçekleştirileceği belirtilmekle birlikte, yazımızda yer alan ürün listesi dışında kalan tüm sanayi ürünleri için 20 Nisan 2020 tarihine kadar tanımlanan geçiş döneminde, Fas gümrük noktalarında söz konusu uygunluk kontrollerinin yapılabileceği açıklanmıştır. Diğer taraftan, ilgi(b) de kayıtlı ve ilişikte bir örneği sunulan yazıda, Fas a gerçekleştirilen ihracat özelinde uygunluk kontrolleri ile ilgili daha önce 20 Nisan 2020 olarak belirlenen geçiş dönemi süresinin, COVID-19 nedeniyle 19 Haziran 2020 tarihine kadar uzatıldığı ve 20 Haziran 2020 tarihi itibariyle geçiş döneminin sona ereceği belirtmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğde Değişiklik
Sayın Üyemiz; Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğ (Tebliğ No: 2019/46)’de Değişiklik Yapılmasına Dair Tebliğ (No: 2020/10)24 Mart 2020 Tarih 31078 sayılı Resmi Gazetede yayımlanmıştır. Tebliğ metnine ulaşmak için lütfenTIKLAYINIZ.
Soğuk Depoculuk Hizmeri
Sayın Üyemiz, Et ve Süt Kurumu Genel Müdürlüğünden Borsamıza gönderilen yazı ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kredi Garanti Fonu (KGF) Bilgilendirme Semineri
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği Başkanı M. Rifat Hisarcıklıoğlu, KGF Yönetim Kurulu Başkanı Faik Yavuz ve KGF Genel Müdürü Kasım Akdeniz’in katılımı ile gerçekleştirilecek olan seminerde “Kredi Garanti Fonu” anlatılacak olup, seminer sonunda KOBİ’lerin konu hakkındaki soruları cevaplandırılacaktır. Toplantıyahttp://webinar.tobb.org.tr linkinden katılabilirsiniz. Tüm üyelere katılım ücretsizdir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 4500 Baş Reforme Erkek Kuzu Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda, İvesi ırkı 4.500 baş reforme erkek kuzu 6 parti halinde satışihale duyurusu yapılmaktadır. İlgili ihale ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Yurt İçi Fuarların Ertelenmesi Hakkında
Sayın Üyemiz, İlgi : Ticaret Bakanlığının 20.04.2020 tarihli ve 53962251 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,İlgi yazı ile Sağlık Bakanlığı bünyesinde oluşturulan Koronavirüs Bilim Kurulu önerileri doğrultusunda 2020yılı fuar takviminde yer alan fuarlardan Mayıs ve Haziran ayında düzenlenmesi planlananların 1 Temmuzsonrası döneme ertelendiği bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye Bankalar Birliği Yönetim Kurulundan Kamuoyu Duyurusu
Sayın Üyemiz, T.C. İçişleri Bakanlığı’nın 21 Nisan 2020 tarihli “Sokağa Çıkma Kısıtlaması” kararına istinaden 31 ilde 24 Nisan Cuma günü banka şubeleri kapalı olacaktır. Bu çerçevede, kısıtlama kapsamındaki 31 ilde yerleşik olan ve edimlerinin yerinegetirilmesinin son günü 24 Nisan 2020 tarihi olan müşterilere; Her türlü bankacılık işlemlerini ve edimlerini şube dışı kanalları kullanarak yerine getirilmesinin hatırlatılması, Veya müşterilerin edimlerinin 27 Nisan 2020 tarihine ötelenmesihususlarında üyelerimize tavsiyede bulunulmasına karar verilmiştir. Üyelerimizin bilgisine sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
LÖSEV Ramazan Kampanyası
Sayın Üyemiz, LÖSEV Vakfının Covid-19 Riski sebebiyle dijital olarak yürüttüğü Ramazan Kampanyası ile ilgili ayrıntılı bilgilinkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Ödeneği Bilgilendirme Semineri
Sayın Üyemiz, İstihdamın korunması adına Kamu-İşveren-Çalışan birlikteliğin sağlandığı" sistem hakkında 22 Nisan 2020 tarihinde saat 14:00 tehttps://tobb.org.tr/Sayfalar/20200409-kisa-calisma-odenegi.phpadresinde internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere katılım ücretsiz olup, bilgilerinize sunulur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Ödeneği
Sayın Üyemiz, İŞKUR Eskişehir İl Müdürlüğünden Borsamıza gönderilen yazıda, Kısa Çalışma Ödeneği başvurularının sonuçlanması için 21.04.2020 tarihinden itibaren başvuru yapan firmalara geri dönüş yapılmaya başlanmıştır. Bu kapsamda, Eskişehir Çalışma ve İş Kurumu İl Müdürlüğü personelleri sokağa çıkma kısıtlaması olan 23-24-25-26 Nisan 2020 tarihlerinde çalışmalarına devam edeceği, firma yetkililerine e-mail yada telefon marifetiyle ulaşılacağı, firma yetkililerinin e-mail adresleri ve telefonlarını belirtilen tarihlerde kontrol etmeleri gerekliliği bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO ELÜS Nohut Satışı
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gelen yazıda,Kurumun stoklaklarında bulunan ve ek listede belirtilen ELÜS nohut stokları 3.000 TL/Ton fiyattan TURİB üzerinden kişi ve kuruluş ayrımı yapılmaksızın serbest satışa açılmıştır. Alıcılar 21 Nisan 2020 tarihinden 30 Nisan 2020 tarihine kadar saat 10.00-12.00 saatleri arasında TÜRİB ekranından direkt alım emri vererek nohut alımı yapabileceklerdir. (ELÜS nohut satışları TMO Elektronik Satış Platformundan yapılmayacaktır.) ELÜS nohut satışları TÜRİB’de, TMO’nun normal emir defterine emir girişi ile (açığa serbest satış) gerçekleşecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (20 Nisan 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 20 NİSAN TARİHİ İTİBARİYLE EKONOMİDE HAYATA GEÇEN YENİ DÜZENLEMELER Eximbank kredileri için Kredi Garanti Fonu kefaleti kullanılabilecek Kısa çalışma ödeneği başvuruları için uygunluk tespitinin tamamlanması beklenmeksizin, işverenlerin beyanı doğrultusunda, kısa çalışma ödemesi gerçekleştirilecek İşveren tarafından ücretsiz izine ayrılan çalışanlar ile 15 Mart 2020 tarihinden sonra iş sözleşmesi sona erdirilen ancak işsizlik sigortasından yararlanamayanlara 3 ay süreyle günlük 39,24 TL ödeme yapılacak Sendikalar ve toplu iş sözleşmesi kanunu kapsamında yürütülen yetki ve toplu sözleşme prosedürleri 3 ay süreyle uzatılacak Yeni koronavirüs (COVID-19) salgını ile ilgili zorlayıcı sebepler kapsamında; Devlete ait ormanlarda ve mesire yerlerinde, orman izinleri ile bunlardan tahsil edilecek bedeller, başvuru şartı aranmaksızın 3 ay ertelenecek Hazine taşınmazlarına ilişkin sözleşmeye istinaden ödenmesi gereken bedeller ile ecrimisiller 3 ay ertelenebilecek Milli parklarda yapılan kiralamalardan tahsil edilmesi gereken bedeller başvuru şartı aranmaksızın 3 ay ertelenecek Faaliyetleri durdurulan veya faaliyette bulunmayan işletmelerin yıllık ilan ve reklam vergileri ile çevre temizlik vergilerinin faaliyette bulunmayan dönemlere isabet eden kısmı alınmayacak Faaliyetleri durdurulan veya faaliyette bulunmayan işletmelerin su giderleri 3 ay süreyle ertelenebilecek Lisanslı depoların 2020 yılı içinde geçerlilik süresi dolacak olan lisansların geçerlilik süresi bir yıl uzatılacak Tüm gemi, deniz araçları, gemi adamları ve şirketlerin belgeleri 3 ay süreyle uzatılacak Denizde Can ve Mal Koruma Hakkında Kanun kapsamında yapılacak denetlemeler 1 Ağustos 2020 tarihine kadar ertelenecek 30 Nisan 2020 günü sonuna kadar verilmesi gereken 2019 hesap dönemine ait “Kurumlar Vergisi” beyannamelerinin verilme süreleri ile bu beyannameler üzerine tahakkuk eden vergilerin ödeme süreleri, 1 Haziran 2020 gün sonuna kadar uzatıldı Seyahat Acentaları Birliği’ne ödenen yıllık aidat, 2020 yılında alınmayacak Her türlü iş sözleşmesi 17 Nisan 2020 tarihinden itibaren üç ay süreyle İş Kanunu’nun 25 inci maddesinin birinci fıkrasının iki numaralı bendinde belirtilen sebepler dışında işveren tarafından feshedilemeyecek Sermaye şirketlerinde 30 Eylül 2020 tarihine kadar 2019 yılı net dönem kârının yalnızca yüzde 25’ine kadarının dağıtımına karar verilebilecek. Bu kapsamda; Geçmiş yıl karları ve serbest yedek akçeler dağıtıma konu edilemeyecek. Madde kapsamına giren sermaye şirketlerine ilişkin istisnalar ile uygulamaya dair usul ve esasları belirlemeye Ticaret Bakanlığı yetkili olacak Üretici, tedarikçi ve perakende işletmeler tarafından satış fiyatında fahiş artış yapılamayacak ve serbest rekabeti bozucu faaliyetler ile tüketicinin mallara ulaşmasını engelleyici faaliyetlerde bulunulamayacak. Bu kapsamda; Yukarıdaki hususlara yönelik düzenlemeler yapmak, gerektiğinde denetim ve incelemelerde bulunarak idari para cezası uygulamak üzere 13 üyeden oluşan “Haksız Fiyat Değerlendirme Kurulu” oluşturulacak Kurul üyeleri içerisinde “Türkiye Odalar ve Borsalar Birliği” temsilcisi de yer alacak 17 Nisan 2020 tarihinden itibaren, 3 aylık süreyi geçmemek üzere, işveren işçiyi tamamen veya kısmen ücretsiz izine ayırabilecek, bu durum işçiye haklı nedene dayanarak sözleşmeyi fesih hakkı vermeyecek
Suudi Arabistan Krallığının Sınır Kapılarında Aldığı Tedbirler
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 15.04.2020 tarihli ve 53898442 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı ndan alınan ilgide kayıtlı yazıda, Dışişleri Bakanlığı ndan alınan bir yazıya atfen, Suudi Arabistan Krallığı nın sınır kapılarında aldığı tedbirlere ilişkin Nota paylaşılmaktadır. Anılan Nota da, Suudi Arabistan Krallığı tarafından; 1) Ülkeye yapılacak eşya sevkiyatında deniz ve havayolu nakliyesi kullanılması, mecbur kalınmadıkça karayolu kullanılmaması, 2) Sınır kapılarında geçici vize uygulamasının başladığı, 3) Sınır kapılarından girişlerde virüs taraması yapılacağı, 4) Transit geçişlerde sadece gıda, ilaç ve tıbbi malzeme için izin verileceği, 5) Ülkeye giren TIR lara takip cihazı yerleştirilerek 96 saat içinde çıkışlarının isteneceği, süre bitiminde mali ceza uygulanacağı, 6) Gıda, ilaç ve tıbbi malzeme harici eşya nakliyatında ülkeye giren araçlarda şoför veya çekicinin değiştirileceği ilan edilmiştir. Suudi Arabistan Krallığı nın aldığı tedbirlere ilişkin Dışişleri Bakanlığı ndan alınan Nota nın örneği ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs Salgınıyla Mücadelede Alınan Tedbirler
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 15.04.2020 tarihli ve 53904826 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı ndan alınan ilgide kayıtlı yazıda, Rusya Federasyonu nda koronavirüs salgınıyla mücadelekapsamında alınan önlemlere ilişkin tablo iletilmektedir. Moskova Ticaret Müşavirliği tarafından hazırlanansöz konusu tablo ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
30 Büyükşehir ve Zonguldak İlinde 23-24-25-26 Nisan Tarihlerinde Uygulanacak Sokağa Çıkma Kısıtlaması
İç İşleriBakanlığı tarafından 81 İl Valiliğine yeni tip Kovid 19 salgını ile mücadele kapsamında “Sokağa Çıkma Kısıtlaması Genelgesi" gönderilmiştir. Genelge ile büyükşehir statüsündeki 30 İl ile Zonguldak il sınırlarında 22 Nisansaat 24.00 ile 26 Nisan 24.00 saatleri arasında belirtilen istisnalar hariç olmak üzere vatandaşların sokağa çıkmaları kısıtlanacak. Bakanlığımız tarafındanvaliliklere gönderilengenelgede, Koronavirüs salgınının görüldüğü andan itibaren, Sağlık Bakanlığı ve Bilim Kurulunun önerileri, Cumhurbaşkanımız Sn. Recep Tayyip Erdoğan’ın talimatları doğrultusunda; salgının/bulaşının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme, sosyal izolasyonu temin, sosyal mesafeyi koruma ve yayılım hızını kontrol altında tutma amacıyla birçok tedbir kararı alınarak uygulamaya geçirildiği belirtildi. Alınan tedbirlerin, bulaşının yayılım hızının düşürülmesine olan etkisinin en üst noktaya taşınabilmesi amacıyla; Büyükşehir statüsündeki 30 il ile Zonguldak ilini kapsayacak şekilde, İl İdaresi Kanununun 11/C maddesi ile Umumi Hıfzıssıhha Kanununun 27 ve 72 nci maddeleri uyarınca il valileri tarafından aşağıdaki ek tedbirlerin alınması gerektiği ifade edildi. Bu kapsamda; 1. 22.04.2020 tarihi saat 24.00 ile 26.04.2020 tarihi saat 24.00 arasında aşağıda belirtilen istisnalar hariç olmak üzere Büyükşehir statüsündeki 30 ilimiz (Adana, Ankara, Antalya, Aydın, Balıkesir, Bursa, Denizli, Diyarbakır, Erzurum, Eskişehir, Gaziantep, Hatay, İstanbul, İzmir, Kahramanmaraş, Kayseri, Kocaeli, Konya, Malatya, Manisa, Mardin, Mersin, Muğla, Ordu, Sakarya, Samsun, Şanlıurfa, Tekirdağ, Trabzon, Van) ile Zonguldak il sınırları içinde bulunan tüm vatandaşlarımızın sokağa çıkmaları kısıtlanacaktır. 2. Açık Olacak İşyeri, İşletme Ve Kurumlar a) Sokağa çıkma kısıtlama/yasaklamanın günlük hayata etkisini en az düzeyde tutmak amacıyla; a.1- Ramazan ayının başlayacak olması münasebetiyle, sokağa çıkma kısıtlaması/yasaklamasının olacağı günlerin öncesinde,21.04.2020 Salıve22.04.2020 Çarşambagünleri market ve bakkalların çalışma saatleri08.00-23.00olarak belirlenmiştir. a.2- Sokağa çıkma kısıtlaması/yasaklamasının olduğu23.04.2020 Perşembeve24.04.2020 Cuma günleri marketler ve bakkallar 09.00-14.00 saatleri arasında faaliyet gösterebilecek, vatandaşlarımız (65 yaş ve üzeri ile 20 yaş ve altında bulunanlar hariç olmak üzere) zorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın market ve bakkallara gidip gelebilecektir. Aynı saatler arasında marketler ve bakkallar evlere/adrese servis şeklinde de satış yapabileceklerdir. a.3- 25.04.2020 Cumartesi ve 26.04.2020 Pazar günleri marketler ve bakkallar kapalı olacaktır. b)23.04.2020 Perşembe, 24.04.2020 Cuma, 25.04.2020 Cumartesi ve 26.04.2020 Pazar günleri, ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı işyerleri ile bu işyerlerinin sadece ekmek satan bayileri, ayrıca tatlı üretiminin yapıldığı/satıldığı işyerleri (Bu işyerlerinde sadece ekmek, unlu mamul ve tatlı satışı yapılabilir.) açık olacaktır. 23.04.2020 Perşembe, 24.04.2020 Cuma günleri vatandaşların dışarı çıkamadığı saatler ile 25.04.2020 Cumartesi ve 26.04.2020 Pazar günleri tatlı satış amaçlı işyerleri sadece evlere/adrese servis şeklinde satış yapabileceklerdir. c)Ramazan ayı münasebetiyle, sokağa çıkma kısıtlaması/yasaklamasının olacağı günler olan 23.04.2020 Perşembe, 24.04.2020 Cuma, 25.04.2020 Cumartesi ve 26.04.2020 Pazar günleri, sadece evlere paket servis şeklinde olmak üzere lokanta ve restoran tarzı işyerleri, ç)İlaç, tıbbi cihaz, tıbbi maske ve dezenfektan üretimi, nakliyesi ve satışına ilişkin faaliyetleri yürüten işyerleri, d)Kamu ve özel sağlık kurum ve kuruluşları, eczaneler, veteriner klinikleri ve hayvan hastaneleri, e)Zorunlu kamu hizmetlerinin sürdürülmesi için gerekli kamu kurum ve kuruluşları ile işletmeler (Havalimanları, limanlar, sınır kapıları, gümrükler, karayolları, huzurevleri, yaşlı bakım evleri, rehabilitasyon merkezleri, Acil Çağrı Merkezleri, AFAD Birimleri, Vefa Sosyal Destek Birimleri, Göç İdaresi, PTT vb.), f)Valilikler/Kaymakamlıklar tarafından yerleşim merkezleri için her 50.000 nüfusa bir adet ve il sınırları içinden geçen şehirlerarası karayolu ve varsa otoyol üzerinde her 50 km için bir adet olmak üzere belirlenecek sayıda akaryakıt istasyonu ve lastik tamircisi (Bu madde kapsamında açık olacak akaryakıt istasyonları ile lastik tamircileri kura yöntemi ile belirlenecektir ve nöbetçi akaryakıt istasyonlarının marketleri açık olacaktır.), g)Doğalgaz, elektrik, petrol sektöründe stratejik olarak faaliyet yürüten büyük tesis ve işletmeler (Rafineri ve petrokimya tesisleri ile termik ve doğalgaz çevrim santralleri gibi), ğ)Su, gazete ve mutfak tüpü dağıtım şirketleri, h)Hayvan barınakları, hayvan çiftlikleri ve hayvan bakım merkezleri, ı)Sağlık hizmetlerinin kapasitesini arttırmaya yönelik acil inşaat, donanım vb. faaliyetleri yürüten işletme/firmalar, i)Bulunduğu yerin İl/İlçe Hıfzıssıhha Kurulu tarafından izin verilmesi şartı ile makarna, un ve unlu mamüller, süt, et, balık üretimi gibi gıda maddelerinin üretiminin yapıldığı tesisler ve kâğıt, kolonya üretimi başta olmak üzere hijyen malzemeleri ile bu malzemelerin üretimi için ihtiyaç duyulacak hammaddelerin üretiminin yapıldığı tesisler, j)Yurt içi ve dışı taşımacılık (ihracat/ithalat/transit geçişler dahil) ve lojistiğini yapan firmalar, k)Oteller ve konaklama yerleri, l)Gıda, temizlik ve ilaç gibi sektörlere ambalaj sağlayan üretim tesisleri, m)Çalışanları inşaat alanında/maden alanında bulunan şantiyede konaklayarak yapımı veya çalışması devam eden büyük inşaatlar ile madenler (Bu madde kapsamında inşaat ve konaklama aynı şantiye alanı içinde ise izin verilir, başka bir yerden çalışanların gelmesine ve şantiyede kalanların başka bir yere gitmelerine izin verilmez. Çalışma alanı sadece inşaat alanı/maden sahaları ile sınırlıdır.), n)Gazete, radyo ve televizyon kuruluşları ile gazete basım matbaaları, o)Daha önceden sözleşmeye/taahhüde bağlanmış ve belirlenen süre içerisinde yetiştirilmesi gereken ihracata konu; mal, malzeme, ürün, araç-gereç üreten iş yerleri ve tesisler (istisna olarak mevcut zorunluluklarını ispatlamaları ve anılan şartlara uymaları kaydıyla), ö)Sokağa çıkma kısıtlaması/yasaklamasının olduğu 23.04.2020 Perşembe ve 24.04.2020 Cuma günleri sebze-meyve halleri, 3- İstisnaKapsamındaOlanKişiler a)Bu Genelgenin (2) numaralı başlığında yer alan “Açık Olacak İşyeri, İşletme ve Kurumlarda” yönetici, görevli veya çalışanlar, b)23.04.2020 Perşembe günü ile sınırlı olmak üzere TBMM çalışanları, c)Kamu düzeni ve güvenliğinin sağlanmasında görevli olanlar (Özel güvenlik görevlileri dahil), ç)Acil Çağrı Merkezleri, AFAD, Kızılay ve Vefa Sosyal Destek Birimlerinde görev alanlar, d) Cenaze defin işlemlerinde görevli olanlar (din görevlileri, hastane ve belediye görevlileri vb.) ile birinci derece yakınlarının cenazelerine katılacak olanlar, e)Elektrik, su, doğalgaz, telekomünikasyon vb. kesintiye uğramaması gereken iletim ve altyapı sistemlerinin sürdürülmesi ve arızalarının giderilmesinde görevli olanlar, f)Ürün ve/veya malzemelerin nakliyesinde ya da lojistiğinde (kargo dahil), yurt içi ve yurt dışı taşımacılık, depolama ve ilgili faaliyetler kapsamında görevli olanlar, g)Yaşlı bakımevi, huzurevi, rehabilitasyon merkezleri, çocuk evleri vb. sosyal koruma/bakım merkezleri çalışanları, ğ)Otizm, ağır mental retardasyon, down sendromu gibi “Özel Gereksinimi” olanlar ile bunların veli/vasi veya refakatçileri, h)Demir-çelik, cam, ferrokrom vb. sektörlerde faaliyet yürüten işyerlerinin yüksek dereceli maden/cevher eritme fırınları ile soğuk hava depoları gibi zorunlu olarak çalıştırılması gereken bölümlerinde görevli olanlar, ı)Bankalar başta olmak üzere yurt çapında yaygın hizmet ağı olan kurum, kuruluş ve işletmelerin bilgi işlem merkezlerinin çalışanları (asgari sayıda olmak kaydıyla), i)Bozulma riski bulunan bitkisel ve hayvansal ürünlerin üretimi, işlenmesi, pazarlanması ve nakliyesinde çalışanlar, j)Küçükbaş-büyükbaş hayvanları otlatanlar, arıcılık faaliyetini yürütenler, sokak hayvanlarını besleyecek kişiler ile ikametinin önü ile sınırlı olmak kaydıyla evcil hayvanlarının zorunlu ihtiyacını karşılamak üzere dışarı çıkacaklar, k)Veteriner hekimler, l)Ekmek dağıtımı ile marketler ve bakkalların evlere servis hizmetinde görevli olanlar, m)Zorunlu sağlık randevusu olanlar (Kızılay a yapılacak kan ve plazma bağışları dahil), n)Yurt, pansiyon, şantiye vb. toplu yerlerde kalanların gereksinim duyacağı temel ihtiyaçların karşılanmasında görevli olanlar, o)İş sağlığı ve güvenliği nedeniyle işyerlerinden ayrılmaları riskli olan çalışanlar (iş yeri hekimi vb.), ö)Servis hizmeti vermek üzere dışarıda olduklarını belgelemek şartı ile teknik servis çalışanları, p)Tarımsal üretimin devamlılığı için gerekli olan ekim-dikim, sulama-ilaçlama gibi faaliyetler kapsamında bölgesel özelliklere göre İl/İlçe Hıfzıssıhha Kurullarınca izin verilenler, r)Belediyelerin toplu taşıma, temizlik, katı atık, su ve kanalizasyon, ilaçlama, itfaiye ve mezarlık hizmetlerini yürütmek üzere hafta sonu çalışacak personel, s)Sokağa çıkma kısıtlaması/yasaklamasının olduğu 23.04.2020 Perşembe ve 24.04.2020 Cuma günleri 06.00-09.00 saatleri arasında marketler ve bakkallar ve 26.04.2020 Pazar günü saat 18.00 dan sonra geçerli olmak üzere tedarik zincirinin aksamaması amacıyla; marketler ve sebze- meyve hallerine mal, malzeme ve ürünlerin nakli, depolanması, mal kabulü ve satışa hazırlanması aşamasında görevli olanlar (Bu madde kapsamında hiçbir şekilde mal, malzeme ve ürün satışı yapılamaz.), Belirtilen istisnalar dışındaki tüm vatandaşların evlerinde kalması esas olacak. -Seyahat izin belgeleri sokağa çıkma kısıtlaması/yasaklaması süresince geçerli olacak. -Başta sağlık ve güvenlik olmak üzere kamu düzeninin tesisi amacıyla görevli olan kamu görevlilerinin şehir içi toplu ulaşımlarını teminen belediyelerce gerekli tedbirler alınacak. -Ekmek dağıtımının düzenli olması amacıyla Vali ve Kaymakamların başkanlığında fırıncılar odası, yerel yönetim, emniyet ve jandarma temsilcilerinin katılımıyla oluşacak komisyon tarafından, her mahalle için muhtar görüşü de alınarak ivedilikle il/ilçe ekmek dağıtım planı yapılacak, bu planda il/ilçedeki ekmek üreten işyerlerinin sorumlu oldukları dağıtım bölgeleri (mahalle/cadde/sokak ölçeğinde) ile her dağıtım bölgesi için görev yapacak araç listeleri belirlenecek. Bu şekilde yapılacak planlama dışında sadece Vefa Sosyal Destek Birimleri ekmek dağıtımını gerçekleştirebilecek. Sokağa çıkma kısıtlaması/yasaklamasının olduğu 23.04.2020 Perşembe ve 24.04.2020 Cuma günleri gazete dağıtımı/satışı marketler ve bakkallar aracılığı ile yapılacak. 25.04.2020 Cumartesi ve 26.04.2020 Pazar günleri ise gazete dağıtımı, sadece gazete şirketlerinin ring halinde çalışacak kendi dağıtım araçları, tespit edilecek içme suyu dağıtım bayileri ve Vefa Sosyal Destek Birimleri aracılığıyla yapılacak (Gazete dağıtımının evlere servis şeklinde yapılması esastır.). -Bu Genelgenin (2) numaralı “Açık Olacak İşyeri, İşletme ve Kurumlar” başlığının (i) maddesi ile (3) numaralı “İstisna Kapsamında Olan Kişiler” başlığının (p) maddesi kapsamındakilere yönelik kararlar, İl/İlçe Hıfzıssıhha Kurullarınca en geç 22.04.2020 Çarşamba günü saat 22:00 a kadar alınacak. Bakanlık söz konusu tedbirlere ilişkin Valiler/Kaymakamlar tarafından ilgili mevzuat uyarınca gerekli kararların ivedilikle alınması, uygulamada herhangi bir aksaklığa meydan verilmemesi ve mağduriyetlere neden olunmamasını istedi. Alınan kararlara uymayan vatandaşlara Umumi Hıfzıssıhha Kanununun 282 nci maddesi gereğince idari para cezası verilmesi başta olmak üzere aykırılığın durumuna göre Kanunun ilgili maddeleri gereğince işlem yapılması, konusu suç teşkil eden davranışlara ilişkin Türk Ceza Kanununun 195 inci madde kapsamında gerekli adli işlemler başlatılacak. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticari Alacak Sigortası Sunumu
Sayın Üyemiz, KOBİ lerin alacaklarını garanti altına alan ve tahsil edememeleri durumunda, alacaklarının önemli bir kısmını devlet destekli havuzdan karşılayan "Devlet Destekli Ticari Alacak Sigortası" sistemi hakkında 16 Nisan 2020 tarihinde online olarak gerçekleştirilen seminere ait sunum notları ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İslam Kalkınma Bankası nın Covid-19 İçin Alacağı Tedbirler Hk.
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 13.04.2020 tarihli ve 52229414-724.01.01 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı nın ilgide kayıtlı yazısı ile, Cidde Ticaret Ataşeliği nden alınan yazıya atfen, İslamKalkınma Bankası nın Covid-19 salgınının kontrol altına alınmasını teminen üye ülkeler için yaklaşık 2,3milyar ABD doları tutarında bir bütçe ayırdığı, konuya ilişkin olarak söz konusu Ataşeliğimizce İslamKalkınma Bankası (İKB) yetkilileri ile yapılan görüşmede, hâlihazırda üye ülkelerin ihtiyaç analizininhazırlandığı ve bu kapsamda yine üye ülkeler tarafından tedarik edilebilecek ürünlerin bir envanterininoluşturulduğu ifade edilmektedir.Yazıda devamla, özellikle medikal ekipman, ilaç, gıda ve temel tüketim malzemeleri olmak üzere üyeülkelerin ciddi manada söz konusu ürünlere ihtiyaç duydukları, ilgili sektörlerdeki üreticilerimiz veihracatçılarımızın İKB nin aşağıda yer alan Türkiye ofisleri kanalıyla tedarik edebilecekleri ürün, miktar vefiyat bilgilerini İKB ye iletebileceği belirtilmektedir. İKB Türkiye ofisleri ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Eskişehir İli Hayvan Sağlık Zabıtası Komisyon Kararı
Sayın Üyemiz, Eskişehir Valiliği İl Tarım ve Orman Müdürlüğünden Borsamıza gönderilen yazıda, İlimiz 2020 yılı Hayvan Hastalıkları İle Mücadele ve Hayvan Hareketlerinin Kontrolü ve Canlı Hayvan Pazarının kapatılması ile ilgili, 20.03.2020 tarih ve 2020/01 sayılı Eskişehir İli Hayvan Sağlık Zabıtası Komisyon Kararı bildirilmektedir. Karar hakkında bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
TİGEM Tiftik Satış İhalesi
Sayın Üyemiz, TİGEM Anadolu Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda, tiftik satışihale duyurusu yapılmaktadır. İlgili ihale ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Şehir Giriş­ / Çıkış Tedbirleri
Sayın Üyemiz, T.C. İç İşleri Bakanlığı İller İdaresi Genel Müdürlüğü tarafından Covid-19 tedbirleri kapsamında "Şehir Giriş/Çıkış Tedbirleri" seyahat sınırlandırılmasının uzatılması ile ilgili yayınlanan bildiri metnine ekteki belgeden ulaşabilirsiniz. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sokağa Çıkma Yasağı Hakkında
Sayın Üyemiz, T.C. İçişleri Bakanlığı’nın 16.04.2020 tarih ve 89780865-153 sayılı yazısına istinaden; Alınan tedbirlerin bulaşın yayılım hızına olan etkisinin en üst noktaya taşınabilmesi amacıyla; İl İdaresi Kanununun 11/C maddesi ile Umumi Hıfzısıhha Kanununun 27 nci ve 72 nci maddesi uyarınca il valileri tarafından aşağıdaki ek tedbirlerin alındığı iletilmiştir. Bu kapsamda; 1-17.04.2020 tarihi saat 24.00 ile 19.04.2020 tarihi saat 24.00 arasında (hafta sonu) aşağıda belirtilecek istisnalar hariç olmak üzere Büyükşehir statüsündeki 30 ilimiz (Adana, Ankara, Antalya, Aydın, Balıkesir, Bursa, Denizli, Diyarbakır, Erzurum, Eskişehir, Gaziantep, Hatay, İstanbul, İzmir, Kahramanmaraş, Kayseri, Kocaeli, Konya, Malatya, Manisa, Mardin, Mersin, Muğla, Ordu, Sakarya, Samsun, Şanlıurfa, Tekirdağ, Trabzon, Van) ile Zonguldak il sınırları içinde bulunan tüm vatandaşlarımızın sokağa çıkmalarıyasaklanacaktır. 2- AÇIK OLACAK İŞYERİ, İŞLETME VE KURUMLAR •Ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı işyerleri (Bu işyerlerinde sadece ekmek ve unlu mamul satışı yapılabilir.) ile bu işyerlerinin sadece ekmek satan bayileri, •İlaç, tıbbi cihaz, tıbbi maske ve dezenfektan üretimi, nakliyesi ve satışına ilişkin faaliyetleri yürüten işyerleri, •Kamu ve özel sağlık kurum ve kuruluşları, eczaneler, veteriner klinikleri ve hayvan hastaneleri, •Zorunlu kamu hizmetlerinin sürdürülmesi için gerekli kamu kurum ve kuruluşları ile işletmeler (Havalimanları, limanlar, sınır kapıları, gümrükler, karayolları, huzurevleri, yaşlı bakım evleri, rehabilitasyon merkezleri, Acil Çağrı Merkezleri, AFAD Birimleri, Vefa Sosyal Destek Birimleri vb.), •Valilikler/Kaymakamlıklar tarafından yerleşim merkezleri için her 50.000 nüfusa bir adet ve il sınırları içinden geçen şehirler arası karayolu ve varsa otoyol üzerinde her 50 km için bir adet olmak üzere belirlenecek sayıda akaryakıt istasyonu ve lastik tamircisi (Bu madde kapsamında açık olacak akaryakıt istasyonları ile lastik tamircileri kura yöntemi ile belirlenecektir.), •Doğalgaz, elektrik, petrol sektöründe stratejik olarak faaliyet yürüten büyük tesis ve işletmeler (Rafineri ve petrokimya tesisleri ile termik ve doğalgaz çevrim santralleri gibi), •PTT, su, gazete ve mutfak tüpü dağıtım şirketleri, •Hayvan barınakları, hayvan çiftlikleri ve hayvan bakım merkezleri, •Sağlık hizmetlerinin kapasitesini arttırmaya yönelik acil inşaat, donanım vb. faaliyetleri yürüten işletme/firmalar, •*Bulunduğu yerin İl/İlçe Hıfzıssıhha Kurulu tarafından izin verilmesi şartı ile makarna, un, süt, et, balık üretimi gibi temel gıda maddelerinin üretiminin yapıldığı tesisler ve kâğıt, kolonya üretimi başta olmak üzere hijyen malzemeleri ile bu malzemelerin üretimi için ihtiyaç duyulacak hammaddelerin üretiminin yapıldığı tesisler, •Yurt içi ve dışı taşımacılık (ihracat/ithalat/transit geçişler dahil) ve lojistiğini yapan firmalar, •Oteller ve konaklama yerleri, •Gıda, temizlik ve ilaç gibi sektörlere ambalaj sağlayan üretim tesisleri, •Çalışanları inşaat alanında bulunan şantiyede konaklayarak yapımı devam eden büyük inşaatlar (Bu madde kapsamında inşaat ve konaklama aynı şantiye alanı içinde ise izin verilir, başka bir yerden çalışanların gelmesine ve şantiyede kalanların başka bir yere gitmelerine izin verilmez. Çalışma sadece inşaat alanı ile sınırlıdır.), •Gazete, radyo ve televizyon kuruluşları ile gazete basım matbaaları, 3- İSTİSNA KAPSAMINDA OLAN KİŞİLER •Bu Genelgenin (2) numaralı başlığında yer alan “Açık Olacak İşyeri, İşletme ve Kurumlarda” yönetici, görevli veya çalışanlar, •Kamu düzeni ve güvenliğinin sağlanmasında görevli olanlar (Özel güvenlik görevlileri dahil), •Acil Çağrı Merkezleri, AFAD, Kızılay ve Vefa Sosyal Destek Birimlerinde görev alanlar, •Cenaze defin işlemlerinde görevli olanlar (din görevlileri, hastane ve belediye görevlileri vb.) ile birinci derece yakınlarının cenazelerine katılacak olanlar, •Elektrik, su, doğalgaz, telekomünikasyon vb. kesintiye uğramaması gereken tedarik sistemlerinin sürdürülmesi ve arızalarının giderilmesinde görevli olanlar, •Ürün ve/veya malzemelerin nakliyesinde ya da lojistiğinde (kargo dahil), yurt içi ve yurt dışı taşımacılık, depolama ve ilgili faaliyetler kapsamında görevli olanlar, •Yaşlı bakımevi, huzurevi, rehabilitasyon merkezleri, çocuk evleri vb. sosyal koruma/bakım merkezleri çalışanları, •Otizm, ağır mental retardasyon, down sendromu gibi “Özel Gereksinimi” olanlar ile bunların veli/vasi veya refakatçileri, •Demir-çelik, cam, ferrokrom vb. sektörlerde faaliyet yürüten işyerlerinin yüksek dereceli maden/cevher eritme fırınları ile soğuk hava depoları gibi zorunlu olarak çalıştırılması gereken bölümlerinde görevli olanlar, •Bankalar başta olmak üzere yurt çapında yaygın hizmet ağı olan kurum, kuruluş ve işletmelerin bilgi işlem merkezlerinin çalışanları (asgari sayıda olmak kaydıyla), •Bozulma riski bulunan bitkisel ve hayvansal ürünlerin üretimi, işlenmesi, pazarlanması ve nakliyesinde çalışanlar, •Küçükbaş-büyükbaş hayvanları otlatanlar, arıcılık faaliyetini yürütenler, sokak hayvanlarını besleyecek kişiler ile evcil hayvanlarının zorunlu ihtiyacını karşılamak üzere dışarı çıkacaklar (ikametinin önü ile sınırlı olmak kaydıyla), •Veteriner hekimler, •Ekmek dağıtımında görevli olanlar, •Zorunlu sağlık randevusu olanlar (Kızılay’a yapılacak kan ve plazma bağışları dahil), •Yurt, pansiyon, şantiye vb. toplu yerlerde kalanların gereksinim duyacağı temel ihtiyaçların karşılanmasında görevli olanlar, •İş sağlığı ve güvenliği nedeniyle işyerlerinden ayrılmaları riskli olan çalışanlar (iş yeri hekimi vb.), •Servis hizmeti vermek üzere dışarıda olduklarını belgelemek şartı ile teknik servis çalışanları, •**Tarımsal üretimin devamlılığı için gerekli olan ekim-dikim, sulama-ilaçlama gibi faaliyetler kapsamında bölgesel özelliklere göre İl/İlçe Hıfzıssıhha Kurullarınca izin verilenler, •Belediyelerin toplu taşıma, temizlik, katı atık, su ve kanalizasyon, ilaçlama, itfaiye ve mezarlık hizmetlerini yürütmek üzere hafta sonu çalışacak personel, •19.04.2020 Pazar günü saat 18.00’dan sonra geçerli olmak üzere tedarik zincirinin aksamaması amacıyla; marketler ve sebze-meyve hallerine mal, malzeme ve ürünlerin nakli, depolanması ve satışa hazırlanması aşamasında görevli olanlar (Bu madde kapsamında hiçbir şekilde mal, malzeme ve ürün satışı yapılamaz.), •Belirtilen istisnalar dışındaki tüm vatandaşların evlerinde kalması esastır. •Daha önceki Genelgeler kapsamında düzenlenmiş olan (sağlık ve cenaze için verilenler hariç) seyahat izin belgeleri (yola çıkmış olanlar hariç) Pazartesi günü itibariyle geçerli olacaktır. •Başta sağlık ve güvenlik olmak üzere kamu düzeninin tesisi amacıyla görevli olan kamu görevlilerinin şehir içi toplu ulaşımlarını teminen belediyelerce gerekli tedbirler alınacaktır. •Ekmek dağıtımının düzenli olması amacıyla Vali ve Kaymakamların başkanlığında fırıncılar odası, yerel yönetim, emniyet ve jandarma temsilcilerinin katılımıyla oluşacak komisyon tarafından, her mahalle için muhtar görüşü de alınarak ivedilikle il/ilçe ekmek dağıtım planı yapılacak, bu planda il/ilçedeki ekmek üreten işyerlerinin sorumlu oldukları dağıtım bölgeleri (mahalle/cadde/sokak ölçeğinde) ile her dağıtım bölgesi için görev yapacak araç listeleri belirlenecektir. Bu şekilde yapılacak planlama dışında sadece Vefa Sosyal Destek Birimleri ekmek dağıtımını gerçekleştirebilecektir. •Gazete dağıtımı, sadece gazete şirketlerinin ring halinde çalışacak kendi dağıtım araçları, tespit edilecek içme suyu dağıtım bayileri ve Vefa Sosyal Destek Birimleri aracılığıyla yapılacaktır (Gazete dağıtımının evlere servis şeklinde yapılması esastır.). Bu Genelgenin (2) numaralı “Açık Olacak İşyeri, İşletme ve Kurumlar” başlığının 10.*maddesi ile (3) numaralı “İstisna Kapsamında Olan Kişiler” başlığının 19.**maddesi kapsamındakilere yönelik kararlar İl/İlçe Hıfzıssıhha Kurullarınca en geç 16.04.2020 Perşembe günü saat 22:00’a kadar alınacaktır. Belirtilen istisnalar dışındaki tüm vatandaşların evlerinde kalması esastır. Yukarıda belirtilen tedbirlere ilişkin Valiler/Kaymakamlar tarafından ilgili mevzuat uyarınca gerekli kararların ivedilikle alınması, uygulamada herhangi bir aksaklığa meydan verilmemesi ve mağduriyetlere neden olunmaması, alınan kararlara uymayan vatandaşlara Umumi Hıfzıssıhha Kanununun 282 nci maddesi gereğince idari para cezası verileceğibaşta olmak üzere aykırılığın durumuna göre Kanunun ilgili maddeleri gereğince işlem yapılması, konusu suç teşkil eden davranışlara ilişkin Türk Ceza Kanununun 195 inci maddesi kapsamında gerekli adli işlemlerin başlatılacağıhususları bilgilerinize sunulur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 4500 Baş Reforme Erkek Kuzu Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda, İvesi ırkı 4.500 baş reforme erkek kuzu 6 parti halinde satışihale duyurusu yapılmaktadır. İlgili ihale ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
T.C. Tarım ve Orman Bakanlığının Tarım ve Hayvancılık Faaliyetlerinde Bulunanların Sokağa Çıkma Yasağından Muaf Tutulacağına İlişkin Açıklaması
Sayın Üyemiz, T.C. Tarım ve Orman Bakanlığının resmi web sitesinde 15.04.2020 tarihinde yapılan açıklamada; Gıda tedarikinde ya da tarım ve hayvancılık sektöründeki üretimde herhangi bir aksaklık yaşanmaması için bir dizi önlem alındığı bu kapsamda tarım ve hayvancılık faaliyetlerinde bulunanların sokağa çıkma yasağından muaf tutulacağı belirtilerek, muafiyet kapsamına alınan gruplar aşağıdaki şekilde belirtilmiştir. "Reyon ömrü kısa olan ve hızlı bozulan(Et, Balık, meyve ve sebze, süt ve süt ürünleri)grupların ünitelerinde çalışanlarile un ve makarna sektöründe çalışanlar, hafta sonu üretimlerine devam edebilecekler. Perakende sektöründe de sorun yaşanmaması içinPazar akşamı saat 18.00 den sonra haller ve marketlerin depoları, mal kabul üniteleriaçık olacak. Buralardaçalışanlar, iş yerlerine ulaşımda sorun yaşamayacaklar. Geçtiğimiz hafta olduğu gibi bu hafta daVeteriner hekimler, hafta sonu uygulanacak olan iki günlük sokağa çıkma yasağı kapsamının dışında olacaklardır. İl ve ilçelerde, köylerimizde üreticimize ve besicimize ulaşımda bir problem yaşamayacaklar. Veteriner Hekimlerine ait klinik, poliklinik, hastaneler ve veteriner hekimlik hizmeti veren özel kuruluşlar ve çalışanları hafta sonu hizmet vermeye devam edebilecekler. Hafta sonu uygulanacak sokağa çıkma yasağının, genelge ile istisnai kapsamında olacak bir grup daTarım ve Hayvancılık üretimindeki çiftçiler üretimlerini aksatmadan devam edebileceklerdir. Aynı şekilde, Mevsimlik İşçilerinkoordinasyonu il valilerine verilmiş olup hijyen ve sağlık önemleri, il ve ilçe pandemi kurullarınca takip edilmektedir. Barınma ve diğer ihtiyaçlara ilişkin önlemler alınmaya devam edilmektedir. Üretimin aksamaması için gerekli ihtimam gösterilecektir ancak üreticiler veya veteriner hekimlerin bulundukları yerlerde herhangi bir sıkıntı olması halinde Mülki Amirlere (Kaymakamlık, Valilik, Tarım ve Orman İl, ilçe Müdürlükleri) başvurabileceklerdir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Protein Tayin Cihazı Satışı
Sayın Üyemiz, Toprak Mahsulleri Ofisi Eskişehir Şube Müdürlüğünden Borsamıza gelen yazıda, 5 adet Perten marka Protein Tayin Cihazının TMO İhale Yönetmeliğinin 22/1 maddesi kapsamında “Pazarlık Yöntemi” ile teklif alınmak suretiyle satılması ön görülmektedir. Ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Nahçıvan Özerk Cumhuriyeti’ne İhracat
Sayın Üyemiz, İlgi : Ticaret Bakanlığı ndan alınan 09.04.2020 tarihli ve E-00053775234 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı tarafından Gümrük ve Dış Ticaret Bölge Müdürlüklerine gönderilen ilgi de kayıtlı yazıda, Nahçıvan Özerk Cumhuriyeti ne çıkış yapmak üzere hareket/giriş gümrük idaresinden en geç 07.04.2020 tarihi saat 23:59 a kadar Dilucu Gümrük Müdürlüğüne sevk edilen "muz" cinsi eşya taşıyan araçların, söz konusu eşyanın Nahçıvan Özerk Cumhuriyeti ne satışının yapıldığını tevsik eden fatura ve CMR belgesi ibraz edilmesi koşuluyla, mevzuat dahilinde gerekli işlemler yapılarak Nahçıvan Özerk Cumhuriyeti ne çıkış yapmasına izin verilmesi gerektiği bildirilmiştir. Diğer taraftan yazıda, 08.04.2020 tarihinden itibaren ikinci bir bildirime kadar, hareket/giriş gümrük idaresinden Dilucu Gümrük Müdürlüğüne "muz" cinsi eşyanın sevkine izin verilmeyeceği ve Dilucu Gümrük Müdürlüğünce de söz konusu eşyanın Nahçıvan Özerk Cumhuriyeti ne çıkışı ile ilgili gümrük işlemi yapılmayacağı bildirilmektedir. Yazıda devamla, "yumurta" ve "sığır eti" cinsi eşyaların ise, Nahçıvan Özerk Cumhuriyeti nin ihtiyaçlarını karşılayacak miktarda Dilucu Gümrük Müdürlüğüne sevk edilmesini teminen Gürbulak Gümrük ve Dış Ticaret Bölge Müdürlüğü ile eşgüdüm sağlanacağı açıklanmıştır. Ayrıca, söz konusu eşyaların Nahçıvan Özerk Cumhuriyeti ne satışının yapıldığını tevsik eden fatura ve CMR belgesi ibraz edilmek koşuluyla, mevzuat dâhilinde gerekli işlemlerin tamamlanarak, Nahçıvan Özerk Cumhuriyeti ne çıkışının yapılması gerektiği belirtilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ukrayna Tarım Arazileri Kanunu Hk.
Sayın Üyemiz, İlgi : Ticaret Bakanlığı Dış Temsilcilikler ve Uluslararası Etkinlikler Genel Müdürlüğü nden alınan 03.04.2020 tarih ve 00053681511 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı Dış Temsilcilikler ve Uluslararası Etkinlikler Genel Müdürlüğü nden alınan "ilgi" yazıda; 31 Mart 2020 de Ukrayna da tarımsal amaçla kullanılan arazi satış moratoryumu 10.10.2019 tarihli 2178-10 sayılı Yasanın Ukrayna Parlamentosu tarafından onaylanan yasa ile kaldırıldığı, dolayısıyla Ukrayna dan arazi alımına yeni kriterler getirildiği bildirilmiştir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ufuk 2020 Ağlara Üyelik Desteği
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,TÜBİTAK tarafından iletilen Ağlara Üyelik Desteği hakkındaki duyuru metni ve desteklenebilecek ağların listesi yer almaktadır. Ağlara üyelik desteği çağrısı kapsamında, Türkiye’de faaliyet gösteren kuruluşların bilim ve teknoloji alanında Avrupa çapındaki etkin olan ağ yapılarına üye olabilmeleri ve üyeliklerini sürdürebilmeleri için giriş ve üyelik aidatlarının ödenmesi için destek sağlanması amaçlanmaktadır. Bu destek 2020 ve 2021 yılları için verilecek giriş veya üyelik aidatlarını kapsamaktadır. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İŞKUR İşbaşı Eğitim Programı Başvuruları
Sayın Üyemiz, İŞKUR Eskişehir İl Müdürlüğünden Borsamıza gönderilen yazıda,İşbaşı Eğitim Programlarına başvurular internet üzerinden alınacağı belirtilmiştir. Konu ile ilgili ayrıntılı bilgiye ekteki dokümanlardan ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Online Export Akademi Programı
Sayın Üyemiz, İlgi : 10.04.2020 tarihli, 53823986 sayılı ve "Online Export Akademi Programı" konuluyazınız Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda,Ticaret Bakanlığı İhracat Genel Müdürlüğü nden alınan İlgi de belirtilen yazıda; Bakanlık ve UPS firması ile,kamu özel sektör işbirliğinde gerçekleştirilen Export Akademi Programı ile kadın ve genç girişimcilerimizinihracatçı olabilmeleri için eğitimler düzenlendiği belirtilerek 16 Nisan 2020 tarihinde bir örneği yazı ekindeyer alan program dahilinde, Zoom Programı üzerinden "Online Export Akademi Programı"gerçekleştirileceği, mezkur eğitim programına https://www.exportakademi.com/kayit-ol/5 linki aracılığıylakayıt olunabileceği ifade edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Et Süt Kurumu 1. Sınıf Dana Karkas Alımı
Sayın Üyemiz; Et ve Süt Kurumundan Borsamıza gelen yazıda, 1. Sınıf Dana Karkas Alımıile ilgili bilgi aktarılmıştır. Ayrıntılı bilgiye ekteki dokümanlardan ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Devlet Destekli Ticari Alacak Sigortası Semineri
Sayın Üyemiz, KOBİ lerin alacaklarını garanti altına alan ve tahsil edememeleri durumunda, alacaklarının önemli bir kısmını devlet destekli havuzdan karşılayan "Devlet Destekli Ticari Alacak Sigortası" sistemi hakkında 16 Nisan 2020 tarihinde saat 14:00 te http://alacaksigortasi.tobb.org.tr adresinde internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere katılım ücretsiz olup, bilgilerinize sunulur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Mısır Satışı
Sayın Üyemiz; TMO Eskişehir Şube Müdürlüğünden Borsamıza gelen yazıda; Mısır Satışı hakkında bilgiler yer almaktadır. Bahse konu satış ile ilgili ayrıntılı bilgiye ekteki dokümallardan ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Dolandırıcılık Vakaları
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda, Ticaret Bakanlığı’na Varşova Ticaret Müşavirliği’nden iletilen yazıya atfen, Polonya’da ithalatçı firmaları dolandırma vakalarında artış gözlendiği, özellikle Polonya merkezli firmaların web-siteleri taklit edilerek veya tamamen sahte ad ve ürün çeşitliliği ile sahte web-sitesi kurarak dolandırıcılık yapılmaya çalışıldığı belirtilmektedir. Yazıda devamla, firmalarımızın özellikle piyasa değerlerinin altında ucuz ürün (genel olarak A4 kağıt) ithalatı konusunda Polonya merkezli firmaların web-siteleri taklit edilerek veya tamamen sahte ad ve ürün çeşitliliği ile sahte web-sitesi kurularak dolandırılmaya çalışıldığı; ihracat yaptığını belirterek ithalatçı firmalarımız ile iletişime geçen şahısların tetkik edilmesi konusunda Varşova Ticaret Müşavirliği’ne gelen başvuru sayısının arttığı ve bu araştırılan firmalar konusunda şüphelerin tamamına yakınının haklı olduğunun tespit edildiği ifade edilmektedir. Bu çerçevede, özellikle Polonya’dan ilk kez ithalat yapacak firmalarımızın Varşova Ticaret Müşavirliği’ne başvurarak iş yapacakları firmaların doğruluğunu teyit etmelerinin ve yeni kurulacak ticari ilişkilerde şüpheli durumların ortaya çıkması halinde ise danışmaları yönünde bilgilendirilmelerinin faydalı olacağı hususunu bilgilerinize sunarız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sokağa Çıkma Yasağı
Kapıkule Gümrük Kapısı nda Covid-19 hızlı tanı laboratuvarı kurulması
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Covid-19 salgını ile ilgili, Kapıkule Gümrük Kapısı nda yaşanan sıkıntılardan bahisle, yaşanan mağduriyetlerin ve yoğunlukların giderilmesi amacıyla, 15 dakika içerisinde Koronavirüs test sonuçlarını veren hızlı kitlerin Kapıkule Sınır Kapısı nda kullanılmasına yönelik TOBB ‘ince yapılan girişimler neticesinde, Sağlık Bakanlığı Halk Sağlığı Genel Müdürlüğü tarafından Kapıkule Gümrük Kapısı nda hızlı tanı PCR testi yapan Mobil Laboratuvarın kurulmasına ve test yapılmasına izin verilmiş olup, ayrıca hızlı tanı Covid-19 Korona testi yapılabilmesine imkan tanınacaktır. Koronavirüs Salgını ve Taşımacılık ile ilgili gelişmeler için; https://tobbtir.tobb.org.tr/Portal/AnaSayfa Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tarımsal Üretimin/Arzın Sürdürülebilirliğinin Sağlanması
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İçişler Bakanlığı, daha önce, 81 İl Valiliği ne muhatap Genelge ile yaşanan COVID-19 salgınının bir an önceengellenmesi, vatandaşlarımızın korunması ve ülkemize olan etkilerinin azaltılması kapsamında; tarımsalüretimin/arzın sürdürülebilirliğinin sağlanması ile birlikte tarım sektöründe çalışanların (mevsimlik işçilerdâhil) pandemiye karşı korunması hususlarını iletmiştir. Bakanlık yeni bir Genelge ile tarımsal üretimin/arzınsürdürülebilirliğinin sağlanması ile birlikte tarım sektöründe çalışanların (mevsimlik işçiler dâhil) pandemiyekarşı korunması hususlarını detaylandırmıştır. Ayrıntılı bilgiye ekteki dokümanlardan ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 5.000 Ton Mahsül Dane Mısır Satışı
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen yazıda 5.000 ton dane mısır ihale duyurusu yapılmaktadır. İlgili ihale ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (07 Nisan 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 7 NİSAN TARİHİ İTİBARI İLESONUÇLANAN TALEPLER Egzoz gazı emisyon ölçüm işlemleri, üç ay süreyle ertelendi KOSGEB’in kredi destek programları kapsamında bankalardan kredi kullanan işletmelerin 30 Haziran’a kadar olan borçları, 3 ay süreyle faizsiz olarak ertelendi
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (06 Nisan 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 6 NİSAN TARİHİ İTİBARI İLE SONUÇLANAN TALEPLER Pandemi hastanesi olarak ilan edilen özel hastanelere, SGK tarafından ödenecek tutarlar yükseltildi SGK ve Muhtasar beyannameleri birleştirmesi,1 Temmuz 2020’ye ertelendi Tarım ve Orman Bakanlığı tarafından 21 ilde “Bitkisel Üretimin Geliştirilmesi” programı kapsamında tohum hibe desteği açıklandı
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (03 Nisan 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 3 NİSAN İTİBARIYLE SONUÇLANAN TALEPLER Taşımacılığın hızlandırılması ve hammadde tedarikinin aksamaması amacıyla Sağlık Bakanlığı tarafından “Kapıkule Gümrük Kapısına” hızlı tanı PCR testi yapan mobil laboratuvar kurulmasına ve hızlı tanı Kovid-19 testi yapılmasına onay verildi, Turizm sektöründe, iş sözleşmeleri askıda olan çalışanlardan Nisan ayında sigortalı girişi yapılan işçiler “kısa çalışma ödeneği” kapsamına alındı Kısa çalışma ödeneği kapsamında olan çalışanın kısa çalışma ücreti ile net maaşı arasındaki farkı ödemek isteyen işverenler, SGK bildirimini “0 gün” yaparak aradaki farkı sorun olmadan ödeyebilecek Kısa çalışma kapsamında bulunan işyerlerinde çalışmasını sürdüren çalışanlar için, asgari ücret desteği ödenmeye devam edecek Muayene süresi gelen tüm araçlar için araç muayene süreleri için 3 ay ertelendi
İl Umumi Hıfzıssıhha Kurulunun Sanayi ve Ticari Süreçlere İlişkin Aldığı Son Kararlar
Sayın Üyemiz, İçişleri Bakanlığımızca alınan kararları değerlendirmek üzere, Borsamızın ve Odalarımızın da katılımıyla 3 Nisan 2020 tarihinde toplanan İl Umumi Hıfzıssıhha Kurulu söz konusu kararları değerlendirmiş, İlimiz koşullarına göre gerekli düzenlemeleri gerçekleştirmiştir. Buna göre üyelerimizi doğrudan ilgilendiren düzenlemeler şu şekildedir; 1. Büyükşehir statüsündeki 30 ilimiz ve Zonguldak’la birlikte kentimize de kara ve hava yolu ile (toplu ulaşım, özel araç, yaya vb.) yapılacak tüm giriş/çıkışlar 3 Nisan 2020 Cuma günü 24:00’den itibaren 15 günlük bir süre için geçici olarak durdurulmuştur. 2. Şehrimizde ikamet edip şehir dışında çalışan ve şehir dışında ikamet edip şehrimizde çalışanlar, çalışmaya devam etmeleri durumundaİkametgah Belgesi ve SGK Kayıt Belgesi’niyanlarında bulundurmak şartıyla seyahat edebileceklerdir. 3. Tüm il ve ilçelerimizle birlikte Eskişehir’de de 01.01.2000 tarihinden sonra doğmuş olanların sokağa çıkmaları 03.04.2020 tarihi saat 24:00’den itibaren geçici olarak yasaklanmıştır. 4. İlimizdeki 01.01.2000 tarihinden sonra doğmuş olanlar için sokağa çıkma yasağı getirilmiştir. Ancak 01.01.2000-01.01.2002 tarihleri arasında doğmuş olmasına karşın; a. Kamu kurum ve kuruluşlarında memur, sözleşmeli personel veya işçi statüsünde olan, b. Özel sektörde düzenli bir işe sahip olan ve sosyal güvenlik kayıt belgesi ile bu durumu belgeleyenler, c. Tarımsal üretimin sürekliliği açısından önemli bir fonksiyona sahip olan ve iller arasındaki planlama, seyahat ve konaklama koşulları 03.04.2020 tarih ve 6202 sayılı İçişleri Bakanlığı genelgesi ile düzenlenen mevsimlik tarım işçilerisokağa çıkma yasağından muaftır. 5. Sokağa çıkma yasağından muaf olanlar istisna kapsamında olduklarını ispatlayacak belgeleri (Sosyal Güvenlik Kayıt Belgesi vb.) yanlarında bulundurmak ve denetimler sırasında bu belgeleri ibraz etmek zorundadır. 6.Tüm ticari faaliyetlerin sürekliliği içingerekli olan ürün ve/veya malzemelerin lojistiği, üretimi ve naklinde yurt içi ve dışı taşımacılık kapsamında görevli olanlar ve araçları; taşıma irsaliyesi, teslimat makbuz veya fatura vb. belgeler ileticari sevkiyatlarını gerçekleştirebilirler. 7. Tüm ticari faaliyetlerin sürekliliği için, işletmelere ait araçlarla kendi ticari ürün/malını almak üzereboş olarak gidecek araçlar ise işletmeler tarafından oluşturulacak görev izin belgesi ile(Matbu izin belgesi örneği eklidir.)kentimize giriş çıkış yapabileceklerdir. Belirtilen amaçlarla kısıtlanan illere giriş/çıkış yapanlar, giriş amacını gösteren belgeler ile 72 saat içerisinde teslim ilinden ayrılarak ilk çıkış iline dönebilecektir. Bu şekilde giriş çıkışı sınırlandırılan illere giren ticari araç sürücüleri seyahatleri süresince, değişim sürelerine uyarak maske takmak, temas gerektiren durumlarda sosyal mesafeye uymak zorundadırlar. 8. Ürün/malzeme götürmeyen ancak sözleşme yapmak, anlaşma sürecini yürütmek, ticari istişarelerde bulunmak, numune incelemek, montaj yapmak, yapılmış bir sözleşmeye ilişkin görevleri ifa etmek vb. amaçlarla, ürün/malzeme olmaksızın seyahat edecek işletme sahipleri ve çalışanları, ilgili valilik bünyesindeki İl Seyahat Kurulundan izin alarak seyahatlerini gerçekleştirebileceklerdir. Belirtilen amaçlarla kısıtlanan illere giriş/çıkış yapanlar, giriş amacını gösteren belgeler ile 72 saat içerisinde teslim ilinden ayrılarak ilk çıkış iline dönebilecektir. Bu şekilde giriş çıkışı sınırlandırılan illere giren araç sürücüleri seyahatleri süresince, değişim sürelerine uyarak maske takmak, temas gerektiren durumlarda sosyal mesafeye uymak zorundadırlar. 9. Doğalgaz, elektrik, akaryakıt vb. sektörlerde enerji arz güvenliğinin ihtiyaç duyduğu malzemenin nakli ve üretiminin gerçekleştirilmesinde görevli olanlar ve araçları; enerji sektöründe görevli olduklarına dair ilgili üyemiz ya da tedarikçisi tarafından düzenlenecek olan sevk irsaliyesi, fatura ya da görev belgesi(Matbu izin belgesi örneği eklidir.)ile ilimize giriş çıkış yapabileceklerdir. 10. Yurt içinde ticari yük/yolcu taşımacılığı yapanlar ile uluslararası yük taşımacılığı yapanların İlimize giriş-çıkışlarının transit şekilde geçişlerine müsaade edilmektedir. Ancak bu şekilde transit geçişlerine izin verilen ticari yük taşıyıcıları, zorunlu dinlenme molaları/süreleri hariç hiçbir şekilde duraklama ya da konaklama yapmayacaklardır. 11. İlimizde çalışan pazar yeri, market ve toplu olarak çalışılan işyerlerine vatandaşlarımız ve çalışanlarımız, ilgili işyerlerine maske ile gireceklerdir. Maske takma zorunluluğu pazarlarda satıcılar için de geçerli olacaktır. 12. Eskişehir Valiliği İl Seyahat Kurulu 09:00-17:00 saatleri arasında Şehirlerarası Otobüs Terminalinde faaliyet göstermektedir. İzin belgesi ekte bilginize sunulmuştur. Bilgilerinize sunarız. ESKİŞEHİR TİCARET BORSASI
Yaş Sınırlaması İstisnaları
Sayın Üyemiz, İçişleri Bakanlığının 04.04.2020 tarihli resmi yazısında,COVID-19 salgını sebebiyle alınan önlemlerden01.01.2000 sonrasında doğanların sokağa çıkmalarını geçici olarak yasaklayan düzenlemedeki kapsam dışında tutulacak maddeleraşağıda belirtilmiştir. Resmi yazıya ekten ulaşılabilecektir. Koronavirüs salgınının toplum sağlığı açısından oluşturduğu riski yönetebilmek, sosyal hareketliliği ve insanlar arası teması azaltarak sosyal izolasyonu tesis etmek amacıyla bugüne kadar ilgili Bakanlıklarımız, Valiliklerimiz ile kamu kurum ve kuruluşları tarafından birçok tedbir alınmıştır. Bu kapsamda Sağlık Bakanlığı ve Bilim Kurulunun önerisi, Sayın Cumhurbaşkanımızın talimatları doğrultusunda 03.04.2020 tarih ve 6235 sayılı Bakanlık Genelgemiz ile bazı yeni tedbir kararları alınmış ve uygulanılmaya başlanılmıştır. Öte yandan 01.01.2000 sonrasında doğanların sokağa çıkmalarını geçici olarak yasaklayan düzenlemenin kapsamı konusunda uygulamada bazı tereddütler yaşandığı görülmektedir. Bu tereddütlerin giderilmesi ve uygulama birliğinin tesis edilmesi amacıyla aşağıda belirtilenlerin kapsam dışı tutulmaları gerektiği değerlendirilmiştir. Buna göre doğum tarihi 01.01.2000-01.01.2002 tarihleri arasında (18-20 yaş aralığında) olmakla beraber; 1- Kamu kurum ve kuruluşlarında memur, sözleşmeli personel veya işçi statüsünde görevli olanlar, 2- Özel sektörde düzenli bir işe sahip olan ve sosyal güvenlik kayıt belgesi ile bu durumu belgeleyenler, 3- Tarımsal üretimin sürekliliği açısından önemli bir fonksiyona sahip olan ve iller arasındaki planlama, seyahat ve konaklama koşulları 03.04.2020 tarih ve 6202 sayılı Genelgemiz ile düzenlenen mevsimlik tarım işçileri, 03.04.2020 tarih ve 6235 sayılı sayılı Bakanlık Genelgesi ile getirilen sokağa çıkış yasağından muaf tutulacaktır. Bu istisnalar 01.01.2002 tarihinden sonra doğanlara (18 yaşından küçüklere) uygulanmayacaktır. Sokağa çıkış yasağından muaf tutulanlar istisna kapsamında olduklarını kanıtlayacak belgeleri yanlarında bulundurmak ve denetimler sırasında bu belgeleri ibraz etmek zorundadırlar. Valiler/Kaymakamlar tarafından bu duruma ilişkin gerekli kararların ivedilikle alınması, uygulamada herhangi bir aksaklığa meydan verilmemesi ve mağduriyetlere neden olunmaması hususunda; Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Covid-19 tedbirleri
Sayın Üyemiz ; T.C. İç İşleri Bakanlığı İller İdaresi Genel Müdürlüğü tarafından Covid-19 tedbirleri kapsamında "Şehir Giriş/Çıkış Tedbirleri ve Yaş Sınırlaması ile ilgili yayınlanan bildiri metnine ekteki belgeden ulaşabilirsiniz. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ayçiçeği tohumunun CIF kıymeti
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;8.3.2020 tarihli Resmi Gazete de yayımlanmış olan İthalatta Gözetim Uygulanmasına İlişkin Tebliğ de (2009/8) Değişiklik Yapılmasına Dair Tebliğ ile "Birim Gümrük Kıymet" ibaresi "CIF Kıymeti" olarak değiştirilmiştir. Buna bağlı olarak 2.4.2020 tarihli Resmi Gazete de yayımlanan Tebliğ değişikliği ile daha önce tonu 850 birim ABD Doları gümrük kıymeti (ABD Doları/Ton) olan 1208. GTİP no lu "Ayçiçeği tohumunun unu ve kaba unları" 850 birim CIF Kıymeti (ABD Doları/Ton); tonu 1.000 birim ABD Doları gümrük kıymeti (ABD Doları/Ton) olan 1512. GTİP no lu "ayçiçek tohumu yağı" 1.000 birim CIF Kıymeti (ABD Doları/Ton); tonu 1.100 birim ABD Doları gümrük kıymeti (ABD Doları/Ton) olan 1512. GTİP no lu "Ayçiçeği tohum yağı" 1.100 birim CIF Kıymeti (ABD Doları/Ton) olarak değiştirilmiştir. Bununla birlikte 1512. GTİP no lu "Ayçiçeği tohum yağı" için 1 Şubat 2020 - 30 haziran 2020 arasında ton başına 800 birim CIF Kıymeti (ABD Doları/Ton) üzerinden uygulama yapılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kamu İhale Kanunu Kapsamında İmzalanan Sözleşmeler
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Covid-19 virüsünün etkilerini azaltmak amacıyla 2.4.2020 tarihli Resmi Gazete de yayımlanan Cumhurbaşkanlığı Genelgesi ile 4734 sayılı Kamu İhale Kanunu kapsamında imzalanan sözleşmelerle bu Kanun tarafından istisna edilmiş olan sözleşmelerin yüklenicileri, sözleşmenin tarafı olan idarelere başvuruda bulunabileceklerdir. Söz konusu başvuruda; Covid-19 salgını nedeniyle yüklenilen işin yerine getirilmesinin geçici veya sürekli olarak, kısmen veya tamamen olanaksız olduğuna dair belgelere yer verilmesi gerekmektedir. Yapılan başvuru üzerine Hazine ve Maliye Bakanlığı nın da değerlendirilmesi alınarak sözleşmenin feshine veya yükleniciye süre uzatımına karar verilebilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
SGK Pirim Ödeme Sürelerinin Ertelenmesi
Sayın Üyemiz; Sosyal Güvenlik Kurumundan Yapılan Prim Ödeme Sürelerinin Ertelenmesi Hakkında Duyuru İlk olarak Çin’in Wuhan kentinde ortaya çıkan yeni tip Korona virüs (COVID-19) çok hızlı bir küresel yayılım göstererek neredeyse tüm Dünya ülkelerini etkilemiş ve Dünya Sağlık Örgütünce salgın olarak tanımlanmıştır. Söz konusu virüsün ülkemizde de görülmesi üzerine Devletimiz tarafından önlemler alınmaya başlanmıştır. Bu kapsamda, 24/03/2020 tarihli, 31078 sayılı mükerrer Resmi Gazetede yayımlanan Vergi Usul Kanunu Genel Tebliği uyarınca Hazine ve Maliye Bakanlığınca 01/04/2020 ila 30/06/2020 (bu tarihler dâhil) tarihleri arasında mücbir sebep halinde olduğu kabul edilen: • Ticari, zirai ve mesleki kazanç yönünden gelir vergisi mükellefiyeti bulunan mükelleflere, • Korona virüs salgınından doğrudan etkilenen ve ana faaliyet alanı itibarıyla;  Alışveriş merkezleri dahil perakende,  Sağlık hizmetleri,  Mobilya imalatı,  Demir çelik ve metal sanayii,  Madencilik ve taş ocakçılığı,  Bina inşaat hizmetleri,  Endüstriyel mutfak imalatı,  Otomotiv imalatı ve ticareti ile otomotiv sanayii için parça ve aksesuar imalatı,  Araç kiralama,  Depolama faaliyetleri dahil lojistik ve ulaşım,  Sinema ve tiyatro gibi sanatsal hizmetler,  Matbaacılık dahil kitap, gazete, dergi ve benzeri basılı ürünlerin yayımcılık faaliyetleri,  Tur operatörleri ve seyahat acenteleri dahil konaklama faaliyetleri,  Lokanta, kıraathane dahil yiyecek ve içecek hizmetleri,  Tekstil ve konfeksiyon imalatı ve ticareti,  Halkla ilişkiler dahil etkinlik ve organizasyon hizmetleri sektörlerinde faaliyette bulunan mükellefler,  Ana faaliyet alanı itibarıyla İçişleri Bakanlığınca alınan tedbirler kapsamında geçici süreliğine faaliyetlerine ara verilmesine karar verilen işyerlerinin bulunduğu sektörlerde faaliyette bulunan mükelleflere ait, iş yerlerinde 5510 sayılı Kanunun 4 üncü maddesinin birinci fıkrasının (a) bendi kapsamında sigortalı çalıştıran özel sektör işverenlerinin, • Köy ve mahalle muhtarları ile isteğe bağlı sigortalılar hariç kendi adına ve hesabına bağımsız çalışanlardan,  Ticarî kazanç veya serbest meslek kazancı nedeniyle gerçek veya basit usûlde gelir vergisi mükellefi olanlar,  Gelir vergisinden muaf olup, esnaf ve sanatkâr siciline kayıtlı olanlar,  Tarımsal faaliyette bulunanlar ile  Tüzel kişilikleri yukarıda belirtilen ve ana faaliyet alanları itibarıyla mücbir sebep halinde olduğu kabul edilen; anonim şirketlerin yönetim kurulu üyesi olan ortakları, sermayesi paylara bölünmüş komandit şirketlerin komandite ortakları, diğer şirket ve donatma iştiraklerinin ise tüm ortaklarından, 5510 sayılı Kanunun 4 üncü maddesi birinci fıkrasının (b) bendi kapsamında (Bağ-Kur) sigortalısı olanların:  2020/Nisan ayı sonuna kadar ödenmesi gereken 2020/Mart ayına ait sigorta primlerinin ödeme süresi, 31/10/2020 tarihinin cumartesi gününe denk gelmesi nedeniyle 02/11/2020 tarihine,  2020/Mayıs ayı sonuna kadar ödenmesi gereken 2020/Nisan ayına ait sigorta primlerinin ödeme süresi, 30/11/2020 tarihine,  2020/Haziran ayı sonuna kadar ödenmesi gereken 2020/Mayıs ayına ait sigorta primlerinin ödeme süresi, 31/12/2020 tarihine ertelenmiştir. • Erteleme nedeniyle 5510 sayılı Kanunun 89 uncu maddesinde belirtilen gecikme cezası ve gecikme zammı uygulanmayacaktır. • Ayrıca, İçişleri Bakanlığınca alınan tedbirler uyarınca 65 yaşını doldurmuş veya kronik rahatsızlığı bulunması nedeniyle sokağa çıkma yasağı kapsamına giren gerçek kişi işverenler ile isteğe bağlı sigortalılar hariç 5510 sayılı Kanunun 4 üncü maddesinin birinci fıkrasının (b) bendi kapsamındaki sigortalılardan;  22/03/2020 tarihi ile mücbir sebep döneminin sonuna kadar 65 yaşını doldurmuş olanların,  Kronik rahatsızlığını sağlık kuruluşlarından alınacak muteber belgelerle ispat ve tevsik edenlerin, mücbir sebep dönemi boyunca tahakkuk edecek sigorta primleri, sokağa çıkma yasağının sona ereceği günü takip eden 15 üncü günün sonuna kadar ertelenmiştir. • 5510 sayılı Kanuna göre Kuruma verilmesi gereken her türlü bilgi, belge ve beyanname ile yapılması gereken başvuruların sürelerinde ertelemeye gidilmemiş olup cari usul ve sürelere göre işlem yapılacaktır. Kamuoyuna saygıyla duyurulur.
TMO Hububat, Bakliyat, Pirinç ve Çeltik Satışı
Sayın Üyemiz; TMO Eskişehir Şube Müdürlüğünden Borsamıza gelen yazıda; Hububat, Bakliyat, Pirinç ve Çeltik Satışı hakkında bilgiler yer almaktadır. Bahse konu satışlar ile ilgili ayrıntılı bilgiye ekteki dokümallardan ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (02 Nisan 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 2 NİSAN TARİHİ İTİBARIYLE SONUÇLANAN TALEPLER Mersin limanı’nda ardiye ücretleri düşürüldü. Kamu kurumları tarafından gerçekleştirilen ihaleler için, koronavirüs (Covid-19) salgını nedeniyle sözleşme şartlarının yerine getirilememesi halinde, “süre uzatımı verilmesi” veya “sözleşmenin feshedilmesi” mümkün hale geldi.
COVID-19 Salgını Hakkında İİT Genel Sekreterliği ve İslam Kalkınma Bankası Tarafından Yapılan Basın Açıklamaları
Sayın Üyemiz; İlgi : Ticaret Bakanlığı nın 30.03.2020 tarihli ve 82699423-730.99 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; ilgide kayıtlı yazıda, İslam İşbirliği Teşkilatı (İİT) Genel Sekreterliği ve İslam Kalkınma Bankası (İKB) tarafından koronavirüs (COVID-19) salgınıyla mücadeleye ilişkin olarak yapılan basın açıklamalarına yer verilmektedir. İİT Genel Sekreterliğinin açıklamasında, Teşkilat ın COVID-19 salgınıyla mücadelede üye ülkelerle dayanışma içinde olduğu, virüs nedeniyle ortaya çıkabilecek sağlık sorunlarını ve olumsuz sosyo-ekonomik sonuçları durdurmak için tüm imkanlarını kullanmaya hazır olduğu ve üye ülkelerin çabalarından övgüyle bahsettiği kaydedilmektedir. Salgınla mücadeleye destek olmak amacıyla üye ülkelere ayırdığı mali kaynaktan ötürü İKB ye takdirlerini de ifade ettiği aktarılmaktadır. İKB nin açıklamasında, Bankanın, virüsün olumsuz etkilerini azaltmak amacıyla üye ülkelere 730 milyon ABD Dolarlık "Stratejik Hazırlık ve Mukabele Desteği" sunmak üzere çalışmalara başladığı bildirilmektedir. Bunun 280 milyon ABD Dolarının İslami Dayanışma Kalkınma Fonu (ISFD) ve İKB tarafından ulusal proje ve programlar için, 300 milyon ABD Dolarının Ticaretin Finansmanı Uluslararası İslam Şirketi (ITFC) tarafından ticaret finansmanı için, 150 milyon ABD Dolarının ise İslam Yatırım Sigortası ve İhracat Kredisi Şirketi (ICIEC) tarafından sigortalama işlemleri için kullandırılacağı belirtilmektedir. Desteğin hem özel hem de kamu sektörlerine yönelik olacağı kaydedilmektedir. Ayrıca Bilim, Teknoloji ve İnovasyon Programından da salgının önlenmesine yönelik yapılacak araştırmalara teknik yardım desteği sağlanacağı, ters bağlantı programı çerçevesinde en iyi uygulamaların ve teknik uzmanlığın paylaşılacağı ifade edilmektedir. Yazıda devamla, İKB nin, salgından etkilenen ülkelere sağlayacağı desteklerde, etkin işbirliği ve kaynak kullanımını teminen uluslararası kalkınma bankaları ve finansman kuruluşlarıyla birlikte çalışacağı belirtilmektedir. Asya Altyapı Yatırım Bankası, OPEC Uluslararası Kalkınma Fonu, Suudi Fonu ve Kuveyt Kalkınma Fonu dahil çok sayıda kuruluşun İKB nin çabalarına destek vermeye ilgi duyduğu aktarılmaktadır.Öte yandan, İKB nin ve alt kuruluşlarının kaynaklarına firmaların doğrudan erişimi mümkün değildir. Bu kaynaklar her bir üye ülkedeki ilgili kuruluşlara aktarılmakta ve bu kuruluşlar aracılığıyla özel sektörün istifadesine sunulmaktadır. Ülkemizde bu fonlar Eximbank tarafından kullanılmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yurt İçinde Canlı Hayvan ve Hayvansal Ürünlerin Nakilleri Hakkında Yönetmelikte Değişiklik Yapılmasına Dair Yönetmelik Taslağı
Sayın Üyemiz; İlgi : Tarım ve Orman Bakanlığı ndan alınan 31.03.2020 tarih ve 1039439 sayılı yazı Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Tarım ve Orman Bakanlığı ndan alınan "ilgi" yazıda; 5996 Sayılı Veteriner Hizmetleri, Bitki Sağlığı, Gıda ve Yem Kanunu gereği hazırlanan "Yurt İçinde Canlı Hayvan ve Hayvansal Ürünlerin Nakilleri Hakkında Yönetmelikte Değişiklik Yapılmasına Dair Yönetmelik Taslağı" hakkında görüş talebinde bulunulmaktadır. Ekte bilgilerinize sunulan bilgiler doğrultusunda 07.04.2020 tarihine kadar görüşlerinizi rica ederiz. iletim adresi:eskisehirtb@tobb.org.tr Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Göçer Hayvanların Tanımlanması ve Nakilleri Hakkında Yönetmelik Taslağı
Sayın Üyemiz; İlgi : Tarım ve Orman Bakanlığı ndan alınan 31.03.2020 tarih ve 1036751 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Tarım ve Orman Bakanlığı ndan alınan "ilgi" yazıda; 5996 Sayılı Veteriner Hizmetleri, Bitki Sağlığı, Gıda ve Yem Kanunu gereği hazırlanan "Göçer Hayvanların Tanımlanması ve Nakilleri Hakkında Yönetmelik Taslağı" hakkında görüş talebinde bulunulmaktadır. Ekte bilgilerinize sunulan bilgiler doğrultusunda 07.04.2020 tarihine kadar görüşlerinizi rica ederiz. iletim adresi: eskisehirtb@tobb.org.tr Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Ödeneği
Sayın Üyemiz; T.C. Aile, Çalışma ve Sosyal Hizmetler Bakanlığı tarafından hazırlanan "Kısa Çalışma Ödeneği" ile ilgili bilgilendirici video linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sermaye Şirketlerinin Kar Payı Dağıtımı
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Ticaret Bakanlığı nın TOBB a ilettiği 31.03.2020 tarihli yazıda, covid-19 virüsü nedeniyle sermaye şirketlerinin özkaynaklarını korumasının önemine işaret edilmekte ve 28.11.2012 tarihli ve 28481 sayılı Resmi Gazete de yayımlanan "Anonim Şirketlerin Genel Kurul Toplantılarının Usul ve Esasları ile Bu Toplantılarda Bulunacak Ticaret Bakanlığı Temsilcileri Hakkında Yönetmeliği nin" 13/5 inci maddesine dayanılarak, aşağıdaki duyurunun tüm şirketlere yapılması istenmektedir: "kamunun iştiraki olan şirketler hariç olmak üzere, sermaye şirketlerinin 2019 yılı hesap dönemine ilişkin olarak bu yıl gerçekleştirilecek genel kurul toplantılarında gündeme alınacak nakit kâr payı dağıtımı kararlarında, geçmiş yıl kârlarının dağıtıma konu edilmemesi ve dağıtım tutarının 2019 yılı net dönem karının %25 ini aşmaması ile yönetim kuruluna kâr payı avansı dağıtımı yetkisi verilmemesi..." Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Çeşitli Ürün Satışı
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; TMO tarafından yapılacak olan çeşitli ürün satışlarına ait bilgilere, ekteki belgelerden ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Uluslararası Katılımlı Organizasyonlar
Sayın Üyemiz; İlgi : Ticaret Bakanlığı ndan alınan 25.03.2020 tarihli ve 00053488165 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İlgide kayıtlı yazıda, Sağlık Bakanlığının 10.03.2020 tarihli ve 114526181 sayılı yazısına istinaden, yeni tipkorona virüs salgını kapsamında Bilim Kurulunun 09.03.2020 tarihli toplantısında uluslararası katılımlıorganizasyonlar ve bu toplantılara katılımların salgının sonlanmasına kadar ertelenmesinin tavsiye edildiğibelirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Milli Yardım Seferberliği
Sayın Üyemiz; Cumhurbaşkanımız Sayın Recep Tayyip Erdoğan ın öncülüğünde ihtiyaç sahiplerine destek olmak amacıyla başlatılan #Biz Bize Yeteriz Türkiyem# Milli Yardım Seferberliğine katkıda bulunabileceğiniz Banka Hesap Bilgileri ile Kısa Mesaj Bilgisine ekten ulaşabilirsiniz. Bilgilerinize sunarız. ESKİŞEHİR TİCARET BORSASI
Tarımsal Üretimin Sürdürülebilirliği
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İçişler Bakanlığı, 81 İl Valiliği ne muhatap Genelge ile yaşanan COVID-19 salgınının bir an önce engellenmesi, vatandaşlarımızın korunması ve ülkemize olan etkilerinin azaltılması kapsamında; tarımsal üretimin/arzın sürdürülebilirliği sağlanması ile birlikte tarım sektöründe çalışanların (mevsimlik işçiler dâhil) pandemiye karşı korunması hususları iletilmiştir. Söz konusu Genelge ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOSGEB Koronavirüs (COVİD-19) Kapsamında Alınan Tedbirler
Sayın Üyemiz; KOSGEB Eskişehir Müdürlüğünden Borsamıza gelen yazıda; Dünya Sağlık Örgütü tarafından pandemi olarak açıklanan Koronavirüs (Covid-19) salgınının etkilerini azaltmak için ülkemizde alınan tedbirler kapsamında; 1. KOSGEB’in proje bazlı destek programlarından ve girişimcilik desteklerinden yararlanan ve proje süreleri ya da girişimcilik programı destek süreleri 11 Mart 2020 ve sonrası tarihte sona eren işletmelerin, 4 (dört) aya kadar ek süre talep etmesi halinde yeni bir kurul kararı gerekmeksizin projelerin bitiş tarihine ya da destek sürelerinin bitiş tarihine işletmelerin talep ettiği sürenin ek süre olarak verilmesine, 2. Koronavirüs (Covid-19) salgını etkilerinin ortadan kalktığına ilişkin ilgili merci tarafından yapılacak kamuoyu duyurusuna kadar ek süre talebi uygulamasının devamına yönelik iş ve işlemlerin yürütülmesine karar verilmiştir. Bu bağlamda, etki alanınızda bulunan, proje bazlı destek programlarımızdan ve girişimcilik desteklerimizden yararlanan işletmelerimize talep etmeleri halinde 4 (dört) aya kadar ek süre uygulanacağı bildirilmiştir. Üyelerimize duyurulur, Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOSGEB Alacakların Ertelenmesi
Sayın Üyemiz; KOSGEB Eskişehir Müdürlüğünden Borsamıza gelen yazıda; Dünya Sağlık Örgütü tarafından pandemi olarak açıklanan Koronavirüs (Covid-19) salgınının etkilerini azaltmak için ülkemizde alınan tedbirler kapsamında KOSGEB tarafından “KOSGEB Alacaklarının Ertelenmesi” kararı alınmış olup, “KOSGEB Alacaklarının Ertelenmesi” kararına istinaden, 30/06/2020 tarihine kadar ödenmesi gereken ve muaccel hale gelmeyen geri ödemeli destek ödemeleri bulunan ve erteleme talebini 30/06/2020 tarihine kadar yazılı olarak bildiren KOBİ’ler için; · 30/06/2020 tarihine kadar vadesi dolacak olan ve muaccel hale gelmeyen geri ödemeli destekler kapsamındaki borçları ve varsa takip eden taksitlerinin vade tarihleri her birine üç ay eklenmek suretiyle ertelenecek, ertelenen taksitlerin ilki 01/07/2020 tarihinden önce olmamak üzere düzenlenecek ve vade sayısı değişmemek üzere herhangi bir yasal faiz alınmaksızın 3 (üç) ayda bir olacak şekilde ödeme takvimi yeniden belirlenecektir. · Teminat/Kefalet Mektubunun süresinin, yeniden belirlenecek vadelere göre ilgili destek programı uygulama esaslarında belirtilen sürelere uygun olmasına dikkat edilmelidir. · Bu karardan daha önce KOSGEB Alacaklarının Ertelenmesi kararlarından faydalanan KOBİ’ler de faydalanabilecektir. · Geri ödemeli desteklere ilişkin ilk taksiti 01/07/2020 tarihi ve sonrasında olan geri ödemeler bu karar kapsamı dışındadır. Üyelerimize duyurulur, Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ekmek Satışında Hijyen Kuralları
Sayın Üyemiz; TOBB’dan alınan 26.03.2020 tarih ve 34221550-774.02-3280 sayılı yazı ekinde gelen T.C. Tarım ve Orman Bakanlığı Gıda ve Kontrol Genel Müdürlüğü’nün 25.03.2020 tarih ve 40317327.045.01-E.1008194 sayılı yazısında; ekmek ve ekmek çeşitleri satışında alınan ihtiyati tedbirler kapsamında uyulması gereken kurallara dair İl Müdürlüklerinin talimatlandırıldığı, ayrıca ekmek hijyeni eğitimleri konusunda, yeni tip koranavirüs (Covid 19) salgınının devam ettiği süre içerisinde toplantılar yapılarak eğitimler düzenlenmesi yerine, kurumlarının internet sitesinde ekmeğin üretim, dağıtım ve satış aşamalarında uygulanması gereken tedbirlere dair üreticilere yönelik eğitim materyalleri yayımlanacağı bildirilmektedir. Bu çerçevede, “Ekmek Satışında Hijyen Kuralları” ile ilgili Bakanlığın ihtiyati tedbirleri içeren ekli yazısında belirtilen konulara dikkat edilmesi hususu sektör mensubu üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (30 Mart 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 30 MART TARİHİ İTİBARIYLE SONUÇLANAN TALEPLER Mevsimlik tarım işçilerinin salgın hastalığa karşı barınma ve çalışma koşullarının sürekli olarak kontrol edilmesi, tarım arazilerine ulaşım koşullarının iyileştirilmesi ve tarım ürünlerinin pazara ulaşımını kolaylaştıracak tedbirlerin alınmasına yönelik düzenleme yapıldı Tarım Kredi Kooperatifleri’ne Nisan ve Mayıs’ta ödenmesi gereken krediler, faizsiz olarak 2 ay süreyle ertelendi Banka şubelerinin kredi uygulamalarından kaynaklı sorunların iletilmesi için BDDK nezdinde şikayet hattı oluşturuldu Kredi Garanti Fonu’nun kefalet kapasitesi 500 milyar TL’ye çıkarıldı, ayrıca 31.12.2020 tarihine kadar kullandırılacak kredilerde, “vergi borcu yoktur” ve “SGK prim borcu yoktur” belgeleri aranmayacak 11 Mart 2020 tarihi itibariyle, ticari taşımacılık yapan firmaların yetki belgelerinde kayıtlı olan ve muayene süreleri geçen araçların (tır, kamyon, kamyonet vb.) yetki belgelerinden düşüm işlemleri ertelendi Gelir İdaresi Başkanlığı interaktif vergi dairesi internet adresinde, “mücbir sebep durum sorgu ekranı” açıldı, işletmeler internet üzerinden “mücbir sebep” hükümlerinden faydalanıp faydalanamayacaklarını sorgulayabilecek
Anonim ve Limited Şirketlerin Genel Kurul Toplantı Çağrısının İptali
Sayın Üyemiz; İlgi : a) 16.03.2020 tarihli ve 2848 sayılı yazımız. b) 20.03.2020 tarihli ve 53382221 sayılı yazı Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; tüm dünya için halk sağlığı tehdidi oluşturan COVID-19 (Koronavirüs) salgını nedeniyle, hastalığın Ülkemizde yayılmasının önlenmesine dair alınacak tedbirlere yönelik tavsiyeler çerçevesinde, usulüne uygun olarak toplantıya çağrılmış anonim ve limited şirketlerin genel kurullarının ileri bir tarihte yapılmak üzere şirketlerin yönetim organlarının alacağı bir karar ile iptal edilebilmesi ve buna ilişkin ilanın Türkiye Ticaret Sicili Gazetesi nde yayımlanabilmesi hususları ilgi (a) yazımızla Ticaret Bakanlığı İç Ticaret Genel Müdürlüğü ne iletilmek suretiyle görüşleri talep edilmiştir. Konuya ilişkin uygun görüşü ve alınacak tedbirleri ihtiva eden Ticaret Bakanlığı İç Ticaret Genel Müdürlüğü nün ilgi (b) yazısı ekte iletilmektedir. Ayrıca, "Genel Kurul Toplantı Çağrısının İptali Duyurusu" ilan örneğine Türkiye Ticaret Sicili Gazetesi internet sitesinden (www.ticaretsicil.gov.tr) erişilebilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
AB ye Kuru İncir/Fındık/Antep Fıstığı İhracatı
Sayın Üyemiz; İlgi : Ticaret Bakanlığı ndan alınan 18.03.2020 tarihli ve E-00053340815 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İlgi de kayıtlı yazıda, Tarım ve Orman Bakanlığı tarafından Ticaret Bakanlığı na gönderilen bir yazıda, 884/2014 (EC) Sayılı Komisyon Uygulama Yönetmeliği nin 14 Aralık 2019 tarihinde yürürlükten kaldırıldığı açıklanmış olup, söz konusu Tüzük te yer alan kurallara göre 14 Şubat 2020 tarihinden itibaren Ek-1 de güncellenmiş Gümrük Tarife İstatistik Pozisyonu (GTİP) numarası belirtilen ülkemiz menşeli ürünlerin (kuru incir, fındık ve Antep Fıstığı ve bunlardan elde edilen ürünler) Avrupa Birliği (AB) ülkelerine ihracatında, "Sağlık Sertifikası" yerine "Model Sertifika" düzenlenmesine başlanmış olduğu kaydedilerek, Ticaret Bakanlığı BİLGE sisteminde "Sağlık Sertifikası" yerine Ek-2 de yer alan "Model Sertifika" ile Ek-3 te yer alan "Numune Alma ve Analiz Sonuç Raporu" varlığının kontrol edilecek şekilde yeniden düzenlenmesinin talep edildiği belirtilmiştir. Yazıda devamla, yukarıda belirtilen hususlar doğrultusunda Ek-1 deki listede yer alan eşyanın AB üyesi ülkelere ihracatında, gümrük idarelerince Ek-3 te yer alan "Numune Alma ve Analiz Sonuç Raporu" ile birlikte "Sağlık Sertifikası" yerine Ek-2 de bir örneği gönderilen "Model Sertifika"nın aranmasını sağlayacak şekilde sistemsel bir düzenleme yapıldığı vurgulanmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Otopark Yönetmeliği
Sayın Üyemiz; Üyelerimizden gelen talepler doğrultusundaTürkiye Odalar ve Borsalar Birliğiningirişimleri ile Çevre ve Şehircilik Bakanlığı, Otopark Yönetmeliğinin Geçici 4 üncü maddesinde belirtilen yürürlük tarihini 30.06.2020 tarihine kadar uzatmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kredi Garanti Fonu Kredisiyle İlgili Yürürlüğü Giren Hususlar
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda, TOBB Başkanımız M.Rifat Hisarcıklıoğlu na iletilen KGF kredisiyle ilgili iki önemli husus bu gün CUMHURBAŞKANLIĞI kararnamesiyle yürürlüğe girmiştir. 1- 31.12.2020 ye kadar kullandırılacak olan hazine destekli kredilerde VERGİ ve SİGORTA BORCU yoktur belgesi aranmayacak. 2- 31.12.2020 ye kadar Kobilerin limitleri 50 milyon TL, Kobi dışı 350 milyon TL olarak uygulanacaktır. İhtiyaç halinde yararlanmanız için bilginize sunarız. ESKİŞEHİR TİCARET BORSASI
Sanal Ticaret Akademisi
Sayın Üyemiz; İlgi : 10.03.2020 tarihli ve 53060532 sayılı Ticaret Bakanlığı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İlgi de kayıtlı Ticaret Bakanlığı yazısında, 5 Mart 2020 tarihinde kamuoyuna duyurusu yapılarak erişime açılan Sanal Ticaret Akademisi hakkında bilgi verilmektedir. Sanal Ticaret Akademisi, ilgili Bakanlık tarafından Türk ticaret ve ihracat ekosistemini güçlendirme amacıyla geliştirilen, girişimcilere, esnaflara, sanatkârlara, öğrencilere, çalışanlara ve kariyerine katkı sağlamak isteyen tüm vatandaşlara yönelik bir uzaktan eğitim platformudur. Platform, 7/24 erişim olanağı sağlamakla birlikte ücretsiz ve herkese açık olup; "Dış Ticaret", "İç Ticaret","Girişimcilik" olmak üzere 3 adet sertifikalı eğitim programını hizmete sunmaktadır. Ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Vadeli Arpa Satışı Hakkında Kamuoyu Açıklaması
Sayın Üyemiz; TMO tarafından vadeli arpa satışı hakkında yaptığı kamuoyu açıklamasılinktebilginize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Pirinç Piyasasına Yönelik Kamuyu Açıklaması
Sayın Üyemiz; TMO tarafından pirinç piyasası istikrarı adına yapılan kamuoyu açıklaması linkte bilginize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazete İlanı
Sayın Üyemiz; Resmi Gazetede yayınlanan kredi garanti kurumlarına sağlanan hazine desteğine ilişkin kararda değişiklik yapılmıştır. Ayrıntılı bilgiye linten ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (28 Mart 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. SONUÇLANAN TALEPLER (28 Mart 2020 itibariyle) 1. Perakende, AVM, Demir Çelik, Otomotiv, Lojistik- Ulaşım, Sinema, Tiyatro, Konaklama, Yiyecek-İçecek, Tekstil Konfeksiyon ve Etkinlik - Organizayon sektörleri için Nisan, Mayıs ve Haziran’daki Muhtasar, KDV, SGK ödemeleri 6’şar ay ertelenecek 2. KGF desteği 25 milyar liradan 50 milyar liraya çıkartılacak, böylece 350 milyar TL’nin üzerinde ilave kefalet limiti sağlanacak. Kullandırımlarda likidite ve teminat açığı bulunan firmalar ile KOBİ lere öncelik verilecek. 3. İhracatçıya stok finansmanı desteği verilecek. 4. Reeskont kredisi geri ödemelerine 90 güne kadar vade uzatımı sağlanacak, yeni kullanımlara 12 ay ek taahhüt kapama süresi verilecek, kredi kullanım süreleri 240 güne ve uzun vadeliler için 720 güne çıkarılacak. 5. Esnek ve uzaktan çalışma modelleri daha etkin hale getirilecek. 6. Havayolu yolcu taşımacılığında KDV oranı 30.06.2020 tarihine kadar % 1’e indirilecek 7. KOSGEB’in 30 Haziran’a tahakkuk edecek alacakları 2021 yılına ertelenecek. 8. İcra ve iflas takipleri 30 Nisan a kadar durdurulacak. 9. Kamu bankaları ve bazı özel bankalar tarafından vadesi gelen çek, maaş, kredi, dönem sonu faizi gibi ödemeler için ilave kredi limiti tahsis edilecek. 10. Faaliyetleri zorunlu olarak durdurulan iş yerleri için kamu idarelerince kira bedeli tahakkuk ettirilmeyecek. 11. Teknoparklardaki kuluçka firmalarından ve ticari işletmelerden 2 ay süreyle kira alınmayacak. 12. Geri kazanım payı (GEKAP) beyannameleri altı ayda bir verilecek. 13. Kapıkule Sınır Kapısı’nda (öncesinde Habur’da başlatılmıştı) tampon bölgede şoför, dorse veya konteyner değişimi başlatıldı. Uygulama İpsala ve Hamzabeyli kapılarına da yaygınlaştırılacak. 14. Mart ayı KDV ve BA/BS beyannameleri ve ödemeleri 1 ay ertelendi. 15. Mart, Nisan, Mayıs aylarına ilişkin 6 aylık vergi ertelemeleri tüm şahıs işletmelerini ve bazı ilave sektörleri (Mobilya, Madencilik, İnşaat, Endüstriyel Mutfak, Araç Kiralama, Matbaacılık, Sağlık Hizmetleri) de kapsayacak şekilde genişletildi. 16. Otopark Yönetmeliği’nin yürürlük tarihi 30 Haziran’a ertelendi. 17. Kamu bankaları öncülüğünde “İş’e Devam Kredi Desteği” açıklandı. 6 ay anapara ve faiz ödemesiz, toplam 36 ay vadeli ve yıllık %7,5 faiz oranlı kredi başvuruları 26 Mart 2020 tarihi itibariyle başlayacak 18. Kısa Çalışma Ödeneği’nden yararlanma şartları iyileştirildi. 600 gün sigorta primi şartı 450 güne, son 120 günlük prim ödeme şartı 60 güne indirildi. Kapatılan işletmeler için başvuru belgeleri 10’dan 2’ye düşürüldü. 19. 1 Mart 2020 ile 30 Haziran 2020’ye kadar işyeri kira bedelinin ödenememesi, kira sözleşmesinin feshi ve tahliye sebebi oluşturmayacak. 20. Turizm sektöründe 1 Nisan 2020 tarihi ile 30 Haziran 2020 tarihi arasında kamuya ödenecek tüm kira, hasılat, ecrimisil ödemeleri 6 ay ertelendi. 21. Konaklama Vergisi, 1 Ocak 2021 tarihine ertelendi. 22. 24 Mart 2020 öncesine ait ödenmeyen kredi/çek/senet/kredi kartı borçları, 31 Aralık 2020 tarihine kadar ödenir veya yeniden yapılandırılırsa, sicile işlenmeyecek. 23. Telafi çalışma süresi 2 aydan 4 aya çıkartıldı. 24. Kısa Çalışma Ödeneği başvurusu için istenen belge sayısı 10’dan 2’ye düşürüldü. 25. Mikro ve küçük ölçekli işletmeler için geçerli olan “Ticari Alacak Sigortası” kapsamında orta ölçekli (cirosu 125 Milyon TL’ye kadar olan) işletmeler de dahil edildi. 26. Tarım ve Orman Bakanlığı, 27 Mart itibariyle yaklaşık 1.9 Milyar TL’lik destekleme ödemesi yapacak. 27. Tarım ve Orman Bakanlığı öncülüğünde geleneksel hayvansal üretim yapan işletmeler için 100 bin TL’ye kadar, bitkisel üretim yapan işletmeler için 50 bin TL’ye kadar faizsiz kredi verilecek. 28. Haziran ayında Oda ve Borsalara ödenmesi gereken yıllık üyelik ve munzam aidatları, “gecikme zammı” ve “faiz” tahakkuk ettirilmeksizin Ekim 2020 tarihine ertelendi. 29. İşletmelerin çeklerini ödeyebilmeleri için, tüm sektörlerde Kredi Garanti Fonu destekli 3 ay anapara ve faiz ödemesiz “Çek Ödeme Destek Kredisi” 30 Mart 2020’de uygulamaya alınacak. 30. Kamu bankaları tarafından açıklanan “İşe Devam Kredi Desteği” yanında özel bankaların da katılabileceği %9,5 faizli, 3 ay ödemesiz 12 ay vadeli “Ekonomik İstikrar Kalkanı Kredi Desteği” paketi Türkiye Bankalar Birliği tarafından açıklandı. Bu kredi paketine başvurular 30 Mart 2020’de kabul edilmeye başlanacak. 31. Mevsimlik tarım işçilerinin salgın hastalığa karşı barınma ve çalışma koşullarının sürekli olarak kontrol edilmesi, tarım arazilerine ulaşım koşullarının iyileştirilmesi ve tarım ürünlerinin pazara ulaşımını kolaylaştıracak tedbirlerin alınmasına yönelik düzenleme yapıldı 32. Limanlardaki ardiye ücretleri indirildi 33. Tarım Kredi Kooperatifleri’ne Nisan ve Mayıs’ta ödenmesi gereken krediler, faizsiz olarak 2 ay süreyle ertelendi 34. Banka şubelerinin kredi uygulamalarından kaynaklı sorunların iletilmesi için BDDK nezdinde şikayet hattı oluşturuldu
Resmi Gazete İlanı
Sayın Üyemiz; T.C. Ziraat Bankası A.Ş. ve Tarım Kredi Kooperatiflerince tarımsal üretime dair düşük faizli yatırım ve işletme kredisi kullandırılmasına ilişkin uygulama esasları tebliği ve ayrıntıları linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazete İlanı
Sayın Üyemiz; Bitkisel üretime destekleme ödemesi yapılmasına dair tebliğ linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazete İlanı
Sayın Üyemiz; Covid-19 salgını nedeniyle zarar gören esnaf ve sanatkârların, Türkiye Halk Bankası Ananim Şirketince düşük faizli kredi kullandırılması ve kredi borçlarının ertelenmesine dair linkte kararın ayrıntıları bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (27 Mart 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 27 MART TARİHİ İTİBARİYLE SONUÇLANAN TALEPLER Haziran ayında Oda ve Borsalara ödenmesi gereken yıllık üyelik ve munzam aidatları, “gecikme zammı” ve “faiz” tahakkuk ettirilmeksizin Ekim 2020 tarihine ertelendi. İşletmelerin çeklerini ödeyebilmeleri için, tüm sektörlerde Kredi Garanti Fonu destekli 3 ay anapara ve faiz ödemesiz “Çek Ödeme Destek Kredisi” 30 Mart 2020’de uygulamaya alınacak. Kamu bankaları tarafından açıklanan “İşe Devam Kredi Desteği” yanında özel bankaların da katılabileceği %9,5 faizli, 3 ay ödemesiz 12 ay vadeli “Ekonomik İstikrar Kalkanı Kredi Desteği” paketi Türkiye Bankalar Birliği tarafından açıklandı. Bu kredi paketine başvurular 30 Mart 2020’de kabul edilmeye başlanacak.
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (26 Mart 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 26 MART TARİHİ İTİBARİYLE SONUÇLANAN TALEPLER 1. Kısa Çalışma Ödeneği başvurusu için istenen belge sayısı 10’dan 2’ye düşürüldü 2. Mikro ve küçük ölçekli işletmeler için geçerli olan “Ticari Alacak Sigortası” kapsamında orta ölçekli (cirosu 125 Milyon TL’ye kadar olan) işletmeler de dahil edildi 3. Çiftçilerimiz için Tarım ve Orman Bakanlığı, 27 Mart itibariyle yaklaşık 1.9 Milyar TL’lik destekleme ödemesi yapacak 4. Tarım ve Orman Bakanlığı öncülüğünde geleneksel hayvansal üretim yapan işletmeler için 100 bin , bitkisel üretim yapan işletmeler için 50 bin TL’ye kadar faizsiz kredi verilecek 5. Üyelerimizin borsalara Haziran ayında ödemesi gereken yıllık aidatların birinci taksiti ile ödeme sürelerinin herhangi bir gecikme zammı/faizi tahakkuk ettirilmeksizin uzatılarak, ikinci taksitle beraber Ekim ayında ödenmesi sağlandı.
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (25 Mart 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 25 MART TARİHİ İTİBARİYLE SONUÇLANAN TALEPLER 1. Kamu bankaları öncülüğünde “İş’e Devam Kredi Desteği” açıklandı. 6 ay anapara ve faiz ödemesiz, toplam 36 ay vadeli ve yıllık %7,5 faiz oranlı kredi başvuruları 26 Mart 2020 tarihi itibariyle başlayacak 2. Kısa Çalışma Ödeneği’nden yararlanma şartları iyileştirildi. 600 gün sigorta primi şartı 450 güne, son 120 günlük prim ödeme şartı 60 güne indirildi* 3. 1 Mart 2020 ile 30 Haziran 2020’ye kadar işyeri kira bedelinin ödenememesi, kira sözleşmesinin feshi ve tahliye sebebi oluşturmayacak* 4. Turizm sektöründe 1 Nisan 2020 tarihi ile 30 Haziran 2020 tarihi arasında kamuya ödenecek tüm kira, hasılat, ecrimisil ödemeleri 6 ay ertelendi* 5. Konaklama Vergisi, 1 Ocak 2021 tarihine ertelendi* 6. 24 Mart 2020 öncesine ait ödenmeyen kredi/çek/senet/kredi kartı borçları, 31 Aralık 2020 tarihine kadar ödenir veya yeniden yapılandırılırsa, sicile işlenmeyecek* 7. Telafi çalışma süresi 2 aydan 4 aya çıkartıldı*
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (24 Mart 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 24 MART TARİHİ İTİBARİYLE SONUÇLANAN TALEPLER 1.Mart ayı KDV ve BA/BS beyannameleri ve ödemeleri 1 ay ertelendi. 2.Mart, Nisan, Mayıs aylarına ilişkin 6 aylık Muhtasar ve KDV ertelemeleri, tüm şahıs işletmelerini ve bazı ilave sektörleri (Mobilya, Madencilik, İnşaat, Endüstriyel Mutfak, Araç Kiralama, Matbaacılık, Sağlık Hizmetleri) de kapsayacak şekilde genişletildi. 3.Otopark Yönetmeliği’nin yürürlük tarihi 30 Haziran’a ertelendi.
İş e Devam Desteği
Sayın Üyemiz; Ekonomik İstikrar Kalkanı tedbirleri doğrultusunda kamu bankaları ve katılım finans kuruluşları ile başta KOBİ ler olmak üzere firmaların işletme sermayesi ihtiyaçlarını karşılamak için Hazine destekli KGF kefaleti sağlanan “İş e Devam Desteği" TOBB Başkanımız Sn. M.Rifat HİSARCIKLIOĞLU nun talepleri doğrultusunda uygulamaya alındı. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Dünyası Koronavirüs İçin Ekonomik Tedbirler (23 Mart 2020 İtibariyle)
Sayın Üyemiz; Sizlerden gelen talepler doğrultusunda Türkiye Odalar ve Borsalar Birliğine ilettiğimiz ve olumlu sonuçlanan talepler aşağıdaki gibidir. 23 MART TARİHİ İTİBARİYLE SONUÇLANAN TALEPLER 1.Perakende, AVM, Demir Çelik, Otomotiv, Lojistik‐ Ulaşım, Sinema, Tiyatro, Konaklama, Yiyecek‐İçecek, Tekstil Konfeksiyon ve Etkinlik ‐ Organizayon sektörleri için Nisan, Mayıs ve Haziran’daki Muhtasar, KDV, SGK ödemeleri 6’şar ay ertelenecek 2.KGF desteği 25 milyar liradan 50 milyar liraya çıkartılacak, böylece 350 milyar TL’nin üzerinde ilave kefalet limiti sağlanacak. Kullandırımlarda likidite ve teminat açığı bulunan firmalar ile KOBİ lere öncelik verilecek. 3.Kovid‐19 salgınıyla ilgili tedbirlerden etkilendiği için nakit akışı bozulan firmaların kredi anapara ve faiz ödemeleri asgari 3 ay ötelenecek ve ilave finansman desteği sağlanacak. 4.Kamu bankaları ve bazı özel bankalar tarafından vadesi gelen çek, maaş, kredi, dönem sonu faizi gibi ödemeler için ilave kredi limiti tahsis edilecek. 5.İhracatçıya stok finansmanı desteği verilecek. 6.Reeskont kredisi geri ödemelerine 90 güne kadar vade uzatımı sağlanacak, yeni kullanımlara 12 ay ek taahhüt kapama süresi verilecek, kredi kullanım süreleri 240 güne ve uzun vadeliler için 720 güne çıkarılacak. 7.KOSGEB’in 30 Haziran’a tahakkuk edecek alacakları 2021 yılına ertelenecek. 8.Çalıştırılamayan personelin brüt maaşının %60’ına kadarının İşsizlik Fonu’ndan alınmasını sağlayan Kısa Çalışma Ödeneği süreci kolaylaştırılacak ve hızlandırılacak. 9.Bu dönemde çalışılamayan mesainin telafisi için tanınan Telafi çalışma süresi 2 aydan 4 aya çıkartılacak. 10.Esnek ve uzaktan çalışma modelleri daha etkin hale getirilecek. 11.İcra ve iflas takipleri 30 Nisan a kadar durdurulacak. 12.Nisan, Mayıs ve Haziran aylarında temerrüde düşen firmaların kredi siciline mücbir sebep notu düşülecek. 13.Konaklama vergisi Kasım ayına kadar uygulanmayacak. 14.Otel kiralamalarına ilişkin irtifak hakkı bedelleri ve hasılat payı ödemeleri Nisan, Mayıs ve Haziran ayları için 6 ay süreyle ertelenecek. 15.Havayolu yolcu taşımacılığında KDV oranı 30.06.2020 tarihine kadar % 1’e indirilecek 16.Faaliyetleri zorunlu olarak durdurulan iş yerleri için kamu idarelerince kira bedeli tahakkuk ettirilmeyecek. 17.Teknoparklardaki kuluçka firmalarından ve ticari işletmelerden 2 ay süreyle kira alınmayacak. 18.Geri kazanım payı (GEKAP) beyannameleri altı ayda bir verilecek. 19.Kapıkule Sınır Kapısı’nda (öncesinde Habur’da başlatılmıştı) tampon bölgede şoför, dorse veya konteyner değişimi başlatıldı. Uygulama İpsala ve Hamzabeyli kapılarına da yaygınlaştırılacak.
Filipinli Firmaların Aktif Farmasötik Bileşenler İhtiyacı
Sayın Üyemiz; İlgi : Filipinler Ankara Büyükelçiliği’nin 17 Mart 2020 tarihli yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; İlgide kayıtlı yazıda, ekte listesi sunulan aktif farmasötik bileşenlere (APIs) ihtiyaç duyan Filipinli şirketlerin söz konusu ürünleri Türkiye deki üreticilerinden ithal edebileceği konusu bildirilmektedir. Konuya ilgi duyan Üyelerimizin aşağıda iletişim bilgileri sunulan yetkili ile iletişime geçmesi gerekmektedir. Marc Theodore P. Benigno Filipinler Ankara Büyükelçiliği Üçüncü Sekreter ve Konsolos Yardımcısı Telefon: +90-312-4423824 Faks: +90-312-4423856 E-posta: marc.benigno@dfa.gov.ph Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüse Karşı İş Yerlerinin Uygulanması Gereken Kurallar
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Sanayi ve Teknoloji Bakanlığı tarafından hazırlanan “ KORONAVİRÜSE KARŞI İŞ YERLERİNİN UYGULAMASI GEREKEN 7 KURAL “ başlıklı broşür ekte bilgilerinize sunulmuştur. Söz konusu broşürün iş yerlerinize asılması önem arz etmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ekonomik İstikrar Kalkanı Paketi
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;18 Mart 2020 tarihinde Cumhurbaşkanımız Sayın Recep Tayyip ERDOĞAN tarafından açıklanan; koronavirüs salgınının etkilerini azaltmak için hayata geçirilen Ekonomik İstikrar Kalkanı paketi içerisinde yeralan ve iş dünyamızı ilgilendiren hususlar ekte bilginize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fuar iptal ve erteleme başvuruları hak.
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Ticaret Bakanlığının 13.03.2020 tarihli ve 53188695 sayılı yazısı ile 16 Mart – 30 Nisan 2020 tarihleri arasında yer alan fuarların 1 Mayıs 2020 sonrasına ertelenmesi gerektiği iletilmiş olup, bu dönemde takvimde yer alan fuarların iptal veya erteleme başvurularının yapılması gerekmektedir. Takvimde bu tarihler arasında fuarı olan şirketlerin, fuar iptal veya erteleme başvurularına ilişkin evraklarını oda ve borsalara, 1-31 Mayıs tarihleri arasında fiziki olarak teslim edilmesi şartıyla, Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esaslarda sıralanan iptal ve erteleme başvuru belgelerinin elektronik ortamda iletilmesine izin verilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
e-PTT AVM Aracılığı İle Satış
Sayın Üyemiz; TMO Eskişehir Şube Müdürlüğünden Borsamıza iletilen yazıda; stoklarında yer alan pirinç, bakliyat, ve fındık ürünleri nihai tüketicinin uygun koşullarda bu ürünlere ulaşmasını sağlamak maksadıyla ülke genelinde yayılmış yaklaşık 150 TMO satış noktasının e-PTT AVM aracılığıyla da internet üzerinden perakende olarak satışa sunulacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hayvan Hastalıkları İle Mücadele ve Hayvan Hareketleri Kontrolü Genelgesi (2020/1)
Sayın Üyemiz, İlgi : Tarım ve Orman Bakanlığı ndan alınan 19.02.2020 tarih ve 578569 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Tarım ve Orman Bakanlığı ndan alınan ilgi yazıda; Bakanlıkları tarafından yayımlanan 29.03.2019 tarih ve 2019/01 sayılı Genelge nin yürürlükten kalktığı bildirilmekte olup, Hayvan Hastalıkları İle Mücadele ve Hayvan Hareketleri Kontrolü Genelgesi 2020/1 yayımlandığı bildirilerek yeni yayımlanan Genelgenin ilgili kurumlara duyurulması talep edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Standart Değişikliği
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;TSE Gıda, Tarım ve Hayvancılık İhtisas Kurulu na bağlı TK15 Gıda ve Ziraat Teknik Komitesi nce hazırlanan ve ekte kopyaları bulunan  TS 319/tst T1 Haşhaş tohumu küspesi,  TS 318/tst T1 Susam tohumu küspesi,  TS 320/tst T1 Keten tohumu küspesi,  TS 322/tst T1 Kolza tohumu küspesi,  TS 323/tst T2 Fındık küspesi,  TS 4715/tst T1 Mısır özü (embriyo) küspesi taslak standart değişiklik, görüş ve önerilerinizi 02/04/2020 tarihi mesai bitimine kadar eskisehirtb@tobb.org.tr adresine gönderilmesini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Suudi Arabistan Gümrük Uygulamaları
Sayın Üyemiz, İlgi : Ticaret Bakanlığı ndan alınan 11.03.2020 tarihli ve E-00053128286 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İlgi de kayıtlı ve ilişikte bir örneği sunulan yazıda, fuarlarda sergilenmek üzere Suudi Arabistan a geçici ihracı gerçekleştirilen eşya ile ilgili son dönemde yaşanan sorunlar hakkında Riyad Büyükelçiliğimiz tarafından Suudi Arabistan Gümrük İdaresi ile yazışmalar yapıldığı belirtilerek, söz konusu eşya özelinde uygulanacak gümrük işlemleri ile ilgili bilgi verilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gemlik Zeytini adının kullanılması
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Gemlik Ticaret Borsası tarafından Birliğimize gönderilen Gemlik Zeytini adının kullanılmasına ilişkin 04.03.2020 tarihli ve 143 sayılı yazı ekte sunulmuştur Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirus e Karşı Ekonomik Destek Paketi
Sayın Üyemiz; Cumhurbaşkanımız Sayın Recep Tayyip ERDOĞAN’ın Korona Virüs ( Covid-19 ) salgının ekonomik etkilerini azaltmak ve istikrarı korumak üzere 100 milyar liralık bir kaynak seti ile devreye alınacak olan Ekonomik İstikrar Kalkanı tedbirleri; 1- Perakende, AVM, Demir-Çelik, Otomotiv, Lojistik-Ulaşım, Sinema-Tiyatro, Konaklama, Yiyecek-İçecek, Tekstil-Konfeksiyon ve Etkinlik-Organizayon sektörleri için Muhtasar ve KDV tevkifatı ile SGK primlerinin Nisan, Mayıs ve Haziran ödemeleri 6’şar ay ertelenecek. 2- Konaklama vergisi Kasım ayına kadar uygulanmayacak. 3- Otel kiralamalarına ilişkin irtifak hakkı bedelleri ve hasılat payı ödemelerini Nisan, Mayıs ve Haziran ayları için 6 ay süreyle ertelenecek. 4- İç havayolu taşımacılığında 3 ay süreyle KDV oranını yüzde 18’den yüzde 1’e indirildi. 5- Korona Virüs salgınıyla ilgili tedbirlerden etkilendiği için nakit akışı bozulan firmaların bankalara olan kredi anapara ve faiz ödemelerini asgari 3 ay ötelendi ve gerektiğinde bunlara ilave finansman desteği sağlanacak. 6- İhracattaki geçici yavaşlama sürecinde kapasite kullanım oranlarının korunması amacıyla ihracatçıya stok finansmanı desteği verilecek. 7- Bu dönemde işlerinin olumsuz etkilendiğini beyan ederek talepte bulunan esnaf ve sanatkârların Halkbank’a olan kredi borçlarının, Nisan, Mayıs ve Haziran anapara ve faiz ödemelerini 3 ay süreyle ve faizsiz olarak ertelenecek. 8- Kredi Garanti Fonu limitini 25 milyar liradan 50 milyar liraya çıkartacak, kredilerde önceliği gelişmelerden olumsuz etkilendiği için likidite ihtiyacı oluşan ve teminat açığı bulunan firmalar ile KOBİ’lere verilecek. 9- Vatandaşlar için uygun ve avantajlı şartlarda sosyal amaçlı kredi paketleri devreye alınması teşvik edilecek. 10- 500 bin liranın altındaki konutlarda kredilendirilebilir miktarını yüzde 80’den yüzde 90’a çıkartacak, asgari peşinatı yüzde 10’a düşürülecek. 11- Virüsün yayılmasına karşı alınan tedbirlerin etkisiyle Nisan, Mayıs ve Haziran aylarında temerrüde düşen firmaların kredi siciline “mücbir sebep” notu düşülmesini sağlanacak. 12- Stopaj gibi kaynağında yapılan kesintilerin ödemelerini içeren içeren muhtasar beyannamelerin süreleri 3 ay ertelendi. 13- Asgari ücret desteği devam ettirilecek. 14- Mevzuattaki esnek ve uzaktan çalışma modellerinin daha etkin hale getirilmesi temin edilecek. 15- Kısa Çalışma Ödeneği devreye alınacak, bundan faydalanmak için gereken süreçler kolaylaştırılacak ve hızlandırılacak. Faaliyetine ara veren işyerlerindeki işçilere geçici bir gelir desteği verilecek, işverenlerin de maliyeti azaltılacak. 16- En düşük emekli maaşı 1.500 liraya yükseltilecek. 17- Emeklilerin bayram ikramiyesi Nisan ayı başında ödenecek. Yine emeklilerin maaş promosyon ödemelerini, şubelere gitmelerine gerek kalmaksızın, doğrudan hesaplarına yatırılmasını sağlanacak. 18- Aile, Çalışma ve Sosyal Politikalar Bakanlığının belirlediği kriterlere göre ihtiyaç sahibi ailelere yapılacak nakdi yardımlar için ilave 2 milyar liralık bir kaynak ayırılacak. 19- İstihdamdaki sürekliliği temin etmek amacıyla 2 aylık telafi çalışma süresini 4 aya çıkartılacak. 20- Küresel tedarik zincirlerindeki aksama ihtimaline karşı hem üretimde hem de perakende de belirlenen önceliklere göre alternatif kanallar geliştirilecek. 21- Tek başına yaşayan 80 yaş üstü yaşlılar için, sosyal hizmet ve evde sağlık hizmetlerinden oluşan periyodik takip programını devreye alınacak. Üyelerimize duyurulur. Gültekin GÜLER Genel Sekreter
Sayın Meclis ve Meslek Komitesi Üyelerimiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; Oda/Borsa mensuplarımızın Yeni Koronavirüs ten (Covid-19) etkilenmesinin önlenmesi ve virüsün yaygınlaşmasının engellenmesi amacıyla TOBB ve Oda/Borsalarımızca gerçekleştirilecek toplantıların ileri bir tarihe ertelenmesi konusunda Ticaret Bakanlığından görüş sorulduğu,Bakanlık görüşü çerçevesinde, Mart ayında yapılması planlanan Konsey toplantıları ileri bir tarihe ertelendiği,Aynı şekilde, Bakanlıkça; Oda ve Borsalarca Mart ayında yapılması gereken Meclis toplantılarının da Nisan ayının son haftasında gerçekleştirilmesinin, Nisan ayında 2 Meclis Toplantısının birden yapılmasının uygun olacağının değerlendirildiği,Bunun yanında, Mart ayında yapılması gereken Müşterek Meslek Komitesi Toplantılarının ve benzeri diğer kalabalık etkinliklerin de Nisan ayının son haftasından sonra gerçekleştirilmesinin uygun görüldüğü bildirilmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Koronavirüs ( Covid-19 ) isimli hastalığa karşı iş yerlerinde alınması gereken önlemler hakkındaki rapor yer almaktadır. Söz konusu rapor ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bilgilendirme Toplantısı: Almanya da Yatırım
Sayın Üyemiz, İlgi : 03.03.2020 tarihli ve 2157 sayılı yazımız. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,İlgide kayıtlı yazımızda, 17-18 Mart 2020 tarihlerinde Ankara da gerçekleştirileceği belirtilen "Almanya da Yatırım" konulu bilgilendirme toplantısı Koronavirüsü nedeniyle alınan tedbir gereği Alman-Türk Ticaret ve Sanayi Odası (AHK) tarafından ileri bir tarihe ertelenmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Meksika Türk İhraç Ürünleri Fuarı (Erteleme)
Sayın Üyemiz, İlgi : a) 19.02.2020 tarihli ve 34221550-720-1735 sayılı yazımız. b) Ticaret Bakanlığı nın 03.03.2020 tarihli ve 82877844-454.09 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,İlgi (a) da kayıtlı yazımız ile belirtilen "Meksika Türk İhraç Ürünleri" fuarının ileri bir tarihe ertelendiği Ticaret Bakanlığı nın ilgi (b) de kayıtlı yazısı ile Birliğimize bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kanada da İş ve Yatırım Ortamı Bilgilendirme Semineri (Erteleme)
Sayın Üyemiz; İlgi : 10.03.2020 tarihli ve 34221550-720-2584 sayılı yazımız. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,İlgide kayıtlı yazımızla 19 Mart 2020 tarihinde yapılacağı bildirilen Kanada da İş ve Yatırım Ortamı Bilgilendirme Semineri Korona Virüsü sebebiyle alınan tedbirler gereği ileri bir tarihe ertelenmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2020 Şehir Ödülleri Türkiye
Sayın Üyemiz; Her yıl yoğun katılım ile şehir liderleri ve profesyonellerini İzmir’de buluşturan, Türkiye’nin en prestijli ödülleri arasında yer alan, Şehir Ödülleri’nin, diğer şehirlerden gelen yoğun ev sahipliği istekleri üzerine, yapılan değerlendirme ve incelemeler sonucu doğa harikalarının şehri Artvin’de yapılması kararlaştırılarak, 10 Nisan 2020’ye kadar ödül başvuruları kabul edilmeye başladı. “Şehir Ödülleri Türkiye” bu yıl, Yaşayan Şehirler Platformu, Artvin Valiliği, Artvin Belediyesi ve Artvin Ticaret ve Sanayi Odası’nın İş Ortaklığı, Artvin Çoruh Üniversitesi Akademik İş Ortaklığı, T.C. Kültür ve Turizm Bakanlığı, Şavşat Kaymakamlığı ve Şavşat Belediyesi’nin İş Birliği, ilgili bakanlıklar, bürokratlar, siyasal partilerimizin yerel yönetimden sorumlu genel başkan yardımcıları, sivil toplum ve ticari örgütler, belediye birlikleri, kalkınma ajansları, sanatçı, profesyonel ve akademisyenlerin ise destekleri ile 7/8/9 Haziran tarihlerinde “Hayallerin Ötesindeki Şehir, Olağan Üstü İnsanlar” temasıyla “Artvin’de düzenlenecektir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ne Eğitimde Ne İstihdamda Olan Gençler İçin İş Gücü Piyasası Destek Programı İçin Hibe Programı Bilgilendirme ve Eğitim Günleri Hk.
Sayın Üyemiz; Eskişehir Valiliği Avrupa Birliği ve Dış İlişkiler Bürosundan Borsamıza gelen yazıda; Katılım Öncesi Mali Yardım Öncesi Yardım Aracı (IPA)-II kapsamında uygulanan istihdam, Eğitim ve Sosyal Politikalar Sektörel Operasyonel Programının "Ne Eğitimde Ne istihdamda Olan Gençler İçin İşgücü Piyasası Destek Programı İçin Hibe Programı (NEET PRO)" bilgilendirme ve eğitim günleri düzenlenecek olup detaylar ekte ve Başkanlığın sitesinde yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs ( Covid-19 )
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Ortaya çıkan yeni tip Koronavirüs ( Covid-19 ) isimli hastalığa karşı devletimiz tüm kurumlarıyla etkinkoruyucu önlemler almaya devam etmektedir. Gerek Sağlık Bakanlığı gerek Ticaret Bakanlığı söz konusuduruma ilişkin birçok bilgilendirme yapmıştır. Bu çerçevede, Sağlık Bakanlığı tarafından hazırlanan bilgilendirme broşürleri ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Azerbaycan Cumhuriyeti´nin idari yaptırımlar konusundaki yeni uygulaması
Sayın Üyemiz, İlgi: TOBB’nin 09.03.2020 tarihli ve 34221550-020.04-2489 sayılı yazısı Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,İlgi kayıtlı yazıda, Azerbaycan Cumhuriyeti nde trafik kurallarını ihlal eden yabancı devletlere kayıtlı araçları kullanan yabancı uyrukluların ve vatansızların, uygulanan cezaları ödemeden ülkeye serbest şekilde giriş-çıkış yapmalarının neden olduğu olumsuzluklardan dolayı, Azerbaycan Cumhuriyeti Göç Yasasının 17.1.7 maddesi gereğince, Azerbaycan Cumhuriyeti sınırları içinde idari suç işlemiş yabancılar ve vatansızlar hakkında idari yaptırımlar uygulanıncaya kadar bu kişilerin Azerbaycan dan çıkışlarının geçici olarak sınırlandırılacağı bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Güney Kore´de düzenlenecek olan İthal Ürünler Fuarı hakkında
Sayın Üyemiz, İlgi: TOBB’nin 09.03.2020 tarihli ve 34221550-720-2521 sayılı yazısı Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,İlgi kayıtlı yazıda, 25-27 Haziran 2020 tarihlerinde Seul/Güney Kore de "İthal Ürünler Fuarı"nın Ege İhracatçı Birlikleri Genel Sekreterliği (EİB) tarafından düzenleneceği bildirilmişti. Bu defa, Ticaret Bakanlığı ndan iletilen yazıda, küresel ölçekle etkisini gösteren corona virüs salgını sebebiyle anılan fuar organizasyonuna milli katılımın düzenlemesinin iptal edildiği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COSME Programı – Kümelenme Eğitimleri
Sayın Üyemiz, KOSGEB Eskişehir Müdürlüğünden Borsamıza iletilen yazıda AB İşletmelerin ve KOBİ’lerin Rekabet Edebilirliği-COSME Programı nın ulusal koordinasyonu görevini yürüttüğü iletilmektedir. Ülkemizde Program’a ilişkin tanıtım faaliyetleri, başvuru sahiplerine teknik destek verilmesi, bilgi paylaşımı, çağrıların duyurulması gibi çeşitli faaliyetler gerçekleştirilmektedir. KOSGEB Başkanlığı tarafından bu faaliyetlerin etkinliğinin artırılması amacıyla, IPA Rekabetçi Sektörler Programı kapsamında desteklenen "COSME Türkiye Projesi" yürütülmektedir. Proje çerçevesinde hedef kitlenin kapasitesinin arttırılmasına yönelik eğitim ve danışmanlık çalışmaları yürütülmekte, program kapsamında açılan çağrılara yönelik çalışmalar gerçekleştirilmektedir. Bu doğrultuda, COSME 2020 Çalışma Programında yer alan kümelenme çağrılarına yönelik olarak; İstanbul’da 16-17 Mart 2020 tarihlerinde Radisson Blu Otel Şişli’de, Adana’da 19-20 Mart 2020 tarihlerinde Sheraton Grand Otel’de COSME Kümelenme Eğitim Programları gerçekleştirilecektir. Kümelenme çağrılarına ülkemizden KOBİ’lere hizmet sunan kurum/kuruluşlar (Üniversiteler, Teknokentler, Kümeler, OSB ler, Sanayi ve Ticaret Odaları, Meslek Kuruluşları, Sivil Toplum Kuruluşları) başvuru yapabilecek olup, gerçekleştirilecek eğitimlerle çağrıların tanıtılması ve yapılacak başvuruların kalitesinin arttırılması hedeflenmektedir. Söz konusu eğitim programı ve katılımcı bilgilerinin yazı ile KOSGEB Başkanlığına ve e-posta ilecosme@kosgeb.gov.tradresine 11 Mart 2020 tarihine kadar bildirilmesi istenmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Güçlü İletişim Güvenli İşyeri İyi Uygulama Yarışması
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Aile, Çalışma ve Sosyal Hizmetler Bakanlığı İş Sağlığı ve Güvenliği Genel Müdürlüğü tarafından TOBB a gönderilen 24.02.2020 tarihli ve 92097133-821.05-E.532281 sayılı yazıda; - Bakanlık tarafından 1987 yılından bu yana her yıl Mayıs ayında İş Sağlığı ve Güvenliği Haftası etkinlikleri kapsamında yapılan ve 2001 yılından itibaren uluslararası boyutta her iki yılda bir düzenlenen Uluslararası İş Sağlığı ve Güvenliği Kongresinin onuncusunun "3-6 Mayıs 2020" tarihleri arasında "Güçlü İletişim Güvenli İşyeri" mottosu ile İstanbul Kongre Merkezi nde gerçekleştirileceği, - Kongre kapsamında iş sağlığı ve güvenliği alanında "Güçlü İletişim Güvenli İşyeri" mottosu doğrultusunda işyerlerinde yapılan uygulamaları görmek, bu konuda sürdürülen çabaları desteklemek ve teşvik etmek, çalışan-işveren-İSG profesyoneli arasındaki iletişimin gelişimine katkı sağlayacak çalışmaların ilgili tüm kesimlere ulaştırılmasını sağlamak amacıyla işyerlerine yönelik iyi uygulama yarışmasının düzenleneceği, - Alanında uzman jüri üyeleri tarafından değerlendirilecek yarışmada işyerlerinin 1-49, 50-249, 250 ve daha fazla çalışanın istihdam edildiği işyerleri olarak 3 e ayrıldığı, - Yarışmaya başvuru süresinin 13 Şubat 2020-31 Mart 2020 tarihleri arasında olduğu, - Yarışma ile ilgili tüm süreç ve bilgilere Kongrenin internet adresinde (www.isg.gov.tr) yer alan "Yarışma" bağlantısından ulaşılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
21.Kamu Kalite Sempozyumu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Amacı kamu kuruluşları ile kamu kurumu niteliğindeki meslek kuruluşlarının kurumsal kapasitelerini güçlendirmek, yönetim kalitesi konusunda farkındalık oluşturmak olan Kamu Kalite Sempozyumu 2000 yılından bu yana düzenlenmektedir. Bu sene 21.si düzenlenen Kamu Kalite Sempozyumu Birliğimiz ev sahipliğinde Türkiye Kalite Derneği işbirliğinde 26 Mart 2020 tarihinde gerçekleştirilecektir. Sempozyum Birliğimiz Başkanı Sayın M. Rifat Hisarcıklıoğlu nun katılımı ile gerçekleştirilecek, ana oturumlarda ise TBMM Eski Başkanı Sayın Cemil Çiçek ile TOBB Ekonomi ve Teknoloji Üniversitesi Rektörü Prof. Dr. Sayın Güven Sak yer alacaktır. Sempozyuma ilişkin program ekte sunulmakta olup, bu senenin ana teması "Geleceği Şekillendirmek" olarak belirlenmiştir. Sempozyuma katılmak isteyenlerin 20 Mart 2020 Cuma gününe kadar http://kks.tobb.org.tr adresinden kayıt yaptırmaları gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Avrupa Birliği İşletmelerin ve KOBİ’lerin Rekabet Edebilirliği (COSME) Programı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Avrupa Parlamentosu, Çin pazarının büyüklüğünü, ekonomik potansiyelini ve KOBİ lerin bu pazara ulaşırken yaşadığı zorlukları göz önüne alarak Çin de bulunan Avrupa KOBİ lerini destekleyecek AB Yardım Merkezi ni kurma kararı almıştır. Bu çerçevede, Avrupa Birliğinin, "İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı (COSME)" kapsamında, "Çin de AB KOBİ Yardım Merkezi (EU SME Centre in China)" başlıklı bir proje teklif çağrısı yayınlanmıştır. Son başvuru tarihi 2 Nisan 2020 olan proje teklif çağrısına, proje başvuru dokümanları ve rehberine, yazı ekindeki bilgi notunda yer alan internet sayfasından ulaşılabilmektedir. Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB), programın ulusal koordinasyonundan sorumlu kurum olarak yetkilendirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Vergiye Uyumlu Mükelleflere %5 Vergi İndirim
Sayın Üyemiz, Gelir İdaresi Başkanlığından Borsamıza gönderilen yazıda; Vergiye uyumlu gelir ve kurumlar vergisi mükelleflerine sağlanan %5 vergi indirimi uygulamasına ilişkin açıklamaların yer aldığı “Vergiye Uyumlu Mükelleflere %5 Vergi İndirimi” Broşürü hazırlanmıştır. 2019 Yılında elde edilen ticari, zirai ve mesleki kazançları nedeniyle 1-31 Mart 2020 beyan döneminde Yıllık Beyanname verecek mükelleflerimizden şartları taşıyanlar, %5 vergi indiriminden yararlanabileceklerdir. Broşür içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bilgilendirme Toplantısı: Almanya da Yatırım
Sayın Üyemiz, İlgi : Alman-Türk TSO dan alınan 13.02.2020 tarihli e-posta mesajı. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Alman-Türk Ticaret ve Sanayi Odası ndan alınan ilgide kayıtlı e-posta mesajında, 17-18 Mart 2020 tarihlerinde, "Almanya da Yatırım" konulu bir bilgilendirme toplantısı ve akabinde ikili görüşmeler düzenleneceği belirtilmekte ve etkinliğin programı iletilmektedir. Ekte yer alan program çerçevesinde, 17 Mart 2020 tarihinde 09.00-13.00 saatleri arasında gerçekleştirilecek sunuma katılım ücretsiz olup; akabinde AHK Ankara Ofisi nde gerçekleştirilecek olan ikili görüşmelere katılım ücretli olacaktır. Detaylı bilgi ve kayıt için aşağıda iletişim bilgileri yer alan Satı Gör Tekbaş ile iletişime geçilmesi gerekmektedir. Üyelerimizin bilgisine sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yeni Koronavirüs (Covid-19) Hakkında
Sayın Üyemiz, Sağlık Bakanlığı Halk Sağlığı Genel Müdürlüğü tarafından yayımlanan "Yeni Koronavirüs (Covid-19)" hakkında bilgilendirme broşürü ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Export Akademi - Kadın ve Genç Girişimci İhracatçı Yetiştirme Programı Hakkında
Sayın Üyemiz, Eskişehir Ticaret İl Müdürlüğünden Borsamıza gönderilen yazıda, Ticaret Bakanlığınca,ihracat potansiyeli taşıyan kadın ve genç girişimcilerimizin bilgi, deneyim ve network ihtiyaçlarının giderilmesine destek olmak amacıyla, UPS Hızlı Kargo Taşımacılığı A.Ş. (UPS) ile işbirliği içerisinde "Export Akademi - Kadın ve Genç Girişimci İhracatçı Yetiştirme Programı " oluşturulmuştur. Bu çerçevede, kamu-özel sektör işbirliğinde hayata geçirilmiş bulunan program kapsamında,5 Mart 2020 Perşembe günü saat 09.30 da Eskişehir Anemon Otel de,içeriği ekte yer alan bir eğitim programı gerçekleştirilecektir. Bahsi geçen eğitim programınakatılım ücretsiz olup, kontenjan 100 girişimci ile sınırlıdır. Katılım sağlamak isteyen girişimcilerimizin ad soyad, firma tam adı, unvan, e-posta adreslerini ve cep telefonu numaralarını,4 Mart 2020 tarihimesai bitimine kadarexportakademi@ups.come-posta adresine iletmeleri gerekmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Vadeli Arpa Satışı Hakkında Kamuoyu Açıklaması
Sayın Üyemiz, TMO Genel Müdürlüğü tarafından yapılan vadeli arpa satışı ile ilgili ayrıntılı bilgiye ilgili linklerden ulaşılabilecektir. Kamuoyu açıklamasınahttp://www.tmo.gov.tr/Main.aspx?ID=26224adresinden. Satışa açılan ürünlere ilişkin fiyatlarahttp://www.tmo.gov.tr/Main.aspx?ID=1234, stoklara isehttp://www.tmo.gov.tr/Main.aspx?ID=1235linkinden ulaşabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Hububat, Bakliyat ve Pirinç Satışı
Sayın Üyemiz, TMO Genel Müdürlüğü Eskişehir Şubesinden gelen yazıda, Kurumun stoklarında bulunan hububat ve bakliyat, 01-31 Mart 2020 tarihleri arasında peşin olarak satılacaktır. Konu ile ilgil ayrıntılar ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
BVV Trade Fairs Brno (Çekya) Hakkında
Sayın Üyemiz, İlgi: Türkiye Odalar ve Borsalar Birliği nin 27.02.2020 tarih ve 34221550-720-2005 sayılı yazısı Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen bir yazıda; ilgide kayıtlı yazıda, Çek Cumhuriyeti Ankara Büyükelçiliği nin ilgide kayıtlı yazısında, Orta Avrupa nın en büyük sergi ve fuarüssü olan BVV Trade Fairs Brno nun 130.000 metre kare büyüklüğündeki alan ile dünyanın en büyük fuaralanlarından biri olduğu vurgulanarak, 2013 ve 2017 yıllarında düzenlenen çeşitli fuarlarda Türkiye nin de"partner ülke" olduğu belirtilmektedir. Yazıda ayrıca, üst düzey resmi heyetlerin iştirak ettiği Brno Sergisahasında her sene 50 den fazla fuarın gerçekleştiği ve 1 milyonun üzerinde ziyaretçinin katıldığıbelirtilmektedir. BVV Trade Fairs Brno tarafından düzenlenen söz konusu fuarlara ilişkin detaylı bilgilerehttps://www.bvv.cz/en/calendar-of-trade-fairs-events/adresinden ulaşılabilmektedir. Ayrıca, fuar takvimiaşağıda sunulmuştur. FUAR TAKVİMİ BIOMASS Tarimda Yenilenebilir Enerji Kaynakları Fuarı (31.03-4.04.2020) TECHARGO Uluslararası Tarım Teknolojileri Fuarı (31.03-4.04.2020) URBIS Akıllı Şehir ve Belediyecilik Çözümleri Fuarı (3-4.06.2020) MSV Uluslararası Mühendislik Fuarı (05-09.10.2020) IMT Uluslararası Makina ve Aksamları Fuarı (05-09.10.2020) WOODTEC Uluslararası Ahşap işleme ve Mobilya Sanayi Fuarı (21-23.10.2020) IDET Uluslararası Savunma ve Güvenlik Teknolojileri Fuarı (Mayıs 2021) Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Danimarka dan ithalat yapacak firmalarımızın dikkatine
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen bir yazıda;T.C. Kopenhag Ticaret Müşavirliğinin yazısına istinaden, Danimarka da bir süredir, ithalatçı firmaları dolandırmaya yönelik faaliyetlerde artış gözlendiği, Danimarka dan ihracat yaptığını belirterek firmalarımızla temasa geçen bazı şahıslar hakkında şüphe duyulduğu ifade edilmektedir. Yazıda devamla; Müşavirliğimize danışan Türk ithalatçı firma sayısının da arttığı ve şüphelerin tamamına yakınının haklı olduğunun tespit edildiği, gerçek firmalar adına web sitesi kuran ve bu web sitelerinde çeşitli ürünlerin satıldığı izlenimini veren dolandırıcıların, başta Polonya olmak üzere farklı ülkelerdeki banka hesaplarına para gönderilmesini talep ettiği ve sonrasında web sitelerini kapatarak ortadan kaybolduğu iletilmektedir. Bu şekilde hareket eden şahıslara ait web sayfalarının genel özellikleri, bazı örnek sayfa bağlantıları ve ekran görüntüleribağlantıdayer almaktadır. Bu çerçevede, yaşanabilecek mağduriyetlerin önüne geçilebilmesini teminen, özellikle Danimarka dan ilk kez ithalat yapacak firmalarımızın T.C. Kopenhag Ticaret Müşavirliğimize danışmaları önem arz etmektedir. Üyelerimizin bilgisine sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOSGEB İşletme Değerlendirme Raporu
Sayın Üyemiz , Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen bir yazıda; KOSGEB in kamu kurum ve kuruluşlarının mevzuatları kapsamında tutmuş oldukları idari kayıtlar üzerinden işletmelerin mevcut durumlarını ortaya koymak, sektöründe ve bölgesinde konumuna göre bilgiyi sağlamak amacıyla “İşletme Değerlendirme Raporu”nun hazırlandığı belirtilmiştir. Rapor en son onaylı mali yıla ait bilanço veya basit usulde defter bilgisi bulunan işletmeler için hazırlanmış olup, işletmeyi münferiden temsilci olanların rapora erişebildiği belirtilmektedir. TC kimlik numarası ve vergi numarası ESBİS/MERSİS kayıtlarına göre eşleştirilmektedir. KOSGEB veri tabanına kayıt şartının aranmadığı, müştereken temsil durumunda rapora erişilemediği ifade edilmektedir. Söz konusu rapor sadece işletmeyi bilgilendirme amaçlı hazırlanmış olup işletme künyesi, genel sıralama, insan kaynakları, Ar-Ge, yenilik ve markalaşma, verimlilik, ihracat ve finansman bölümlerinden oluşmaktadır. Rapor, veriler üzerinden Türkiye geneli ve İstatistiki Bölge Birimleri Sınıflaması (İBBS) Düzey 1’e göre sektör ortalamaları hesaplanarak, grafikler marifetiyle işletmenin kendisini sektörü ile karşılaştırma imkanı sağlamaktadır. İşletme Değerlendirme Raporuna e-Devlet Kapısı üzerinden erişilmekte olup ilgili üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sri Lanka Savunma Bakanlığı İhale Duyurusu Hakkında
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen bir yazıda, Dışişleri Bakanlığı’nın bir yazısına atıfta bulunularak Kolombo Büyükelçiliğinden iletilen, Sri Lanka Savunma Bakanlığına bağlı Kabine Tarafından Atanmış Daimi Satınalma Komitesinin ihale duyurusu kapsamında; Sri Lanka Kara Kuvvetlerinin haberleşme sisteminin iyileştirilmesini teminen taktik telsiz haberleşme cihazlarının satın alımı için uygun ve nitelikli teklifçilerin kapalı zarfla teklif vermeye davet edildiği ve satın alınacak cihazların türü ve adedine ilişkin bilgilere yer verildiği ifade edilmektedir. Yazıda devamla, söz konusu ihale duyurusunda, ihaleye katılmak isteyenlerin, ilgili ülke Savunma Bakanlığı saymanlığına yazılı başvuru yapmak ve 300.000 LKR (1676 ABD Doları) tutarındaki geri ödemesiz ihale ücretini nakden ödemek suretiyle ihale belgelerini en geç 8 Nisan 2020 ye kadar satın alabilecekleri, ön ihale toplantısının 3 Mart 2020 de Savunma Bakanlığında düzenleneceği, tekliflerin ise 9 Nisan 2020 saat 11:00 den önce Savunma Bakanlığına iletilmesi gerektiği, bu tarihten sonra alınan tekliflerin ve/veya e-postayla iletilen tekliflerin kabul edilmeyeceğinin belirtildiği dile getirilmektedir. Duyuru Metni ekte yer almaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOBİ ler için hibe desteği (Ufuk2020 KOBİ’lere özel hızlandırıcı programı)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda,Avrupa Birliği Ufuk 2020 projesi kapsamında KOBİ lere özel olarak tasarlanan Hızlandırıcı (Accelerator) Programı nın başvurulara açıldığı iletilmektedirAR-GE ve inovasyon faaliyetlerine hibe desteği sağlayan programın Türkiye Koordinasyonu TÜBİTAK tarafından yapılan yapılmaktadır. Program kapsamında KOBİ ler tarafından hazırlanan projelere 2,5 milyon Avro ya kadar hibe verilmekte; ayrıca 15 milyon Avro ya kadar girişim sermayesi alma imkanı da sağlanabilmektedir. Destek oranı; hibe seçeneği için proje bütçesinin %70 idir. Konu hakkında detaylı bilgi ile irtibat noktaları TÜBİTAK tarafından hazırlanan ve ekte bulunan bilgi notunda yer almaktadır. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Construct Nigeria Expo 2020 Hk.
Sayın Üyemiz, İlgi : Nijerya Ticaret, Sanayi, Maden ve Tarım Odaları Birliği nden alınan 20.02.2020 tarihli ve 6373 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen İlgide kayıtlı yazıda, Nijerya Ticaret, Sanayi, Maden ve Tarım Odaları Birliği (NACCIMA) ve Abuja Ticaretve Sanayi Odası (ACCI) işbirliğinde, 15-18 Haziran 2020 tarihleri arasında "Construct Nigeria Expo 2020"etkinliğinin düzenleneceği bildirilmektedir. Abuja Ticaret ve Kongre Merkezi nde düzenleneceği belirtilenetkinliğe 45 ten fazla ülkeden 150.000 den fazla kişinin katılımının beklendiği, 300 ün üzerinde serginin yeralacağı ifade edilmektedir. Nijerya Ticaret, Sanayi, Maden ve Tarım Odaları Birliği İkinci Başkan Yardımcısı Dele Kelvin Oye Esq.tarafından iletilen mail ile Türk Firmaları söz konusu fuara katılmaya davet edilmektedir.Anılan etkinliğe ilişkin broşür ekte sunulmakta olup, fuarla ilgili detaylı bilgiyewww.constructnigeriaexpo.com internet sitesinden ulaşmak mümkündür. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Nijerya Polis Ekipmanları Temini Hk
Sayın Üyemiz, İlgi : Ticaret Bakanlığı ndan alınan 21.02.2020 tarihli ve 52569349 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen ilgide kayıtlı yazıda, Nijeryalı Pens & Drops isimli bir firmadan gelen dilekçe eşliğinde, adı geçen firmanın savunma ve güvenlik alanlarında uzman olduğu ve her türlü asker ve polis ekipmanları konusunda ülkemizden firmalarla irtibat kurmak ve iş birliği sağlamak istediği dile getirilmektedir. Yazıda devamla, söz konusu firmanın Nijerya Polis Gücü ne numune gönderilmek üzere balistik kask ve kurşun geçirmez yelek temini açısından kendilerine yol gösterebilecek firmalarımız ile işbirliği yapmak istediği belirtilmektedir. Anılan Nijerya firmasına ilişkin bilgiler ve firmanın iletişim bilgileri ekte sunulmaktadır. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Türkiye-Libya Birinci Forumu Hakkında
Sayın Üyeniz, İlgi : Dışişleri Bakanlığı ndan alınan 19.02.2020 tarihli ve 31050385 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen ilgide kayıtlı yazıda, Libya nın Ankara Büyükelçiliği nden alınan bir Nota ya atfen, Libya Ticaret, Sanayi veTarım Odaları Genel Birliği nin, Libya-El Dawlia Fuarlar ve Konferanslar Şirketi ile ICFF AIR&ORGŞirketinin işbirliğiyle, Türkiye-Libya Birinci Forumu nu 16-17 Nisan 2020 tarihlerinde İstanbul dadüzenlemeyi planladığı bildirilmektedir. Yazıda devamla, bahse konu etkinliğin Pullman İstanbul Otel ve Kongre Merkezi nde, Libya dan yaklaşık 200civarında iş insanının katılımıyla düzenlenmesinin öngörüldüğü, etkinlik hakkında bilgiyewww.libyaturkeyb2b.com adresinden ulaşılabileceği belirtilmektedir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Sri Lanka Savunma Bakanlığı İhale Duyurusu
Sayın Üyemiz, İlgi : Ticaret Bakanlığı’nın 21.02.2020 tarihli ve 46473657-724.02.01 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen İlgide kayıtlı yazıda, Dışişleri Bakanlığı ndan alınan yazıya atfen, Kolombo Büyükelçiliğimizdeniletilen, Sri Lanka Savunma Bakanlığına bağlı Kabine Tarafından Atanmış Daimi SatınalmaKomitesinin ihale duyurusu kapsamında; Sri Lanka Kara Kuvvetlerinin haberleşme sistemininiyileştirilmesini teminen taktik telsiz haberleşme cihazlarının satın alımı için uygun ve nitelikliteklifçiler kapalı zarfla teklif vermeye davet edildiği ve satın alınacak cihazların türü ve adedine ilişkinbilgilere yer verildiği ifade edilmektedir.Yazıda devamla, söz konusu ihale duyurusunda, ihaleye katılmak isteyenlerin, ilgili ülke SavunmaBakanlığı saymanlığına yazılı başvuru yapmak ve 300.000 LKR (1676 ABD Doları) tutarındaki geriödemesiz ihale ücretini nakden ödemek suretiyle ihale belgelerini en geç 8 Nisan 2020 ye kadar satınalabilecekleri, ön ihale toplantısının 3 Mart 2020 de Savunma Bakanlığında düzenleneceği, tekliflerinise 9 Nisan 2020 saat 11:00 den önce Savunma Bakanlığına iletilmesi gerektiği, bu tarihten sonra alınantekliflerin ve/veya e-postayla iletilen tekliflerin kabul edilmeyeceğinin belirtildiği kaydedilmektedir.İhale duyurusu Birliğimiz web sitesi (www.tobb.org.tr) "Hizmetler" başlığı altındaki Uluslararası İşİmkânları/Yurtdışı Etkinlikler bölümünden temin edilebilmektedir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda,Nijerya da 8-10 Haziran 2020 tarihlerinde, ACCI Ticaret ve Kongre Merkezinde "Halal Expo Nigeria 2020" adlı etkinliğin gerçekleştirileceği bildirilmektedir. Abuja Ticaret ve Sanayi Odası ndan alınan davet mektubunda anılan etkinliğin; elektrikli ev aletleri, giyim ve aksesuar, dekorasyon, aydınlatma, deri, mobilya, bebek ve çocuk ürünleri, zanaat ürünleri, gıda, sağlık, kişisel bakım, gezi ve turizm, el sanatları, çevre dostu ürünler, eğitim ve medya gibi otuzdan fazla sektörü kapsayacağı belirtilmektedir. Bu minvalde, bahsi geçen etkinliğe ilişkin detaylı bilgilere https://www.accinigeria.com/halal-expo-nigeria2020/ adresinden ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Fas - Paketleme ve Plastik Fuarı, 23-26 Eylül 2020
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda,Fas Plastik Federasyonu ile Fas Sanayi, Ticaret, Yatırım ve Dijital Ekonomi Bakanlığı Yatırım ve İthalat Geliştirme Ajansı işbirliğinde düzenlenecek, 4. PACKEXPO 2020 (Uluslararası Paketleme ve Plastik Paketleme Çözümü Fuarı) etkinliğinin, ‘Afrika da Paketleme için Yenilikçi Çözümler Teması kapsamında, 23-26 Eylül 2020 tarihinde Fas ın Kazablanka şehrinde gerçekleştirileceği bildirilmektedir. Fuara 30 ülkeden 15.000 e yakın katılımcı ile 180 e yakın Fuar firmasının katılım sağlamasınınbeklendiği ifade edilmektedir. Fuarla ilgili broşür ekte yer almakta olup detaylı bilgi için Bay NabilSAOUAF ile (Fas Plastik Federasyonu, Mimoza Bulvarı, Tamaris Sk., Ain Sebaa, Kazablanka, Tel: +212 522 66 24 58/ Faks: +212 5 22 66 24 60; federationdeplasturgie@gmail.com; fmprojects@gmail.com;www.fmplasturgie.ma) irtibata geçilebilir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
İran da Özelleştirilecek ve Halka Açılacak Kurumlar Listesi
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda,, İran yeni yılına yönelik, petrol gelirinde öngörülemeyen bir bütçe oluşturulduğu ve bu bütçeninİran Meclisince kabul edildiği belirtilerek yeni bütçede Hükümetin bütçe açıklarını azaltmak için vergileriartırması ve yoğun bir özelleştirme yapmasının öngörüldüğü ifade edilmiştir. Yazıda devamla, İran Özelleştirme Kurumu tarafından ilk aşamada özelleştirilecek veya halka arz edilecekkurumların listesinin yayımlandığı, söz konusu listelere https://bit.ly/38OLVgG ; https://bit.ly/318mqnZbağlantılarından ulaşılabileceği bildirilmektedir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Pakistan 15. Gıda Teknolojileri Asya 2020 Fuarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda,15. Gıda Teknolojileri Asya 2020 Uluslararası Fuar ve Konferansı nın, 12-14 Eylül 2020 tarihlerinde, Pakistan da Karaçi Fuar Merkezi nde düzenleneceği bildirilmektedir. Fuarın plastik, paketleme ve baskı, pirinç teknolojisi, tarım ve canlı hayvan, gıda paketleme ve işleme, gıda güvenliği, un, mutfak ürünleri, atıştırmalık gıda, et teknolojileri ve pişirme sektörlerini kapsaması öngörülmektedir. Fuara 6 ay kala kayıt yaptırarak, minimum 9 metrekare fuar standı (KDV dahil 3.559,50 ABD Doları) kiralayanlara, aşağıdaki imkanların organizatör tarafından sağlanacağı ifade edilmektedir. 1000 ABD Doları nı aşmayan uçuş bileti 1 Fuar standı karşılığında çift kişilik odada 4 gece 5 gün konaklama 3 gün boyunca havaalanı-otel-fuar-restoran transferleri 3 gün boyunca Kahvaltı-öğle yemeği-akşam yemeği Resmi vize davet yazısı Yarım gün şehir turu Resmi Fuar Kataloğunda katılımcı firmanın 200 kelimeyi aşmayacak şekilde tanıtım profili Her bir firma için 10 adet ikili görüşme ayarlanması Fuarla ilgili bilgi broşürü ekte yer almakta olup, Fuar ile ilgili detaylı bilgi için: Dr. Khursheed Nizam; Tel: +92 321 824 4446 Bay Farım Anis; Tel: +92 300 824 444 Bayan Fauzia Khan; Tel:+92 300 056 8721 E-posta:fauzia.khan@ecgateway.netile irtibata geçilebilir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Zambiya daki Altın Madenciliği Hk.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen, 20.02.2020 tarih, 34221550-720-1770 sayılı yazıda, Zambiya’da önümüzdeki dönemde altın madenciliği faaliyetine ağırlık vereceği duyurulmaktadır. Söz konusu duyuruda, Ticaret Bakanlığı’nın 17.02.2020 tarih, 52398875 sayılı yazısına atfen, Türkiye-Zambiya Karma Ekonomik Komisyonu (KEK) 1.Dönem Toplantısı’nın Aile, Çalışma ve Sosyal Hizmetler Bakanımız Sayın Zehra Zümrüt Selçuk’un eşbaşkanlığında 12-13 Şubat 2020 tarihlerinde Zambiya’nın başkenti Lusaka’da gerçekleştirildiği, anılan toplantı vesilesiyle gerçekleştirilen görüşmelerde Zambiya tarafının önümüzdeki dönem altın üretimine ağırlık vereceklerini belirterek, Türk yatırımcı firmalarını bu alanda faaliyet göstermeye davet ettiği bildirilmektedir. Bilgilerinize sunulur, Saygılarımızla, Gültekin GÜLER Genel Sekreter
Konferans Duyurusu (Litvanya)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda, T.C. Ticaret Bakanlığından alınan yazıya atfen, T.C. Ticaret Bakanımız Sn. Ruhsar Pekcan ın Litvanya’ya gerçekleştirmiş oldukları ziyaret sırasında Litvanya’da düzenlenecek olan enerji sektörüne yönelik konferans gündeme gelmiştir. Konuyla ilgili olarak, Vilnius Ticaret Müşavirliğimizce; "Energy Tech Summit" adlı söz konusu konferansın 21-22 Mayıs 2020 tarihlerinde Vilnius/Litvanya da düzenleneceği, elektrikli arabalar, temiz enerji kaynakları, enerji sektöründe yapay zeka ve otomasyonun kullanılması gibi konuların ele alınacağı konferansın bir çok uluslararası konuşmacıya ev sahipliği yapacağı ifade edilmektedir. Bilgilerini ve bahsi geçen konferansa ilişkindetaylı bilgilerehttps://www.energytechsummit.com/adresinden ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Büyük Göller Yatırım ve Ticaret Konferansı Hk.
Sayın Üyemiz, İlgi : Ticaret Bakanlığı ndan alınan 14.02.2020 tarihli ve 52356379 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen ilgide kayıtlı yazıda, Dışişleri Bakanlığı ndan alınan yazıya atfen, Birleşmiş Milletler Genel Sekreteri BüyükGöller Bölgesi Özel Temsilciliği Ofisi yetkilisinin 23 Ocak 2020 tarihinde Kigali Büyükelçiliğimize birziyaret gerçekleştirdiği ve 18-20 Mart 2020 tarihlerinde Kigali de yapılacak olan Büyük Göller Yatırım veTicaret Konferansı (The Great Lakes Investment and Trade Conference - GLITC) hakkında bilgi verdiğibildirilmektedir. Yazıda devamla, anılan yetkilinin bahsekonu konferansa ilişkin değerlendirmeleri aktarılmaktadır. Yetkilininifadelerine göre; konferans BM Genel Sekreteri Büyük Göller Bölgesi Özel Temsilciliği Ofisi tarafındandesteklenmektedir. Söz konusu konferansta yatırıma ve sınır ötesi ticarete odaklanılacaktır. Konferans bukapsamda, anılan konularda bir platform teşkil ederek enerji, madencilik, tarım, altyapı vb. alanlarda BüyükGöller Bölgesi nde projelerin geliştirilmesine katkıda bulunmayı amaçlamaktadır. Söz konusu konferans ileayrıca gençler ve kadınlar için iş ve geçim kaynaklarının oluşturulması teşvik edilecektir. Bahsekonu yazıda, üç gün sürecek konferans ile kamudan ve özel sektörden yaklaşık 700 katılımcıyı bir arayagetirmenin hedeflendiği ve ülkemizden katılım sağlanmasının memnuniyetle karşılanacağını aktarılmış,konferansa sponsor olma, konuşmacı olarak katılma, sergi standı açma olanaklarının da bulunduğubelirtilmiştir. Söz konusu konferansa ilişkin bilgi notları ve konferansın taslak gündemi ile 24-25 Şubat 2016 tarihindeKinşasa da düzenlenen Büyük Göller Bölgesi için Özel Sektör Yatırım Konferansı na (Private SectorInvestment Conference for the Great Lakes region) dair bilgi notu ekte sunulmaktadır. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Fas a Gerçekleştirilecek İhracatlarda Uygunluk Kontrolleri Hk.
Sayın Üyemiz, İlgi : Ticaret Bakanlığı ndan alınan 17.02.2020 tarihli ve 52403607 sayılı yazı. Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda,ilgi yazıda, Rabat Ticaret Müşavirliğimizden alınan bir yazıya atfen, Fas a ithal edilen sanayi ürünlerinin yerelmevzuat çerçevesinde uygunluk kontrollerinin 1 Şubat 2020 tarihinden itibaren dış kaynak kullanılarakgerçekleştirilmeye başlanılacağı, bu kapsamda adı geçen Fas lı Bakanlıkla Fransız Bureau Veritas, AlmanTUV Rheinland ve İspanyol ApplusFomento firmaları ile anlaşma sağlandığı, bahsi geçen tarihten itibarenkontrole tabi olan sanayi ürünlerinin ithalatçıları tarafından anlaşmalı şirketlerden sağlanan uygunluksertifikalarının ibrazının zorunlu hale geleceği ifade edilmektedir. Söz konusu yazıda, bazı ürünlerin uygunluk kontrollerinin, anlaşmalı şirketler tarafından, Fas gümrük kontrolnoktalarında gerçekleştirileceği ifade edilirken, bu ürünler aşağıdaki listedeki şekilde tanımlanmıştır:- Otomobil yedek parçaları: lastikler, aküler, fren aksesuarları, camlar, filtreleme elemanları, mekanik kontrolkablosu - Yapı malzemeleri: seramik fayans, çimento, sızdırmazlık levhaları, sıhhi ürünler, musluklar, plastik borular - Ahşap paneller - Gazlı cihazlar: gazlı ısıtıcılar, gazlı su ısıtıcıları - Filmaşin ve beton demiri - İş kıyafetleri dışındaki giyim ürünleri - Elektrik ürünleri: Cep telefonları için şarj cihazları, devre kesiciler - Battaniyeler, halılar ve döşemelik kumaşlar - Bebek bezi Söz konusu listeye ilişkin detaylı ürün bilgilerini içeren dokümana http://www.mcinet.gov.ma sitesindenulaşmak mümkündür.Diğer taraftan, liste kapsamı dışında kalan sanayi ürünlerinde uygunluk kontrollerinin çıkış ülkelerinde gerçekleştirileceği, 20 Nisan 2020 tarihine kadar tanımlanan geçiş döneminde ise ithalatçılara yukarıda listedeyer verilen ürünler dışında kalan tüm sanayi ürünleri için Fas gümrük noktalarında uygunluk kontrollerinigerçekleştirme imkanı tanınacağı hususuna yer verildiği ifade edilmektedir. Uygulamadan sorumlu Faslı Bakanlık olan Fas Sanayi, Ticaret, Yeşil ve Sayısal Ekonomi Bakanlığının(http://www.mcinet.gov.ma/) internet sitesinden genel uygulama bilgilerine, mevzuat ve konuya ilişkin olarakTicaret, Yeşil ve Sayısal Ekonomi Bakanlığının internet sitesinde yayımlanan duyuruya ulaşabilmekmümkündür. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Güney Kore Fuarları Tanıtım Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gelen yazıda; 19-22 Mayıs 2020 tarihlerinde "Seoul Food and Hotel" fuarının Selten Uluslararası Fuar ve Aksesuarları firması tarafından, 25-27 Haziran 2020 tarihlerinde ‘’İthal Ürünleri’’ fuarının Ege İhracatçı Birlikleri Genel Sekreterliği tarafından düzenleneceği bildirilmiştir. Ayrıca gıda ve tarım ürünleri, plastik, kauçuk, tekstil ve konfeksiyon, demir-çelik, iklimlendirme, elektronik, otomotiv yan sanayi, deniz taşıtları ve mobilya sektörlerinde faaliyet gösteren firmalardan Güney Kore’ye yapılacak ihracatın büyük bir potansiyel teşkil ettiği ifade edilmiştir. Bu çerçevede 03 Mart 2020 tarihinde Ege İhracatçı Birlikleri’nde anılan fuarlar ile ilgili İzmir ili için bir tanıtım toplantısı düzenlenecektir. Bilgilerinize sunulur, Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kazan Enerji Forumu ve Fuarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden aldığımız 14.02.2020 tarihli yazıda, 17-19 Mart 2020 tarihleri arasında Tataristan’ın başkenti Kazan’da “Tataristan Uluslararası Enerji, Kaynak Verimliliği ve Ekoloji Forumu” ve eşzamanlı olarak “Enerji ve Enerji Kaynaklarının Tasarrufu” ile “21. Yüzyıl Çevre Teknolojileri ve Ekipmanları” konulu fuarların düzenleneceği bildirilmiştir. Söz konusu Forum ile ilgili davet mektubuna (www.tobb.org.tr) adresinde yer alan “Hizmetler” başlığı altındaki “Uluslararası İş İmkanları/Yurt Dışı Etkinlikler bölümünden ve aynı zamanda etkinliklere ilişkin güncel bilgilere (http://tef.tatar) adresinden ulaşılacağı belirtilmiştir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Afrika İş ve Yatırım Forumu ( AFRIBIF 2020)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen, 10.02.2020 tarih, 34221550-720-1371 sayılı yazıda, Afrika İş ve Yatırım Forumu duyurulmaktadır. Söz konusu duyuruda, Ticaret Bakanlığı’nın 05.02. 2020 tarih, 52032068 sayılı yazısına atfen, Afrika İş ve Yatırım Forumu’nun (AFRIBIF 2020) 23-27 Mart 2020 tarihleri arasında Nijerya’nın başkenti Abuja’daki Nicon Luxury Oteli’nde düzenleneceği bildirilmektedir. Duyuruda devamla, Türkiye Odalar ve Borsalar Birliği’nin Nijerya Ankara Büyükelçiliği’nden aldığı yazıya atfen, foruma katılacak katılımcılar için sergi alanı maliyetlerine ilişkin bilgiler ve ilgili web sitesi aşağıda belirtilmiştir; web sitesi:www.afribif.com Konferans delege ücreti (Kişi Başı) N120.000.00 (350 $); 95 metrekarelik fuar standı N350.000,00 (1.000 $); 12 metrekarelik üst sınıf stand N525.000,00 (1.500 $); 20 metrekarelik eyalet veya ülke pavyonu N7.000.000,00 (2.000 $); Konaklama / otel rezervasyonu yukarıdaki web sitesinden alınabilir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Katar Uluslararası Hurma Festivali 2020
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; Katar Belediye ve Çevre Bakanlığı tarafından 8-18 Nisan 2020 tarihlerinde, Doha da Uluslararası Hurma Festivali 2020 nin düzenleneceği bildirilmektedir. Festivale katılmak için ekte yer alan formun doldurularak formda belirtilen e-posta adreslerine iletilmesi gerekmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kazan Enerji Forumu ve Fuarı Hakkında
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden Borsamıza ulaşan yazıda Tataristan Sanayi ve Ticaret Bakanlığı tarafından 17-19 Mart 2020 tarihlerinde Tataristan ın başkenti Kazan da "Tataristan Uluslararası Enerji, Kaynak Verimliliği ve Ekoloji Forumu" ve eşzamanlı olarak "Enerji ve Enerji Kaynaklarının Tasarufu" ile "21. Yüzyıl Çevre Teknolojileri ve Ekipmanları" konulu fuarların düzenleneceği belirtilmektedir. Anılan Forum da enerji verimliliği alanında gaz yakıt pazarındaki gelişmeler, alternatif enerji kaynakları ve üretimin dijitalleşmesi konuları ele alınacak olup, günümüzdeki "enerji tasarruf teknolojileri" ve "yenilikçi enerji tasarrufu" uygulamaları sergilenecektir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Güney Kore Fuarları Hakkında İl Tanıtım Toplantıları
Sayın Üyemiz, TOBB dan Borsamıza ulaşan bilgilendirmede, Ticaret Bakanlığından alınan yazıya atfen, 19-22 Mayıs 2020 tarihlerinde Seoul Food and Hotel fuarının Selten Uluslararası Fuar ve Aksesuarları Tic. Ltd. Şti tarafından, 25-27 Haziran 2020 tarihlerinde Import Goods Fair-İthal Ürünleri fuarının Ege İhracatçı Birlikleri Genel Sekreterliği (EİB) tarafından düzenleneceği bildirilmektedir. Yazıda devamla, anılan etkinliklerde gıda ve tarım ürünleri, plastik, kauçuk, tekstil, ve konfeksiyon, demir-çelik, iklimlendirme, elektronik, otomotiv yan sanayi, deniz taşıtları ve mobilya, gibi ülkemizin Güney Kore ye ihracat potansiyeli yüksek olan sektörlerde firmalarımızın yoğun katılımının beklendiği ifade edilmektedir. Bu çerçevede, anılan fuarlara ilişkin olarak 25 Şubat - 3 Mart 2020 tarihlerinde Adana, Bursa, Gaziantep, İstanbul, Ankara ve İzmir şehirlerinde tanıtım toplantılarının düzenleneceği bildirilmektedir. Toplantı takvimi ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
TMO Kabuklu Fındık Satışı Hk.
Sayın Üyemiz, TMO Genel Müdürlüğü Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda kabuklu fındık satışı hakkında bilgi yer almaktadır. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla, Eskişehir Ticaret Borsası
E-İhracat Eğitimi
Sayın Üyemiz, T.C. Eskişehir Valiliği nden Borsamıza gelen yazıda27-­28Şubat2020tarihlerinde10.00/­16.00saatleriarasında DivanOtelEskişehir’dee­ticaretvee­ihracatkonularındafaaliyetgösterenveilgiduyan vatandaşlarımızayönelik2günsürecek“E­İhracatEğitimi”düzenlenecektir. Eğitimekatılımbaşvurularıhttps://tinyurl.com/ulla5wnbağlantısıüzerinden çevrimiçialınacakolupkontenjan100kişiilesınırlıdır. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Meksika Türk İhraç Ürünleri Fuarı
Sayın Üyemiz, İlgi: Ticaret Bakanlığı nın 13.02.2020 tarihli ve 82877844-454.09 sayılı yazısı. Ticaret Bakanlığımızın ilgide kayıtlı yazısı ile, 17-20 Nisan 2020 tarihleri arasında Meksika nın Meksiko şehrinde "Meksika Türk İhraç Ürünleri" fuarının Orta Anadolu İhracatçı Birlikleri Genel Sekreterliği organizatörlüğünde düzenleneceği, söz konusu fuarın gerçekleştirilmesinin Bakanımız Sayın Ruhsar PEKCAN ve Meksikalı mevkidaşının iki ülke arasında ticari ilişkilerin geliştirilmesine yönelik ortak kararlılıklarının bir ifadesi olduğu, fuar açılışının Sayın Bakanlar tarafından gerçekleştirilmesinin planlandığı bildirilmektedir. Yazıda devamla, Meksika nın dünyanın 11 inci büyük ekonomisi olması, dış ticaret bakımından ülkemizin bölgede yoğunluklu ticari faaliyet gösterdiği ülkelerden birisi olmaması gibi unsurların bu ülkeyi Türk iş insanları için önemli bir cazibe odağı haline getirdiği, tarım ürünleri, petrol ürünleri, plastik, kauçuk, tekstil ve konfeksiyon, demir-çelik, iklimlendirme, elektronik, otomotiv yan sanayi, deniz taşıtları ve mobilya sektörlerinde bu ülkeye yapılacak ihracatın büyük bir potansiyel teşkil ettiği ifade edilmektedir. Bu kapsamda, ayrıca, Sayın Bakanların Türkiye-Meksika ticari ilişkilerinin sahip olduğu yüksek potansiyeli gerçekleştirme iradeleri göz önünde bulundurularak yukarıda bahsi geçen sektörlerde faaliyet gösteren firmalarımızın geniş katılımıyla bir fuarın sağlanmasında fayda olduğu bildirilmektedir. Bu çerçevede anılan fuara ve Meksika pazarına ilişkin olarak 19-21 Şubat 2020 tarihleri arasında Adana, Bursa, Gaziantep, İstanbul ve İzmir şehirlerinde tanıtım toplantılarının düzenleneceği bildirilmektedir. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Bosna Hersek Troleybüs Alımına İlişkin İhale Duyurusu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden aldığımız 17.02.2020 tarih ve 1610 sayılı yazıda, Ticaret Bakanlığı ndan alınan ilgili yazı çerçevesinde, Avrupa İmar ve Kalkınma Bankası (EBRD) tarafından, Saraybosna Kantonu Hükümeti ile Saraybosna Kantonu Ulaştırma Bakanlığı nın ihtiyaçları için 25 adet yeni troleybüs alımına ilişkin ihale duyurusu yapıldığı belirtilmektedir. Yazıda devamla, ihale duyurusuna EBRD ninhttps://ecepp.ebrd.com/respond/49EPVKG9X4 adresinden ulaşılabileceği ve aday firmaların 23/03/2020 günü yerel saatle 12:00 a kadar tekliflerini iletebilecekleri ifade edilmektedir. Bilgilerinize sunarız. Saygılarımızla, Eskişehir Ticaret Borsası
Lüksemburg’da “Citi Invest Control” İsimli Firmanın Şüphe Uyandıran Faaliyetleri Hakkında
Sayın Üyemiz, TOBB dan Borsamıza gelen bilgilendirmede, T.C. Lüksemburg Büyükelçiliğimizden alınan yazıya atıfla, son dönemde ülkemizden bazı firmalarca yazılı ve şifahi olarak iletilen mesajlara göre, Lüksemburg’da bulunan ‘Citi Invest Control’ isimli bir firmanın, ülkemizde özellikle inşaat sektöründe faaliyet gösterenler başta olmak üzere, bazı firmalarımızla iletişime geçerek, faaliyet alanlarıyla yatırım amaçlı olarak ilgilendiklerini beyan ettiğinin; iletişim kurdukları firmalarımızı, şirket sahibinin veya eşinin tedavi görmekte olduğu bahanesiyle, yüz yüze görüşmek için Roma veya Lüksemburg’a davet ettiğinin; turizm sektöründe faaliyet gösteren bir şirketimizin anılan firma ile bir yatırım fonuna para transfer etmek bahanesiyle maddi sorun yaşadığının anlaşıldığı bildirilmektedir. Yazıda, 2019 yılı itibarıyla yaklaşık olarak 4,6 trilyon Avro tutarında yatırım fonuna ev sahipliği yapan ve bu alanda New York’tan sonra dünyada ikinci sırada yer alan Lüksemburg’da kurulan firmaların, uygulamada faaliyet adresi olarak firma kuruluşu ile ilgili belgeleri hazırlayan/düzenleyen muhasebe veya avukatlık bürolarını gösterebildikleri; öte yandan Lüksemburg makamlarının firma kuruluşlarını basitleştirme çabalarının ve vergi konusunda firmalara sağladıkları avantajların da etkisiyle, ülkede yaklaşık olarak 30.000 civarında “posta kutusu” tabir edilen şirketin bulunduğunun tahmin edildiği; Lüksemburg mevzuatına göre bütün firmaların resmi niteliği haiz “Ticaret ve Şirket Kaydı (Registre de Commerce et des Sociétés-www.rcsl.lu)” isimli siteye, firmaya dair muhtelif bilgi ve belgelerle birlikte kaydedildiği, fakat anılan sitede kayıtlarının bulunmasının, söz konusu tüm firmaların güvenilir olduğuna delalet etmediği ifade edilmektedir. Bu bağlamda, Lüksemburg’da yerleşik şirketlerle iş yapmak isteyen firmalarımızın kurumsal niteliği hakkında şüphe duyulmayan firmalar ile muhatap olmalarının önem arz ettiği vurgulanmaktadır. Bilgilerinize sunulur. Saygılarımızla. Gültekin GÜLER GENEL SEKRETER
Bankacılık Sistemine Yönelik Ücretlere İlişkin Düzenlemeler
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden alınan 13.02.2020 tarih ve 34221550-010.05-1535 sayılı yazı ile; sanayici ve tüccarımızın sorunlarının çözümüne yönelik olarak girişimde bulunulan ve takip edilen konulardan birisi olan banka işlem ücretlerine ilişkin Merkez Bankası tarafından ’’Bankalarca Ticari Müşterilerden Alınabilecek Ücretlere İlişkin Usul ve Esaslar Hakkında Tebliğ’’ ve Bankacılık Düzenleme ve Denetleme Kurumu (BDDK) tarafından ’’Finansal Tüketicilerden Alınacak Ücretlere İlişkin Usul ve Esaslar Hakkında Yönetmelikte Değişiklik Yapılmasına İlişkin Yönetmelik’in yayınlandığı bildirilmiştir. Yürürlük tarihi 01.03.2020 olan ’’Bankalarca Ticari Müşterilerden Alınabilecek Ücretlere İlişkin Usul ve Esaslar Hakkında Tebliğ’’ ile birlikte; •Ticari müşterinin vadesi gelmemiş bir veya birden çok taksit ödemesinde bulunduğu veya kredi borcunun tamamını erken ödediği hallerde banka erken ödenen miktara göre tahakkuk etmeyen tüm faiz ve diğer maliyet unsurlarına ilişkin indirimleri yapmakla yükümlü olacaktır. •Ticari müşterinin kredinin tamamı için erken ödeme talebinde bulunması halinde bankalar bu talebi kabul etmek zorunda olacaktır. Ticari müşterilerden alınabilecek erken ödeme ücreti, gerekli faiz indirimi yapılarak hesaplanan ve ticari müşteriler tarafından bankaya erken ödenen tutarın, kalan vadesi yirmi dört ayı aşmayan kredilerde yüzde birini, kalan vadesi yirmi dört ayı aşan kredilerde ise yüzde ikisini geçemeyecektir. Faiz oranının değişken olarak belirlenmesi halinde bu müşterilerden erken ödeme ücreti talep edilemeyecektir. Ayrıca, Hazine destekli KGF kefaleti ile kullandırılan kredilerin erken kapatılması halinde bankalarca talep edilen erken kapama komisyonlarının alınmaması gerektiği Bakanlıkça değerlendirilmiştir. Diğer taraftan, yürürlük tarihi yine 01.03.2020 olan Finansal Tüketicilerden Alınacak Ücretlere İlişkin Usul ve Esaslar Hakkında Yönetmelikte Değişiklik Yapılmasına İlişkin Yönetmeliği’’ ile birlikte; •EFT işlemlerinden alınacak ücret işlem tutarının 1.000.-TL’nin altında olması halinde mobil bankacılık uygulamaları ve internet bankacılığı aracılığıyla yapılan işlemler ile düzenli ödemelerde 1.-TL’yi, ATM’den yapılan işlemlerde 2.-TL’yi, diğer kanallar ile yapılan işlemlerde ise 5.-TL’yi geçemeyecektir. İşlem tutarının 1.000.-TL ile 50.000.-TL arasında olması halinde bu sınırlar sırasıyla 2.-TL, 5.-TL ve 10.-TL olarak, işlem tutarının 50.000.-TL ve üzerinde olması durumunda ise 25.-TL, 50.-TL ve 100.-TL olarak uygulanacaktır. Kuruluş ile finansal tüketici arasındaki sözleşmede geç işlemler olarak belirlenen ve mutat saatler dışında yapılan EFT işlemlerinde anılan sınırlar %50 artırımlı olarak uygulanacaktır. Havale işlemlerinde ise uygulanacak azami ücretler EFT işlemleri için belirtilen ayrımlara tabi olarak ilgili ücretlerin yarısı oranında uygulanacaktır. Bankalarca gerçekleştirilen uluslararası para transfer işlemlerinin ücretleri ise finansal tüketici ile banka arasında düzenlenen sözleşme ile belirlenecektir. Bilgilerinize sunulur. Saygılarımızla. Gültekin GÜLER GENEL SEKRETER
Bosna Hersek te Düzenlenmesi Öngörülen Enerji Konulu Konferanslar
Sayın Üyemiz, İlgi : Dışişleri Bakanlığı’ndan alınan 06.02.2020 tarih ve 30996616 sayılı yazıya istinaden; Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelenİlgide kayıtlı yazıda 5-6 Mart 2020 tarihlerinde Borsa Hersek’in Trebinje şehrinde Batı Balkanların Enerji Geleceği konulu konferans gerçekleştirilecektir. Konferans ile ilgili detaylı bilgiyehttps://setrebinje.com/sadrzaj/jedna/9/0/enadresinden ulaşılabilmektedir. 18-20 Mart 2020 tarihlerinde Borsa Hersek’in Neum şehrinde Enerji Zirvesi gerçekleştirilecektir.https://www.energetskisamit.ba/en/home/adresinden detaylı bilgilere ulaşılabilmektedir. Bilgilerinize sunulur. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gelen yazıda, Türkiye ve Kosova arasında imzalanan Serbest Ticaret Anlaşmasının 14 Haziran 2019 tarihinde yürürlüğe girdiği ve Kosova Ticaret Odası ile TOBB arasında gerçekleştirilen temaslar neticesinde ilki Türkiye’de, ikincisi Kosova’da olmak üzere bahse konu Anlaşmanın getirdiği fırsatlar hakkında toplantı düzenlenmesinin kararlaştırıldığı belirtilmektedir. Bu kapsamda, 19 Şubat 2020 tarihinde, TOBB ev sahipliğinde Ankara’da bir toplantı gerçekleştirilmesi ve toplantıda TOBB Başkanı M. Rifat Hisarcıklıoğlu ve Kosova Ticaret Odası Başkanı Berat Rukiqi’nin açılış konuşmalarının akabinde, Ticaret Bakanlığı tarafından Anlaşma hakkında detaylı bir sunum yapılması, ayrıca toplantı kapsamında Türk ve Kosova özel sektör temsilcilerinin ikili görüşmeler gerçekleştirmesi planlanmaktadır. Söz konusu toplantıya katılmak isteyen üyelerimizinkosova.tobb.org.tradresinden kayıt yaptırması hususunu bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Workshop: Marka İtibarı İçin Yerelleştirmenin Önemi
Sayın Üyemiz: İlgi : Alman-Türk Ticaret ve Sanayi Odası’ndan alınan 15.01.2020 tarihli e-posta mesajı. Alman-Türk Ticaret ve Sanayi Odası’ndan alınan ilgide kayıtlı yazıda, 18 Şubat 2020 tarihinde, 13:30-16:00 saatleri arasında, “Marka İtibarı İçin Yerelleştirmenin Önemi” konulu bir workshop düzenleneceği belirtilerek, toplantı kapsamında aşağıdaki konuların ele alınacağı iletilmektedir: – Uluslararası marka-müşteri etkileşimlerinin önemli unsurlarından Localization (Yerelleştirme) ve Foreignization (Yabancılaştırma) nedir? – Marka itibarı açısından dilbilgisel doğruluk çalışmaları – Çeviri dünyasının geleceği olarak görülen Machine Translation (Makine Çevirisi) sürecine nasıl uyum sağlanır ve maliyetlerinizi azaltmak için makine çevirisini nasıl kullanabilirsiniz? – Makine Çevirisi için ilk aşama olan Translation Memory (Çeviri Belleği) nedir ve böyle bir belleğe sahip olmak neden sizin için gereklidir? Workshop’a katılım ücretsiz olup, katılımcıların kayıt yaptırması beklenmektedir. Bilgilerinize sunarız. Saygılarımızla. Gültekin GÜLER Genel Sekreter
TMO Un İhalesi İlanı
Sayın Üyemiz, TMO Genel Müdürlüğünden Borsamıza gönderilen ihale duyurusu hakkında ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla.
Avrupa Birliği İşletmelerin ve KOBİ lerin Rekabet Edebilirliği (COSME) Programı
Sayın Üyemiz Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gönderilen yazıda, Avrupa Birliği’nin, ‘’İşletmelerin ve KOBİ’lerin Rekabet Edebilirliği Programı ( COSME)’’ kapsamında, sanayide yüksek katma değerli ürün ve hizmet yaratılmasını amaçlayan ‘’ELITT ( European Liğht Industries Innovation and Technology Project)’’başlıklı bir proje teklif çağrısı yayınlamıştır. Son Başvuru tarihi 17 Mart 2020 olan proje teklif çağrısına,proje başvuru dokümanları ve rehberine, Avrupa Komisyonununhttps://ec.europa.eu/growth/tools-databases/eliitinternet sayfasından ulaşılabilmektedir. Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB), programın ulusal koordinasyonundan sorumlu kurum olarak yetkilendirilmiştir. Söz konusu çağrıya ilişkin bilgiler ekte sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Et ve Süt Kurumu Dondurulmuş Sığır Karkas Et Satışı Hk.
Sayın Üyemiz, Et ve Süt Kurumu dan Borsamıza gönderilen yazıda, dondurulmuş sığr karkas eti satışı hakkında bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla. Gültekin GÜLER Genel Sekreter
Elüs ve İthal Ürün Satışları Hk.
Sayın Üyemiz, TMO Genel Müdürlüğünden Borsamıza gönderilen yazıda; TMO Elektronik satış platformu üzerinden tahsisi yapılan ithal ürün satışları için TMO hesaplarına para yatırma süre sonu sehven 22.01.2020 olarak bildirilmiştir. Söz konusu ithal ürün satışlarında Şubat ayı için TMO hesaplarına para yatırma süre sonu 21.02.2020 tarihi olarak uygulanacaktır. Saygılarımızla Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Kütahya Vakıflar Bölge Müdürlüğünden borsamıza gönderilen ihale ilanına ait ayrıntılı bilgi ektedir. Bilgilerinize rica ederiz.
Mısır Satışı Hk.
Sayın Üyemiz, S.S. Eskişehir Pancar Ekicileri Kooperatifi nden borsamıza gönderilen mısır satışı hakkında yazıya ait ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla Gültekin GÜLER Genel Sekreter
Peru da Düzenlenecek Olan Uluslararası Altın, Gümüş Ve Bakır Sempozyumu Hk.
Sayın Üyemiz, İlgi :Türkiye Odalar ve Borsalar Birliğinin (TOBB), 28/01/2020 tarihli ve 914 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği (TOBB) tarafından Borsamıza gönderilen ilgi yazıda, Peru Ulusal Madencilik, Petrol ve Enerji Odası tarafından 26-28 Mayıs 2020 tarihleri arasında Lima da, başta altın, gümüş ve bakır jeolojisi olmak üzere doğal kaynakların potansiyeliyle ilgili farkındalığı arttırmayı, bölgedeki yeni yatırım ve iş olanaklarını teşvik etmeyi ve uzmanlar ve danışmanların pazarın gelişimi konusundaki bilgi ve etkileşimlerini güçlendirmeyi hedefleyen "XIV. Uluslararası Altın, Gümüş ve Bakır Sempozyumu"nun düzenleneceği bildirilmektedir. Söz konusu sempozyuma ilişkin detaylı bilgilere ve taslak programa TOBB web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Yurt dışı Etkinlikler" bölümünden ulaşılabileceği belirtilmektedir. Bilgilerini arz/rica ederim. Gültekin GÜLER Genel Sekreter
"PEMT 20" Toplantısı Hk.
Sayın Üyemiz İlgi :Türkiye Odalar ve Borsalar Birliğinin (TOBB) 30/01/2020 tarihli 1047 sayılı yazısı. Türkiye Odalar ve Borsalar Birliği (TOBB) tarafından Borsamıza gönderilen ilgi yazıda, Türkiye Petrolleri Anonim Ortaklığı (TPAO) ev sahipliğinde ve Türkiye Cumhuriyeti Enerji ve Tabii Kaynaklar Bakanı Sayın Fatih Dönmez’in teşrifleriyle 10 Şubat 2020 tarihinde Crown Plaza – İstanbul Asia’da “Petrol Endüstrisinde Milli Teknolojiler (PEMT20)” toplantısı gerçekleştirileceği bildirilmiştir. Bilgilerinize arz/rica ederim. Gültekin GÜLER Genel Sekreter
BMGK Irak Yaptırımlar Listesinin Güncellenmesi Hk.
Sayın Üyemiz, İlgi:T.C. Ulaştırma ve Altyapı Bakanlığı Deniz Ticareti Genel Müdürlüğü’nün 12.07.2019 tarihli ve 52756 sayılı yazısı ve eki. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İlgi yazı ile, Birleşmiş Milletler Güvenlik Konseyi’nin (BMGK) 1518 (2003) sayılı Kararı uyarınca faaliyet gösteren Irak Yaptırımlar Komitesi’nin 24 Haziran 2019 tarihli Notası’nda özetle, yaptırımlar listesinde yapılan son güncellemeyle, 1483 (2003) sayılı Kararının 19. ve 23. paragrafları çerçevesinde, ekte (Ek-1) yer alan kuruluşların 24 Haziran 2019 tarihi itibariyle yaptırım listesinden çıkartıldığı bildirilmektedir. Bilgilerinizi arz/rica ederim. Gültekin GÜLER Genel Sekreter
TMO Hububat, Bakliyat ve Pirinç Satışı Hakkında
Sayın üyemiz, Tmo Eskişehir Şube Müdürlüğünden alınan ihaleye ait yazı Ekte Bilgilerinize Sunulmuştur. Saygılarımızla Gültekin GÜLER Genel Sekreter
Bosna Hersek Federasyonu İhale Duyurusu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Bosna Hersek Federasyonu Enerji Bakanlığı nın petrol ve doğal gaz keşifleri için bir ihale açtığı bildirilmekte ve ihaleye ilişkin detaylar ile iletişim bilgileri ekte sunulmaktadır. Bilgilerinizi rica ederiz. Gültekin GÜLER Genel Sekreter
7. Uluslararası İş Geliştirme Forumu,Burkina Faso, 27-29 Mayıs 2020
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İslam Ticaret, Sanayi ve Tarım Odası nın 22.01.2020 tarih ve 17/ITCS/00/0 sayılı yazısına atfen, Burkina Ticaret ve Sanayi Odası tarafından, "7. Uluslararası İş Geliştirme Forumu AFRICALLIA2020"nin, 27-29 Mayıs 2020 tarihlerinde, Burkina Faso nun başkenti Ougadougou da düzenleneceği bildirilmektedir. Yazıda devamla, konuyla ilgili detaylı bilgi için Burkina Ticaret ve Sanayi Odası temsilcileri (info@africallia.com;felix.sanon@cci.bfve; tel: +226 25 30 61 14/ +226 25 30 61 15) ile irtibata geçilebileceği belirtilmiştir. Bilgilerinizi rica ederiz. Gültekin GÜLER Genel Sekreter
Automechanika Buenos Aires 2020 Hk.
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;İstanbul Ticaret Odasının yazısına ilişkin duyuru aşağıdadır; “İstanbul Ticaret Odası nın ilgide kayıtlı yazısı ile, 4-7 Kasım 2020 tarihlerinde Arjantin in başkenti Buenos Aires de, Güney Amerika da düzenlenen en büyük otomotiv sanayi Fuarı olan "Automechanika Buenos Aires 2020"nin gerçekleştirileceği bildirilmektedir. Türkiye Milli Komite iştirakı olan İstanbul Ticaret Odası organizasyonunda gerçekleşecek olan söz konusu Fuara a ilişkin detaylı bilgilere ve katılım formuna TOBB web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Yurt dışı Etkinlikler" bölümünden ulaşılabilmektedir. Bilgilerinize sunarız. Gültekin GÜLER Genel Sekreter
Libya daki Yatırım Fırsatları
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; Dışişleri Bakanlığı’nın yazısına atfen; Trablus Büyükelçimizin, Ulusal Mutabakat Hükümeti (UMH) Başkanlık Konseyi üyesi Kıdemli Bakan Muhammed Ammari Zayed in yönlendirmesi üzerine ziyaret talebinde bulunan "Mechanical&Electrical Manufacturing Company S.A." (MEM) adlı Libya devlet şirketinin temsilcileri Genel Müdür Mühendis Jamal Abushagour, Dış Yatırımlar İdaresi Müdürü Abdülvahid Ali Malik El-Şami ve Ammari Zayed in Danışmanı Muhammed El-Fatih Ali Muhammed Gargum ile görüştüğü bildirilmektedir.Anılan görüşmede, Genel Müdür Jamal Abushagour un, MEM şirketinin Libya İktisadi ve Sosyal Kalkınma Fonu na bağlı olduğunu, bağımsız bütçe ve tüzel kişiliği bulunduğunu, Libya ticaret kanunları hükümlerine uygun faaliyet gösterdiğini, Gıryan da 200 hektara varan bir alanda çeşitlimekanik ve elektrik sanayileri alanlarındafaaliyet gösteren bir sanayi komplekslerinin olduğunu ve ilave inşaat çalışmalarıyla yeni sanayi alanlarını da içerecek şekilde genişletilebileceğini, ilgi duyabilecek Türk şirketleriyle ortak yatırım yapma arzusunda olduklarını ifade ettiği belirtilmektedir.Abdülvahid Ali Malik El-Şami nin,ilaç sanayi ve tıbbi teçhizat alanlarında üretimlerinigenişletmek amacıyla ülkemizle işbirliği yapmayı arzuladıklarını söylediği kaydedilmektedir. Adı geçenlerin, faaliyet ve taleplerine ilişkin ilettiği Arapça mektup ve Trablus Büyükelçiliğimizce yapılan Türkçe çevirisi ile UMH Sağlık Bakanlığı na bağlı İlaç ve Tıbbi Malzeme Genel İmalat Şirketinden alınan İngilizce mektup ekte sunulmuştur. MEM in Arapça mektubunda,Türk şirketleriyle mekanik-elektrik endüstrisi, madenlerin dökümü, şekillendirilmesi ve dövülmesi gibi alanlarda yatırım yapılması arzusunda olduklarıbelirtilmektedir.İlaç ve Tıbbi Malzeme Genel İmalat Şirketinden alınan mektupta ise,ilaç ve tıbbi malzeme üretimi gibi alanlarda ilgi duyabilecek şirketlerletemas etmek istedikleri ifade edilmektedir. Bilgilerinizi rica ederiz. Gültekin GÜLER Genel Sekreter
Değerli Üyelerimiz, Elazığ ve Malatya daki depremzede kardeşlerimize Borsamızın koordinasyonunda #KARDEŞLERİMİZİN YANINDAYIZ# sloganıyla #YARDIM KAMPANYASI# başlattık. Yardım etmek isteyen hayırseverlerimizden beklenen öncelikli yardım malzemeleri; 1-Isıtıcı ( elektrikli-tüplü) 2-Kullanılmamış giysi 3- Kuru gıda 4- Çocuk bezidir. Yardımlarınızı Elazığ ve Malatya’daki AFAD Merkezlerine gönderilmek üzere Borsamız Merkezine ve İrtibat Bürolarına en kısa sürede tutanak ile teslim etmenizi veya adresinizden alınması için İrtibat Telefonumuz 0 222 237 27 83 - 111 e bilgi verilmesini rica ederiz. Ülkemize geçmiş olsun.
Eskişehir Masal Yarışması
Sayın Üyemiz, Eskişehir Valiliği İl Kültür ve Turizm Müdürlüğü tarafından düzenlenen "Bin Masal, Bir Şehir Anlat Eskişehir" başlıklı masal yarışmasının son başvuru tarihi ilginin yoğun olması ve talepler doğrultusunda 14 Şubat 2020 Cuma gününe kadar uzatılmıştır. Yarışmaya ilişkin detaylı bilgiyehttps://eskisehir.ktb.gov.trlinkinden de ulaşabilirsiniz. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yeniden Değerleme Oranının Uygulanması
Sayın Üyemiz, İçişleri Bakanlığı İller İdaresi Genel Müdürlüğünün 31.12.2019 tarih ve 22735 sayılı yazısına istinaden, Eskişehir Valiliğinden gönderilen yazıda Ulaştırma ve Altyapı Bakanlığının "Yeniden Değerleme Oranının Uygulanması" konulu yazısı ve ekleri, ekte bilgilerinize sunulmuştur. Saygılarımızla Gültekin GÜLER Genel Sekreter
Gıda Ürünlerinde Taklit ve Tağşiş Yapan Firmalar Hk.
Sayın üyemiz, Tarım ve Orman Bakanlığı 13.01.2020 tarihinde laboratuvar sonucu taklit ve tağşiş yapıldığı kesinleşen ve kişilerin hayatını ve sağlığını tehlikeye düşürecek şekilde bozulmuş, değiştirilmiş gıdaları üreten ve satan firmaların bilgilerini kamuoyuna duyurmuştur. Bahse konu firmaların listesi ilgili linkte bilgilerinize sunulmuştur. https://www.tarimorman.gov.tr/Lists/Duyuru/Attachments/1102/Kamuoyu_Duyurusu_2020-1.pdf Saygılarımızla. Gültekin GÜLER Genel Sekreter
Çifteler Kaymakamlığı taşınır, taşınmaz ilanı
Sayın Üyemiz, Çifteler Kaymakamlığından Borsamıza gönderilen yazıda, taşınır ve taşınmazlara ait ihale yapılacağı bildirilmiştir. ihale hakkında ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla. Gültekin GÜLER Genel Sekreter
İkili Odalar a Üyelik
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,TOBB’un yurtdışında muadili olan özel sektör kuruluşları (Oda/Birlik/Federasyon) ile kurumsal işbirliğini geliştirme çabaları çerçevesinde bir dizi ülke ile “Ticaret ve Sanayi Odası Forumu” adı altında yapılanmaya gideceği bildirilmiştir. 11 ülke ile “Ticaret ve Sanayi Odası Forumu” kurulmuş olup ülkemiz öncelikleri doğrultusunda çalışmalara başlanmıştır. İkili Oda Forumları kapsamında hem Türkiye’de hem muhatap ülkelerde etkinlikler düzenlenmekte, muhatap ülkenin resmi ve çeşitli sektörlerdeki firma temsilcileri ile ikili görüşme fırsatları sunulmaktadır. Ticaret ve Sanayi Odası Forumlarına ilişkin üyelik dahil tüm bilgilerehttps://tobb.org.tr/IkiliOdalar/AnaSayfa.phplinkinden ulaşılabilmektedir. Bilgilerinize sunarız. Gültekin GÜLER Genel Sekreter
Ticaret Bakanımızın Hırvatistan Ziyareti
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Ticaret Bakanımız Sayın Ruhsar Pekcan’ın, 11 Şubat 2020 tarihinde Hırvatistan’ı ziyaret ederek bir takım temaslarda bulunmasının öngörüldüğü belirtilerek, söz konusu temaslarda gündeme getirilmesinde fayda görülen hususlara ilişkin görüş talep edilmektedir. Söz konusu ziyaret kapsamında görüş bildirmek isteyen üyelerimizin görüşlerini 24 Ocak 2020 Cuma günü mesai bitimine kadar Türkiye Odalar ve Borsalar Birliğine gönderilmek üzere Borsamıza iletmeleri gerekmektedir. Bilgilerinize sunarız. Gültekin GÜLER Genel Sekreter
Pakistan Değerli Taşlar ve Mineral Sergisi
Sayın Üyemiz, Pakistan Büyükelçiliği nin 08.01.2020 tarih ve Pol-27/2020 sayılı yazısına istinaden TOBB’dan alınan 17.01.2020 tarih ve 595 sayılı yazıda, 20. Pakistan Değerli Taşlar ve Mineral Sergisi nin, 6-8 Mart 2020 tarihlerinde Pakistan İslamabad Otel de düzenleneceği bildirilmektedir. Konuyla ilgili detaylı bilgi için: Haji Dost Muhammed E-mail:apceap@yahoo.com Telefon: +92-3339103320; +92-91-9331919-11 Saygılarımızla, Gültekin GÜLER Genel Sekreter
CIIE 2020 Fuarı Bilgilendirme Semineri
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda , ikincisi 05-10 Kasım 2019 tarihleri arasında Şanhay/Çin Halk Cumhuriyeti (ÇHC) nde gerçekleştirilen "Çin Uluslararası İthalat Fuarı (CIIE)" milli katılım organizasyonunun İstanbul Maden ve Metaller İhracatçı Birlikleri (İMMİB) Genel Sekreterliği tarafından gerçekleştirildiği, 180 ülkeden yaklaşık 3900 katılımcının bulunduğu, 500 binden fazla yerli ve yabancı profesyonel alıcının yer aldığı fuarda Gıda ve Tarımsal Ürünler, Aksesuar & Tüketici Ürünleri, Tüketici Elektroniği& Elektronik Aletler, Giyim, Otomobil, Mobilya, Mücevher, Üst Düzey Akıllı Ekipmanlar, Hizmetler sektörleri olmak üzere, 6 ayrı holde 1496 m2 alanda 54 firmanın katıldığı bilirtilmektedir. Ticaret Bakanımız Ruhsar PEKCAN ın açıklamış olduğu İhracat Ana Planı çerçevesinde ÇHC hedef ülke kapsamında olup, ÇHC ne yönelik ihracatımızın arttırlmasını teminen, CIIE nin 2020 yılında aynı tarihlerde gerçekleştirilecek üçüncü versiyonuna daha güçlü bir düzeyde katılım sağlanmasına karar verildiği ifade edilmektedir. Bu kapsamda, Ticaret Bakan Yardımcısı Gonca YILMAZ BATUR ile Çin Ticaret Bakan Yardımcısı Ren HOGBİN in teşrifleriyle anılan fuarın tanıtmı ve ÇHC ne yönelik bilgilendirme semineri nin 7 Şubat 2020 tarihinde Dış ticaret Kompleksi/İstanbul da gerçekleştirileceği bildirilmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Afrika Kalkınma Bankası nın Ekvator Ginesi nde Finanse Etmeyi Öngördüğü Projeler
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda ;Afrika Kalkınma Bankası (AfDB) yetkililerinin, Ekvator Ginesi ne yönelik 2020 yılı kredi programını oluşturmak üzere bu ülkeyi ziyaret ettiği ve Banka nın önümüzdeki dönemde Kamu Maliyesi Modernizasyon Destek Programının takvimini ve özel sektöre yönelik kredi dağılımını gözden geçireceği bildirilmektedir. AfDB nin Ekvator Ginesi nde finanse etmeyi planladığı projeler aşağıdaki şekilde ifade edilmektedir: a. Liman ve Havalimanı altyapılarında faydalanılarak fuarlar düzenlenmesinin teşviki programı, b. Ekvator Ginesi nde elektronik yönetim ve cazibenin arttırılması için fiberoptik ağının geliştirilmesi programı, c. Balıkçılık ve tarım sektörünün desteklenmesi programı, d. Ekvator Ginesi ile Kamerun arasında Ntem Nehri üzerinde köprü inşa edilmesi projesi, e. Kamu maliyesi yönetiminin iyileştirilmesi programı, f. Sosyal sektörde insan kaynaklarının geliştirilmesi programı, g. Bütçe destek programı, h. Kariyer geliştirme programı Saygılarımızla, Gültekin GÜLER Genel Sekreter
İran Ticaret ve Teknoloji Toplantısı, 21-23 Ocak 2020, İstanbul
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; İran İslam Cumhuriyeti Cumhurbaşkanı’nın Bilim ve Teknolojiden Sorumlu Yardımcısı Prof. Dr. Sorena Sattari nin, 21-23 Ocak 2020 tarihleri arasında Türkiye ye gerçekleştireceği ziyaret çerçevesinde, 22 Ocak 2020 Çarşamba günü, İstanbul Elit World Hotel Konferans Salonu’nda iki ülke iş insanlarının katılımı ile "Ticaret ve Teknoloji Toplantısı" düzenleneceği bildirilmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda, Ticaret Bakanlığı yazısına atfen, 5 Kasım 2019 tarihinde Nijerya’nın Ondo Eyaleti Yatırım ve Kalkınma Ajansı Genel Müdürü Boye Oyewumi ile toplantı yapıldığı, şehirde açılacak yeni liman ile Lagos limanının yoğunluğunu kendi eyaletlerine çekmeyi hedefledikleri, liman inşaatına eyalet tarafından Yap İşlet Devret finansman sistemi ile başlanacağı, Yatırım ve Kalkınma Ajansının da projeye önem verdiği ifade edilmektedir. Yazıda devamla, yeni limanın hem eyaletin kalkınması için büyük bir fırsat olarak göründüğü hem de yatırım fırsatları ile Türk firmalarımızın limanın yapımında söz sahibi olabilmesi açısından değer kazandığı belirtilmektedir. Bahse konu yatırım projeleri hakkında bilgi ve irtibat noktalarını içeren doküman ekte yer almaktadır. Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıdaTSE-Gebze Tahribatsız Muayene Laboratuvarı’ndan alınan yazıya atfen; Gözle Muayene Kurs ve Sınavına ait ücret ve tarihler ile eğitime başvuru için gerekli dilekçe örneği ekte bilgilerinize sunulmaktadır. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda, Dışişleri Bakanlığı’ndan alınan yazıya atfen; Dışişleri Bakanımız Mevlüt Çavuşoğlu’nun, 11 Şubat 2020 tarihinde Karadağ’ı ve 12 Şubat 2020 tarihinde Arnavutluk’u ziyaret ederek bir takım temaslarda bulunmasının öngörüldüğü belirtilerek, söz konusu temaslarda gündeme getirilmesinde fayda görülen hususlara ilişkin görüş talep edilmektedir. Söz konusu ziyaret kapsamında görüş bildirmek isteyen üyelerimizin görüşlerini 20 Ocak 2020 cuma günü mesai bitimine kadar Türkiye Odalar ve Borsalar Birliği’ne gönderilmek üzere Borsamıza iletmeleri gerekmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda, Ticaret Bakanlığı’ndan alınan yazıya atfen; Ticaret Bakan Yardımcımız Sayın Gonca YILMAZ BATUR ile Meksikalı muhatabı Meksika Ekonomi Bakanlığı Dış Ticaret Bakan Yardımcısı Sayın Luz Maria de la Mora SANCHEZ’in arasında yapılan bir mektup teatisi neticesinde iki ülke arasındaki ticaretin serbestleştirilmesi ve engellerin kaldırılmasına yönelik istişarelerde bulunulmasının kararlaştırıldığı bildirilmektedir. Meksika tarafının, iki ülke arasında ticaretin kolaylaştırılması faaliyetlerinin etkinleştirilmesi amacıyla bir çalışma grubu kurulmasını önerdiği; olası işbirliği alanları ve çalışma konularının görüşülmesi amacıyla bir araya gelinmesini teklif ettiği belirtilmektedir. Bu çerçevede, Meksika ile ticaretin kolaylaştırılması alanında muhtemel işbirliği konularına ve toplantıda gündeme getirilmesinde fayda görülen hususlara ilişkin görüş göndermek isteyen üyelerimizin en geç 17 Ocak 2020 mesai bitimine kadar görüşlerini Borsamıza iletmeleri gerekmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOSGEB Yurt Dışı İş Gezisi Destek Programı Uygulama Esasları Revizyonu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden (TOBB) Borsamıza iletilen yazıda TOBB ile KOSGEB arasında geçen sene gerçekleştirilen işbirliği sonucunda oda ve borsaların KOBİ lerin katılımı ile düzenlendikleri KOSGEB destekli yurt dışı iş gezisi başvurularının TOBB a yapılmakta olduğu ve ardından KOSGEB tarafından onaylandığı belirtilmiştir. Başvuru noktasının TOBB a alınmasının, oda ve borsalar tarafından düzenlenen yurt dışı fuar sayısını arttırdığı da ifade edilmiştir. Bu süreçte uygulamanın yaygınlaştırılması ve iyileştirilmesi için birtakım çalışmalar gerçekleştirildiği aktarılmıştır. Gerçekleştirilen çalışmalar neticesinde KOSGEB tarafından İşletme Geliştirme Destek Programı Uygulama Esaslarını nın Yurt Dışı İş Gezisi Desteği başlığında 02.01.2020 tarihinden itibaren geçerli olmak üzere yapılan iyileştirilmeler aşağıda yer almaktadır. Destek Limitlerinde Artış:Kuzey Amerika, Güney Amerika ve Avustralya kıtası ile Asya Pasifik Ülkeleri için destek 5.000 TL’den 10.000 TL’ye, Çin Halk Cumhuriyeti dahil diğer ülkeler için 3.000 TL’den 5.00 TL’ye çıkarılmıştır. Kolay Başvuru:Başvuru esnasında talep edilen, iş yükünü artıran ve bürokrasi oluşturan belgeler azaltılarak başvurular kolaylaştırılmıştır. Fuar Kapsamının Genişletilmesi:Destek kapsamında Milli Katılım Organizasyonu Düzenlenecek Fuarların yanı sıra Prestijli Fuarlar Listesi de dahil edilmiştir. Bilginize sunarız. Gültekin GÜLER Genel Sekreter
TİGEM Karkas Et Satış İhalesi
Sayın Üyemiz, TİGEM Anadolu Tarım İşletmesi Müdürlüğü nden Borsamıza gönderilen karkas et satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Karadağ ve Arnavutluk hk. Görüş Talebi
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda;Dış işleri Bakanlığının yazısında atfen; Dış işleri Bakanımız Mevlüt Çavuşoğlu nun, 11 Şubat 2020 tarihinde Karadağ ı ve 12 Şubat 2020 tarihinde Arnavutluk u ziyaret ederek birtakım temaslarda bulunmasının öngörüldüğü belirtilerek, söz konusu temaslarda gündeme getirilmesinde fayda görülen hususlara ilişkin Borsamız görüşü talep edilmektedir. Söz konusu temaslarda gündeme ilave edilmek üzere görüş belirtmek isteyen üyelerimizin en geç 17 Ocak 2020 mesai bitimine kadar görüşleriniBorsamızailetilmelerini rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye - Çin 17. Dönem KEK Toplantısı
Sayın Üyemiz, Sayın Üyemiz,Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda; 20 Şubat 2020 tarihinde Pekin de Türkiye - Çin Halk Cumhuriyeti Karma Ekonomik ve Komisyonu (KEK) 17. Dönem Toplantısı nın düzenleneceği bildirilmiştir. Eşbaşkanlığı nı Ticaret Bakanımız Ruhsar Pekcan ile Çin Halk Cumhuriyeti Ticaret Bakanı ZhongShan tarafından yürütüleceği ifade edilmiş olan toplantıda Çin Halk Cumhuriyeti ile ikili ticari ve ekonomik ilişkilerimizde varsa sorunlar ve çözüm önerileri ile bahse konu toplantıda gündeme getirilmesinde yarar görülen konular ile toplantı sonucunda imzalanması öngörülen Protokolde yer alması talep edilen hususlara ilişkin görüşlerinizi 15 Ocak 2020 Çarşamba günü mesai bitimine kadar Borsamız e-posta adresine göndermeniz hususunu bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hayvan ve Hayvansal Ürünlerin İthalat - İhracat İşlemlerinde Elektronik Kayıt Sistemi
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Tarım ve Orman Bakanlığı çalışmaları neticesinde canlı hayvan, hayvansal yan ürünler dâhil tüm hayvansal ürünler ve hastalık bulaştırma riski olan sap, saman gibi bir takım bitkisel ürünlerin ülkeye girişindeki veteriner kontrolleri ve gerekli durumlarda ithalat izin işlemlerinin bilgisayar ortamında yürütülmesi ve elektronik olarak kayıt altına alınabilmesi amacıyla web tabanlı bir yazılım sistemi geliştirilmiştir. İthal edilmek istenen canlı hayvan ve hayvansal ürünlerin kontrol belgesi ve ithalat işlemleri, ithalatçıların ve ilgili bakanlık birimlerinin kullanacağı web tabanlı elektronik sistemden gerçekleştirilecektir. Söz konusu sitemehttps://hbs.tarbil.gov.tr/web adresinden ulaşılabilmektedir. Belirtilen kayıt sistemi için gerçek veya tüzel her ithalatçı BakanlığınVSKN/İl/İlçe Müdürlüklerine başvurarak T.C. Kimlik No / Vergi No ile kayıtlarını gerçekleştirebileceklerdir. İthalatçı kişi veya firmalar adına işlem gerçekleştirecek kişiler noter onaylı yetki belgelerinin aslı ile yine bu birimlere başvurarak sistemden ilgili firma adına yetkilendirileceklerdir. https://hbs.tarbil.gov.tr/web adresinden giriş yapılacak sistemin kontrol belgesi ve Veteriner Giriş Belgesi doldurma işlemlerini açıklayan videohttp://content.tarimtv.gov.tr/asset/86m75x9q/7UPn97mm.htmladresinde yeralmaktadır. 01 Eylül 2019 tarihinden itibaren kullanıma başlanan sistemle ilgili aksaklıklara mahal verilmemesi amacıyla uygulama videosunun izlenmesi, gerek görüldüğü takdirde VSKN Müdürlükleri personelinden bilgi alınması gerekmektedir. https://www.tarimorman.gov.tr/Sayfalar/Detay.aspx?OgeId=1052&Liste=Duyuru Saygılarımızla, Gültekin GÜLER Genel Sekreter
Aydın Uluslararası Tarım Gıda ve Hayvancılık Fuarı
Sayın Üyemiz, 23-26 Ocak 2020 tarihleri arasında, Aydın İl Merkezinde düzenlenecek olan Aydın Uluslararası Tarım Gıda ve Hayvancılık Fuarının 23 Ocak 2020 Perşembe günü saat 12:00 de açılışı gerçekleştirilecektir. Yöresel ürünlerin, tarım ve hayvancılık sektörlerine ait makinelerin sergileneceği fuar 24-26 Ocak 2020 tarihleri arasında 10:00 - 18:00 saatleri arasında ziyaretçilere açık olacaktır. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Elüs ve ithal ürün satışları
Sayın Üyemiz, TMO Genel Müdürlüğünden Borsamıza gönderilen yazıda,buğday ve arpa satışı hakkında bilgi aktarılmıştır. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Brunei ‘de Terunjing Serbest Bölgesi için Yatırım Çağrısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Brunei ‘de kurulan Terunjing Serbest Bölgesi için yatırım çağrısı duyurulmaktadır. Dışişleri Bakanlığı nın 24.12.2019 tarihli, 21364333-150.05-2019/24260297 sayılı yazısı ile, Brunei Darüsselam Büyükelçiliğinden alınan, Darusselam Enterprise (DARe) tarafından hazırlandığı belirtilen ilana aften, Türk yatırımcılarının Brunei’de kurulan Terunjing Serbest Ticaret Bölgesi’nde faaliyet göstermek üzere davet edildiği ve söz konusu davete ilişkin başvuru yapabilmek içinrfp@dare.gov.bne-posta adresine “ EOI-The Investment and Development of Terunjing Free Trade Zone ” (Reference Number: EOI 19 14 00) konu başlığıyla bir mail atılabileceği ve ardından13 Şubat 2020 tarihinde yerel saatle sabah 10:00’a kadarNiyet Beyanı’nın iletilebileceği bildirilmektedir. Yazıda devamla, Brunei Hükümetinin ülkenin ekonomik yapısını çeşitlendirebilmek amacıyla enerji (petrol, doğalgaz, petrokimya), imalat (ilaç, kozmetik, tıbbi malzeme), gıda, bilgi-iletişim teknolojileri ve hizmet (restorasyon, denizcilik-marina, atık yönetimi, eğitim, sağlık) sektörlerine öncelik verdiği, fakat diğer sektörlerden yapılacak yatırımları da değerlendirecekleri belirtilmektedir. Terunjing Serbest Ticaret Bölgesi’nin ilanının Türkiye Odalar ve Borsalar Birliği web sitesi (www.tobb.org.tr) sağ panelinde “Hizmetler” başlığı altındaki Uluslararası İş İmkanları/Yurtdışı Etkinlikler bölümünden temin edilebilmekte olduğu ifade edilmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Taipei Akıllı Şehirler Zirvesi/expo
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,Tayvan ın başkenti Taipei şehri Dünya Ticaret Merkezi nde 24-27 Mart 2020 tarihlerinde "Akıllı Şehirler Zirvesi/Expo” düzenleneceği bildirilmektedir. Yazıda devamla, anılan Zirve de liderlerin, düşünürlerin, sanayide karar vericilerin görüş alışverişinde bulunup çözüm odaklı bir yaklaşımla kurgulanan B2B faaliyetlerinin gerçekleştirileceği kaydedilmektedir. Söz konusu Zirve de sürdürülebilir şehir anlayışı ve akıllı şehir hizmetleriyle ilgili forumların yansıra firmalar için farklı alanlarda aktiviteler düzenleneceği ifade edilmektedir. Anılan etkinlik için son başvuru tarihi17 Ocak 2020olup, detaylı bilgilerehttp://en.smartcity.org.twlinkinden ve Christine Yeh (Tel: +886 2 2577-4249 ext. 820 E-Posta:chrisy@mail.tca.org.tw)ile irtibata geçilerek ulaşılabilmektedir Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden alınan bir yazıda, Ottava Büyükelçiliğimizden alınan bir yazıya atfen, şirketlerimizin Kanada’yı ziyaretlerinde dikkat etmesi gereken hususlara ilişkin Ottava Büyükelçiliğimizin görüş ve önerileri bildirilmektedir. Yazıda aşağıdaki hususlara değinilmektedir: 1.Kanadalı firmalar, yabancı iş heyetlerinin ziyaretlerinde, davetin ticaret odaları gibi yerel kuruluşlar tarafından kendilerine iletilmemesi durumunda, “B2B” görüşmelerine yeterli ilgi göstermemektedir. Bu durum, ticaret odalarıyla çalışmadıkları takdirde, danışmanlık ve eşleştirme firmalarının etkinliğini azalmaktadır. Düzenli olarak benzer etkinlikler düzenleyen ve yerel koşulları bilen ticaret odaları gibi yerel kuruluşların, mekan kirası, lojistik düzenlemeler, tercüme, kayıt ve tanıtım için web sayfası hazırlanması gibi tamamlayıcı hizmetleri daha uygun koşullarda sağlayabildiği gözlemlenmektedir. Ayrıca, ticaret ve meslek odaları, geniş üye tabanlarından faydalanarak doğru eşleştirmeyi yapabilmekte ve farklı sektörlerden firmalara ulaşabilmektedir. Ticaret ve meslek odaları dışındaki danışmanlık firmalarının, Kanadalı firmalar ve Kanada resmi makamları tarafından ciddiye alınmadığı, sahipleri ve/veya çalışanları göçmen statüsünde bulunan ve bir kısmı Kanada piyasasını henüz tanımamakta olan bu tür özel firmaların çevrelerinin yetersiz olduğu, iş deneyimlerinin sınırlı kaldığı, Kanada’daki ortamı doğru yansıtamadıkları ve ülkemizdeki kurumların ise bu firmaları muhatap aldıkları görülmektedir. Bu tür firmalarca hazırlanan programın yeterince zenginleştirilememesi sonucunda, iş bağlantıları yapılamadığı, heyetlerin ziyaretlerinin turistik düzeyde kaldığı, etkinliklerin tamamen danışmanlık ve eşleştirme firmalarından hizmet alımıyla gerçekleştirilmesi halinde bedelin 50.000-60.000 ABD Dolarına varabildiği, bununla birlikte Kanada tarafından katılımın gayet sınırlı kalabildiği, üç beş Kanadalı firmayı geçmediği gözlemlenmektedir. 2.Heyetlerin faaliyetlerinde göze çarpan bir başka husus iş yapma ve bağlantı kurma anlayışlarında yaşanmaktadır. Ticaret odaları gibi yerel kuruluşlar salt “B2B” görüşmeleri düzenlemek yerine, ülke, sektör, yatırım ortamı, iş yapma kültürü vb. konularda bilgilendirme seminerleriyle birlikte “networking” ve “B2B” görüşmelerini içeren daha kapsamlı programlar düzenlemeyi arzu etmektedir. Heyetlerimiz ise genellikle, zamanlarının tamamını “B2B” görüşmelerine ve saha ziyaretlerine ayırmak istemekte ve her bir “B2B” görüşmesinin önceden planlanmasını şart koşmaktadır. Oysa Kanada’da iş bağlantısı kurmanın en etkili yollarından birini bilgilendirme toplantıları ve “networking” teşkil etmekte, bunun için de seminer ve konferans gibi etkinliklere ağırlık verilmekte, “B2B” görüşmeleri ise etkinlikle eş zamanlı olarak organize edilmektedir. 3.Yukarıda belirtilen hususlar bağlamında, sektörel veya genel ticaret heyetlerimizin ziyaretlerinden somut sonuç alınabilmesini teminen; •Kanada’yı ziyaret eden iş heyetlerimizce Ottava Büyükelçiliğimiz, Toronto, Montreal ve Vencouver Başkonsolosluklarımız, Ottava Ticaret Müşavirliğimiz ve Toronto Ticaret Ateşeliğimizle azami ölçüde işbirliği yapılmasında, •Temsilciliklerimizin yerel bağlantılarından istifade edilmesinde ve aracı firmalar yerine ticaret odaları gibi yerel kuruluşlarla çalışılmasında, •Danışmanlık ve eşleştirme firmalarından gerekmesi halinde sadece tamamlayıcı/lojistik hizmet alınmasında, bu firmaların seçilmesinde Kanada’da mukim temsilciliklerimizin tecrübelerine başvurulmasında, •Heyetlerimizin ziyaretlerini imkanların elverdiği ölçüde yerel dillere hakim yetkililerin yardımıyla koordine etmelerinde, gerektiği takdirde tercüme hizmeti almalarında, •”Networking” olanağı sağlaması itibariyle seminer ve konferans gibi faaliyetlere de ağırlık verilmesinde, ayrıca mümkün olduğu durumlarda ziyarete gerek kalmadan gerçekleştirilebilen sanal “B2B” uygulamaları gibi daha düşük bütçeli alternatiflerin de değerlendirilmesinde fayda olduğu düşünülmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İtalya Sanayiciler Birliği Confındustria’nın Milano’da Düzenleyeceği Etkinlik
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,İtalya Sanayiciler Birliği Konfederasyonu’nun (Confindustria) organize ettiği, İtalyan ve uluslararası şirketleri bir araya getirmeyi amaçlayan CONNEXT 2020 isimli etkinliğin 27-28 Şubat 2020 tarihlerinde Milano’da gerçekleştirileceği belirtilmektedir. Söz konusu etkinliğin, sanayi birlikleri, ticaret odaları, kamu kurumları, kredi ve finans kuruluşları, üniversiteler, araştırma merkezleri ve her ölçekteki şirketin katılımıyla tecrübe ve görüş paylaşımı imkanı sağlayacağı ve ayrıca şirketlerin ikili görüşmeler gerçekleştirebileceği iletilerek özellikle Afrika, Akdeniz Bölgesi, Doğu ve Orta Avrupa, Rusya ve AB’den yabancı şirketlerin katılımının arzu edildiği bildirilmektedir. Etkinliğe ilişkin detaylı bilgiye https://connext.confindustria.it/2020/international linkinden ulaşılabilmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Pirinç Satışı Hk.
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, pirinç satışı hakkında bilgi aktarılmıştır. Konu ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2020 Yılı Tarım Havzalarında Desteklenecek Ürün Listeleri
Sayın Üyemiz, T.C Tarım ve Orman Bakanlığı tarafından 2017 yılında başlatılan Havza Bazlı Destekleme Modeli kapsamında, Ülkemizde arz açığı bulunan, stratejik öneme haiz, bölgesel önem arz eden, insan beslenmesi - sağlığı ve hayvansal üretim açısından önemli 21 üründe (buğday, arpa, çavdar, çeltik, dane mısır, tritikale, yulaf, mercimek, nohut, kuru fasulye, pamuk, soya, yağlık ayçiçeği, kanola, aspir, çay, fındık, zeytinyağı, patates, soğan (kuru) ve yem bitkileri) mazot-gübre, sertifikalı tohumluk kullanım, fark ödemesi, yem bitkileri, fındık alan bazlı gelir destekleme uygulamaları yürütülmektedir. Bu kapsamda 2020 üretim yılında Tarım Havzalarında desteklenecek ürünlerin belirlenmesi amacıyla; iklim, toprak, topoğrafya, su kısıtı, istatistiki veriler, ekim nöbeti ve il/ilçe müdürlükleri ile STK önerileri birlikte değerlendirilerek ürün listeleri oluşturulmuştur.Hazırlanan listeye ilgili linkten ulaşılabilecektir.www.tarimorman.gov.tr Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO hububat, bakliyat ve pirinç satışı
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, hububat, bakliyat ve pirinç satışı hakkında bilgi aktarılmıştır. Konu ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Yeşil Mercimek Kalibrasyon ve İmalatı İhalesi Hk
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, yeşil mercimek kalibrasyon ve imalat ihalesi hakkında bilgi aktarılmıştır. Ayrıntılı bilgiye ilgili linkten ulaşılabilecektir. www.tmo.gov.tr Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ottava Tic. Müş. Yazısı Hk.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda, Ottava Ticaret Müşavirliğinden alınan bir yazıya atfen, son dönemde giderek artan bir şekilde dolandırıcılık amacıyla bazı internet hesaplarından vatandaşlarımıza yönelik olarak Kanada da çalışmak üzere yüksek ücretli iş tekliflerinin yapıldığı ve akabinde vize veya iş başvuru ücreti adı altında ödeme yapmalarının istendiği belirtilmekte ve vatandaşlarımızın talepleri çerçevesinde yapılan araştırmalar neticesinde bu tür tekliflerin tamamının dolandırıcılık amaçlı olduğunun tespit edildiği ifade edilmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
MİT de Düzenlenecek Avrupa Kariyer Fuarı Hakkında
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda,"Massachusetts Institute of Technology"de (MIT) her yıl düzenlenen Avrupa KariyerFuarı nın yirmi dördüncüsünün 22 Şubat 2020 tarihinde gerçekleştirileceği ve söz konusu fuarın MIT veHarvard Üniversitesi nde eğitimlerini tamamlamak üzere olan öğrencileri iş gücüne katmak isteyen işverenlereönemli bir fırsat sağladığı aktarılmaktadır. Detaylı bilgi içinhttps://euro-career.mit.eduadresini ziyaret ediniz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türk-Türkmen HEK Toplantısı Hakkında
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen yazıda Ekonomik İşbirliğine Dair Hükümetler arası Türk-Türkmen Komisyonu (HEK) 6. Dönem Toplantısının Cumhurbaşkanı Yardımcımız Sn. Fuat Oktay eş başkanlığında 12-13 Şubat 2020 tarihlerinde Aşkabat’ta düzenleneceği belirtilerek, Türkiye-Türkmenistan ilişkilerine dair görüşlere ve varsa karşılaşılan sorunlar ile çözüm önerilerine ilişkin bir bilgi notu talep edilmektedir. Bu çerçevede Türkiye-Türkmenistan ilişkilerine dair görüşlerinizi 31 Aralık 2019 mesai bitimine kadareskisehirtb@tobb.org.tradresine iletmenizi rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ürdün de Düzenlenecek Fuar Hk.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen, yazıdaÜrdün ün başkenti Amman da 15-17 Temmuz 2020 tarihlerinde, 1. Uluslararası Ekonomik Fuar ın (IJEX) düzenleneceği bildirilmektedir. Etkinlikle ilgili bilgiyehttps://ijexjo.comadresinden ulaşabilirsiniz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
IORA Uzmanlar Toplantısı Hakkında
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen, 23.12.2019 tarih, 34221550-720-12634 sayılı yazıda, IORA Uzmanlar Toplantısı duyurulmaktadır. Dışişleri Bakanlığı’nın 18.12.2019 tarih ve 24305451 sayılı yazısına atfen, Madagaskar-Antananarivo Büyükelçiliğimiz aracılığıyla iletilen Notada, Hint Okyanus Kıyıları Birliği (IORA) Bölge İçi Ticaret ve Yatırımı Artırmaya Yönelik Uzmanlar Toplantısı’nın 30-31 Ocak 2020 tarihlerinde, Morityus’ta düzenleneceği bildirilmektedir. Söz konusu etkinliğe ilişkin program, katılım şartları ve diğer bilgilerin yer aldığı notlar ekte iletilmekte olup, etkinliğe son başvuru tarihi 30 Aralık 2019’dur. Başvuru Şartlarıiçin tıklayın Bilgi Formuiçin tıklayın Çalışma Planıiçin tıklayın Kavram Kağıdıiçin tıklayın Kayıt Formuiçin tıklayın Program için tıklayın Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-Nijerya 5. Dönem KEK Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen, 23.12.2019 tarih, 34221550-720-12631 sayılı yazıda, Türkiye-Nijerya Karma Ekonomik Komisyonu 5. Dönem Toplantısı duyurulmaktadır. Ticaret Bakanlığı’nın 20.12.2019 tarih ve 54304773-724.01.02 sayılı yazısına atfen, Enerji ve Tabii Kaynaklar Bakanımız Sayın Fatih DÖNMEZ eşbaşkanlığında gerçekleştirilecek Türkiye-Nijerya Karma Ekonomik Komisyonu 5. Dönem Toplantısının 29-30 Ocak 2020 tarihlerinde Ankara’da düzenlenmesinin planlandığı bildirilmektedir. Bu çerçevede, söz konusu toplantı sonunda imzalanacak olan Tutanak metnine eklenecek metin önerilerinizin en geç 30 Aralık 2019 Pazartesi günü mesai saati bitimine kadar Türkiye Odalar ve Borsalar Birliği’ne (Sedan Gedik,seda.gedik@tobb.org.tr) iletilmesi gerekmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-Zambiya Karma Ekonomik Komisyon (KEK) 1. Dönem Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen, 23.12.2019 tarih, 34221550-720-12633 sayılı yazıda, Türkiye-Zambiya Karma Ekonomik Komisyon (KEK) 1.Dönem Toplantısı duyurulmaktadır. Söz konusu duyuruda, Ticaret Bakanlığı’nın 19.12.2019 tarih, 50584169 sayılı yazısına atfen, Türkiye-Zambiya Karma Ekonomik Komisyon 1. Toplantısı’nın, 12-13 Şubat 2020 tarihlerinde Zambiya’nın başkenti Lusaka’da gerçekleştirilmesinin planlandığı, iki ülke arasındaki ilişkilere yönelik olarak Türkiye Odalar ve Borsalar Birliği’nin görev ve yetki alanına giren konular ile toplantıda gündeme getirilmesinde fayda görülen hususları içeren bir bilgi notu talep edildiği belirtilmiştir. Bu çerçevede, Türkiye-Zambiya ilişkilerine dair görüşlerinizi, 08 Ocak 2020 mesai saati bitimine kadareskisehirtb@tobb.org.tradresine iletmenizi rica ederiz.Bilgilerinize rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, TOBB’nin girişimleriyle VERBİS e kayıt süresi uzatılmıştır. VERBİS’e kayıt ve bildirim gerçekleştiren veri sorumluları ile envanter hazırlama süreçlerini tamamlayamadığı için süresinde kayıt ve bildirim yükümlülüğünü yerine getiremeyecek olan veri sorumluları dikkate alınarak, VERBİS’e girilmiş olan bilgilerde herhangi bir hata veya Kanuna aykırılık varsa bu durumun bir an önce düzeltilmesi için gerekli çalışmaların yapılabilmesini teminen 6698 sayılı Kanunun Geçici 1 inci maddesi gereği; Yıllık çalışan sayısı 50’den çok veya yıllık mali bilanço toplamı 25 milyon TL’den çok olan gerçek ve tüzel kişi veri sorumlularına Sicile kayıt ve bildirim yükümlülüğünü yerine getirmeleri için verilen sürenin 30.06.2020 tarihine, Yurt dışında yerleşik gerçek ve tüzel kişi sorumlularına Sicile kayıt ve bildirim yükümlülüğünü yerine getirmeleri için verilen sürenin 30.06.2020 tarihine, Yıllık çalışan sayısı 50’den az ve yıllık mali bilanço toplamı 25 milyon TL’den az olup ana faaliyet konusu özel nitelikli kişisel veri işleme olan gerçek veya tüzel kişi sorumlularına Sicile kayıt ve bildirim yükümlülüğünü yerine getirmeleri için verilen sürenin 30.09.2020 tarihine, Kamu kurum ve kuruluşu veri sorumlularına Sicile kayıt ve bildirim yükümlülüğünü yerine getirmeleri için verilen sürenin 31.12.2020 tarihine, kadar uzatılmasına, Bu kararın Kurum internet sayfasında duyurulması ve Resmî Gazete’de yayımlanmasına karar verilmiştir. Ayrıntılı bilgiyehttp://bit.ly/2rwy1Qh adresinden ulaşılabilecektir. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazete Hububat ve Bakliyat Hakkında Karar
Sayın Üyemiz; Hububat ve Bakliyat ithalatında tarife kontenjanı uygulaması hakkında kararda değişiklik yapılmasına ilişkin Resmi Gazetede yayınlanan Cumhurbaşkanlığı Kararına ilgili linkten ulaşılabilecektir. Karar Sayısı: 1835 Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.Tüketici Ödülleri İlanı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği (TOBB) aracılıyla alınan Ticaret Bakanlığı Tüketicinin Korunması ve Piyasa Gözetimi Genel Müdürlüğü’nün 20.11.2019 tarih, 46831714-403-E-00049600836 sayılı yazılarında; tüketici bilincini geliştirmek ve bu yönde hak arama alışkanlıklarını yaygınlaştırmak, tüketici haklarına saygılı kişi, kurum ve kuruluşları teşvik etmek, tüketicinin korunması ve bilinçlendirilmesi ile ilgili bilimsel çalışmaları özendirmek amacıyla, “Bilinçli Tüketici Ödülü,” Yazılı Basın Tüketici Ödülü”, “Radyo-Televizyon Programı Ödülü”, Tüketici Memnuniyetini İlke Edinen Firma Ödülü”, “Bilimsel Çalışma Ödülü”, ve “Tüketici Özel Ödülü” dallarında her yıl hak sahiplerine verilen Tüketici Ödülleri’nin bu yıl 23’ncüsü verileceği belirtilmektedir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Ek: 23. tüketici ödülleri ilanı Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; TMO Fındık, kuru üzüm ve kuru incir alımları hakkında ayrıntılı bilgiye ilgili linkten ulaşılabilecektir. www.tmo.gov.tr Saygılarımızla.
Danışmanlık Hk.
Sayın Üyemiz ; Borsamiz Kadin Girisimciler İl Icra Kurulu Üyesi SMMM Serap Yildirim, 509 sayili VUK tebligi ( e-Fatura, E-Ticaret ve e-Arsiv) kapsaminda her Çarsamba gunu 10-13 saatleri arasi Borsamiz danismanlik ofislerinde ucretsiz bilgilendirme ve danismanlik hizmeti verecektir. Bilgilerinize sunulur Saygılarımızla
Eskişehir Büyükşehir Belediyesi İlan
Sayın Üyemiz, Eskişehir Büyükşehir Belediyesi nden Borsamıza gönderilen ölçü ve tartı aletleri hakkında ilan ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; TMO Genel Müdürlüğünden yapılan kamuoyu açıklaması ve ayrıntılarına aşağıdakiadresinden ulaşılabilecektir. www.tmo.gov.tr Saygılarımızla.
Sayın Üyemiz, S.S. Eskişehir Pancar Ekicileri Kooperatifinden Borsamıza iletilen"Hububat Satışı"konulu yazılar ektedir. İlgilenen üyelerimizin bilgisine sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Cibuti Özel Ekonomik Bölgesi Toplantısı hk.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza iletilen 03.12.2019 tarih ve 11931 sayılı yazıda; Son dönemde Türkiye ve Cibuti arasında siyasi ve ekonomik ilişkilerin hızla geliştiği, bu kapsamda, Cibuti de Türk firmalarının Afrika ya yönelik ihracatlarında stratejik bir açılım noktası olarak değerlendirilebilecek bir Özel Ekonomi Bölgesi (ÖEB) kurulmasına yönelik çalışmaların 2014 yılında başlatıldığı ve ÖEB ye arazi tahsisine ilişkin Protokol 2015 yılında imzalandığı belirtilmiştir. Yazıda devamla, Cibuti Cumhurbaşkanının 19 Aralık 2017 tarihinde ülkemize gerçekleştirdiği resmi ziyaret sırasında, Cumhurbaşkanlığı Makamı nın konuya ilişkin çalışmalara TOBB’un da iştirak etmesi yönündeki talimatı alındığı bildirilerek, bu itibarla, T.C. Ticaret Bakanlığı, TOBB ve TEPAV yetkililerinden müteşekkil bir heyet, 24-27 Aralık 2018 tarihleri arasında Cibuti ye bir ziyaret gerçekleştirdiği, ziyaretin akabinde TEPAV tarafından bir değerlendirme raporu hazırlandığı belirtilmektedir. Son olarak, 16 Eylül 2019 tarihinde Cibuti nin Ankara Büyükelçisi Aden Houssein ABDİLLAHİ ve TOBB ETÜ Rektörü Prof. Dr. Güven SAK, Bakan Yardımcısı Sayın Rıza Tuna TURAGAY ı makamında ziyaretlerinde projenin Türk iş adamlarına tanıtılmasına yönelik olarak bir toplantı düzenlenmesi kararlaştırıldığı aktarılmaktadır. Bu çerçevede, T.C. Ticaret Bakanlığı’nın yazısına atfen, 17 Aralık 2019 tarihinde Ankara da (Ticaret Bakanlığı Söğütözü Yerleşkesi 3. Kat Toplantı Salonu, saat 14.00 da) Ticaret Bakan Yardımcısı Sayın Rıza Tuna TURAGAY başkanlığında ilgili kurum ve Cibuti Özel Ekonomi Bölgesi ne ilgi duyan ve yatırım yapmak isteyen firmalarının katılımıyla bir toplantının düzenleneceği bildirilmektedir. Bu itibarla, söz konusu toplantıya katılmak isteyen üyelerimizin 10 Aralık 2019 mesai saati bitimine kadar Türkiye Odalar ve Borsalar Birliği’ne (Anara Daylan,anara.daylan@tobb.org.tr) bilgi vermesi gerekmektedir. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Cezayir ile Ticaretimizde Yaşanan Sorunlar ve Çözüme İlişkin Değerlendirmeler
Sayın Üyemiz, İlgi: Türkiye Odalar ve Borsalar Birliğinden Borsamıza iletilen 29.11.2019 tarih ve 11867 sayılı yazıda; Ticaret Bakanlığı tarafından, Türkiye Odalar ve Borsalar Birliğinin görüşlerinin de yer aldığı, Cezayir ileolan ticaretimizde yaşanan önemli sorunlar ve bu sorunlara ilişkin çözüm önerilerini içeren bir bilgi notuiletilmektedir. Not ekte bilgilerinize sunulmuştur. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinin 28.11.2019 tarih ve 11794 sayılı yazısı ile Borsamıza iletilen ve Toprak Mahsulleri Ofisi Genel Müdürlüğü’nün yazısında ELÜS satışı uygulamalarına dair şu bilgilere yer verilmektedir; Bilindiği üzere, TMO Genel Müdürlüğü’nün 2018-2019 satış döneminde Elektronik Ürün Senetli (ELÜS) stoklarının şartlı satış işlemi web tabanlı "TMO ELÜS SATIŞLARI" platformu üzerinden yapılmakta ve takas işleminin gerçekleştirilmesi için emirler ticaret borsalarına gönderilmekteydi. ELÜS lerin tek bir borsa çatısı altında işlem görebilmesini teminen 2018 yılında kuruluşu gerçekleştirilen Türkiye Ürün İhtisas Borsası A.Ş. (TÜRİB), 26.07.2019 tarihinde faaliyete geçmiştir. TÜRİB in faaliyete geçmesini takiben,Ticaret BorsalarınınELÜS eilişkin borsacılık faaliyetlerini gerçekleştirme yetkisi sona ermişolup tüm ELÜS işlemleri TÜRİB bünyesinde gerçekleştirilmeye başlanmıştır. ELÜS lerin alım-satın işlemleri, yatırımcılar tarafından aracı olmaksızınwww.turib.com.trinternet adresinde yer alan "TÜRİB İşlem Platformu" üzerinden doğaldan emir girmek suretiyle yapılmaktadır. 5300 sayılı Tarım Ürünleri Lisanslı Depoculuk Kanunu ve ilgili mevzuat hükümleri ile 10.08.2017 tarih ve 30150 sayılı Resmi Gazete’de yayımlanan Ürün İhtisas Borsalarının Kuruluş, Faaliyet, İşleyiş, Denetim Usul ve Esasları Hakkında Yönetmelik gereğince2019-2020 satış döneminden itibaren Kuruluşumuz ELÜS Satışları TÜRİB üzerinden gerçekleştirilecektir. TMO ELÜS SATIŞLARI platformu üzerinden gönderilen anlaşmalı özel emirler satış işleminin gerçekleştirilmesi için TÜRİB e gönderileceğindenTMO ELÜS SATIŞLARI platformu üyelerimizin ELÜS alım işlemlerine devam edebilmesi için TÜRİB e kayıt olması gerekmektedir. Yatırımcıların TÜRİB e kaydı için Ticaret Borsaları ile TÜRİB arasında acentelik ilişkisi tesis edilmiştir. Çiftçiler de dahil olmak üzere tüm yatırımcıların TÜRİB sistemine kavdı TÜRİB acentesisıfatıylahizmet veren ticaret borsaları tarafından ücretsiz yapılmaktadır.Kayıt için istenilen belgelere ait bilgilereticaret borsalarındanveyahttps://www.turib.com.tr/acenteler.aspxadresinden ulaşılabilir. Kayıt aşamasında verilecek hesap bilgisi "ELÜS Alış İşlemi Gerçekleştirebilen Takas Üyesi Aracı Kurum / Bankalar" nezdindeki hesap bilgisi olmalıdır. Bu banka ve aracı kurumların listesine"https://www.turib.com.tr/takas-uyeleri.aspx"adresinden ulaşılabilir. Söz konusu hesabın ELÜS saklama özelliği taşıması için ilgili aracı kurum/banka tarafından Merkezi Kayıt Kuruluşu nezdinde de tanımlama yapılması gerektiğinden yatırımcıların banka/aracı kurumlarını bu konuda uyarması önem arz etmektedir. TÜRİB de resmi tatil günleri haricinde hafta içi tam çalışma günlerinde 10:00-12:00 saatleri arasında ELÜS işlemlerini gerçekleştirmek mümkündür. TMO tarafından onaylanan anlaşmalı özel emirler, saat 09:30 da TÜRİB İşlem Platformu na aktarılacaktır.TMO nun TÜRİB İşlem Platformu na gönderdiği satış emirlerine alıcı (kişi, kuruluş ve firmalar tarafından onay verildikten sonra anlaşmalı özel emir işlemleri gerçekleştirilecektir.Gerçek veya tüzel kişiler, TÜRİB İşlem Platformu na kaydettirdikleri kendileri veya temsilcilerinin cep telefonuna gelen şifre ve doğrulama kodları üzerinden TÜRİB İşlem Platformu na giriş yaparak onay vereceklerdir. Onay işlemleri, TÜRİB İşlem Platformu üzerinde”TMO İşlemleri”menüsü altında yer alan"TMO Satış Emri Onay Listesi"nden yapılacaktır. Gerçek ve tüzel kişi yatırımcıların onay aşamasında, Elektronik Kayıt Kuruluşu ve Takas Merkezi Üyesi aracı kurum/bankalarında ELÜS saklaması için tanımlı hesaplarını seçmelerigerekmektedir. Eğer tek bir hesap tanımlı ise, hesap seçmeye gerek olmadan"TMO Satış Emri OnayListesindeki "işlem" sütunu altındaki ilgili işlem satırındaki yeşil "onay" işaretini seçmeleri yeterli olacaktır. Alıcı tarafından onay verildikten sonra alıcı hesabındaki ELÜS bedeli TL tutarı ilgili banka/aracı kurum hesabından otomatik sorgulanacağından alıcı tarafınbakiyesinin yetersiz olması durumundaTMO tarafından girilen satış emirleriyle ilgili işlemlere alıcı tarafından onay verilse dahi iptal edilmiş olarak görünecektir. Bu nedenle alıcıların, satın alacakları ELÜS’lere ilişkin (TMO nun satış emirlerini TÜRİB platformuna gönderdiği gün 10:00-12:00 saatleri arasında) alım emrini TÜRİB İşlem Platformuna girerek onaylaması ve ELÜS bedelinialım emrini sisteme girmeden öncebanka/aracı kurum nezdindeki hesaplarına yatırması esastır. Alıcının alım emrini onaylamaması, onaylasa dahi banka/aracı kurum nezdindeki hesabında yeterli bedel bulunmaması durumunda satış emri ve TMO Genel Müdürlüğünce yapılan firma tahsisi iptal edilecektir. Bilgilerinize önemle sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Toprak Mahsulleri Ofisi Eskişehir ŞubeMüdürlüğündenBorsamıza iletilen“ELÜS ve İthal Ürün Satışı”konulu yazıda şu bilgilere yer verilmektedir; Bilindiği üzere Kuruluşumuzun Elektronik Ürün Senetli (ELÜS) stoklarının şartlı satış işlemi web tabanlı"ELÜS SATIŞLARI"platformu üzerinden yapılmaktadır. Aralık 2019 tarihinden itibaren ELÜS satışlarına ek olarak ithal ürünlerin satışları da aynı platform üzerinden gerçekleştirilecektir. Söz konusu platformun ismi bu tarihten itibaren"TMO ELEKTRONİK SATIŞ PLATFORMU"olarak değiştirilmiştir. Kullanıcılar yeni platforma aynı mail adresleri ve şifreleri ile giriş yapabileceklerdir. Platforma ilk defa üye olacak kişi ve firmaların; internet üzerinden üye olması, üyeliğini ve üye olurken girdiği bilgilerin doğruluğunu hinterlandında bulunduğu TMO Şube Müdürlüğüne giderek onaylatması gerekmektedir. Her firma sisteme bir kez üye olabilecek, bu üyelik ise firma içerisinde bir kişi ile sınırlı tutulacaktır. Sistemde üyelerin sektör ayrımı ve fiili tüketim takibi yapılacağından üyelik aşamasındaki bilgilerin(fiili tüketim, ihracat miktarı, adres beyanı, fabrika sayısı vb.)doğru bir şekilde girilmesi önem taşımaktadır. Sisteme kayıt ve talep oluşturma işlemleri direkthttps://ticaret.tmo.gov.trlinkinden veyahttp://www.tmo.gov.trsayfasındaki"TMO ELEKTRONİK SATIŞ PLATFORMU"kısa yol sekmesinden girilmek suretiyle yapılacaktır, Oluşturulan web tabanlı platform üzerinden 01 Aralık - 06 Aralık 2019 tarihleri arasındaELÜS ve İTHAL (liman şube müdürlükleri ve işyerlerinde bulunan stoklar)makarnalık buğday, ekmeklik buğday ve arpa satışı yapılacaktır. ELÜS satışlarından; TMO Elektronik Satış Platformuna ve satışların takas ile ciro işlemlerinin yapılacağı Türkiye Ürün İhtisas Borsası A.Ş. ne (TÜRİB) üye olan ilgili firmalar yararlanacaktır. İthal ürün satışlarına başvuru için ise sadece TMO Elektronik Satış Platformuna üyelik yeterli olacaktır. Makarnalık Buğday stoklarına; - Makama fabrikaları, - Üretiminde makarnalık buğday kullanan bulgur fabrikaları - İrmik, Şehriye fabrikaları, Ekmeklik Buğday stoklarına; •Un fabrikaları •Üretiminde ekmeklik buğday kullanan bulgur fabrikaları •Bisküvi fabrikaları Düşük Vasıflı Ekmeklik Buğday stoklarına; Un fabrikaları Bisküvi fabrikaları Arpa stoklarına; Besici ve yetiştiriciler Yem fabrikaları, müracaat edebilecektir. Platform üzerinden satışa açılacak stok miktarları; ELÜS: •Ekmeklik Buğday 7.549 Ton •Makarnalık Buğday 1.339 Ton •Arpa 5.348 Ton (Sadece besici ve yetiştiricilere) İTHAL ÜRÜN (LİMAN STOKLARI): •Ekmeklik Buğday 239.391 Ton •Makarnalık Buğday 55.000 Ton •Arpa 40.500 Ton(Sadece besici ve yetiştiricilere) •Arpa 50.000 Ton(Sadece yem fabrikalarına) Başvurular 01 Aralık Cumartesi Günü 13.00 de başlamış olup, 06 Aralık Cuma günü ithal ürün başvurulan Saat 13.00 da, ELÜS başvuruları ise saat 16.00’da sona erecektir. BaşvurularTMO Elektronik Satış Platformuüzerinden alınacak olup başvuru yapacak firmalar platform üzerinden"Güncel Satış Listesi"veya"Menü"kısmından satış listelerine ulaşıp, tekliflerini girerek ELÜS ve İthal ürün başvuru işlemlerini tamamlayacaklardır. Dağıtım sonuçlan 10 Aralık tarihinde yine platform üzerinden talep eden firmalarca görülebilecektir. ELÜS tahsis sonuçları takas ve ciro işlemlerinin yapılabilmesi için 11 Aralık tarihinde Türkiye Ürün İhtisas Borsası A.Ş. ne (TÜRİB) gönderilecektir. TMO Elektronik Satış Platformu üzerinden yapılan ithal ürün satışları ise tahsislerin görülmesini müteakip 25.12.2019 tarihine kadar TMO hesaplarına para yatırılmak sureti ile teslim alınabilecektir. Bilgilerinize önemle sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Suriye ye Un Hibesi İhalesi
Hububat Satış Hk.
Sayın Üyemiz, S.S. Kütahya Pancar Ekicileri Kooperatifinden alınan "Hububat Satışı" konulu yazı ektedir. İlgili üyelerimizin bilgilerine sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Dökme Kavrulmuş Fındık Toptan Satışı
Sayın Üyemiz, TMO Eskişehir Şube MüdürlüğündenBorsamıza iletilen"Dökme Kavrulmuş Fındık Toptan Satışı"konulu yazıda; Kavrulmuş iç fındıkların dökme olarak toptan satışa açıldığı belirtilerek, satışa açılan dökme kavrulmuş fındıkların ilave nakliye ve manipülasyondahil, KDV hariç olmak üzere45,00 TL/kg lıkambalajlardan daha düşük miktarlı ambalajlarıntalep edilmesi durumunda imalat durumuna göre değerlendirileceği bildirilmiştir. Yazıda devamla, şube müdürlüğüne bildirilen talepler doğrultusunda oluşturulan teslimat programı çerçevesinde teslimatlar yapılacağı belirtilmiş olup, ilgilenen firmalarınbilgilerine sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Eskişehir Masal Yarışması Hk.
Sayın Üyemiz, T.C. Eskişehir Valiliği – İl Kültür ve Turizm Müdürlüğünden Borsamıza iletilen 26.11.2019 tarih ve 972611 sayılı yazıda; Kültür ve Turizm Bakanlığınca 3-5 Mart 2017 tarihleri arasında İstanbul’da düzenlenen“III. Milli Kültür Şurası” sonucunda hazırlanan eylem planının “12. Çocuk ve Kültür” bölümünün 6. maddesi ile okul öncesine yönelik yeni ve özgün masal metinleri yazılmasını teşvik amacıyla yerel düzeyde masal yarışması düzenlenmesi hedeflendiği, Bakanlık Araştırma ve Eğitim Genel Müdürlüğü sorumluluğunda 2019 yılında çalışmalara başlanılan söz konusu eylemin gerçekleştirilebilmesi için İl Kültür ve Turizm Müdürlükleri ile yerel yönetimler ilgili birim olarak görevlendirildiği belirtilmiştir. Bu bağlamda, hedef eylem planı doğrultusunda İl Kültür ve Turizm Müdürlüğü tarafından okul öncesine yönelik“Bin Masal, Bir Şehir Anlat Eskişehir”başlıklı masal yarışması düzenlenmiş olup, yarışmaya ilişkin başvuru formu ve şartname ekte bilgilerinize sunulmuştur. Yarışmaya ilişkin detaylı bilgiyehttps://eskisehir.ktb.gov.trlinkinden de ulaşabilirsiniz. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğünden mahsül buğday satış ihalesi ile ilgili ayrıntılı bilgiye aşağıdaki adresten ulaşılabilecektir https://www.tigem.gov.tr . Saygılarımızla.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden Borsamıza iletilen 19.11.2019 tarih ve 11529 sayılı ulaşan yazıda; Ticaret Bakanı Sayın Ruhsar Pekcan ın, önümüzdeki dönemde Tunus ve Fas ı ziyaret ederek mevkidaşları ile görüşmeler gerçekleştirmesinin öngörüldüğü belirtilmekte olup, söz konusu görüşmelerde faydalanmak üzere TOBB dan bilgi notları talep edildiği bildirilmiştir. Konu hakkındaki görüşlerini belirtmek isteyen üyelerimizin 29 Kasım 2019 tarihine kadar Türkiye Odalar ve Borsalar Birliğine gönderilmek üzere, Borsamıza e-mail (eskisehirtb@gmail.com) ile bildirmeleri gerekmekte olup, tüm ilgili üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye Kooperatifler Fuarı
Sayın Üyemiz; Ticaret Bakanlığı Esnaf, Sanatkarlar ve Kooperatifçilik Genel Müdürlüğü’nden Birliğimize intikal eden ve ekte yer alan 95330207-253 sayılı yazıda; ülkemizdeki kooperatifçiliğin geliştirilmesi, kooperatif ürünlerinin tanıtımı ve amacıyla 5 – 8 Aralık 2019 tarihlerinde, Ankara Ticaret Odası Congresium Kongre ve Sergi Merkezinde “3. Türkiye Kooperatifler Fuarı”nın düzenleneceği belirtilmektedir. Saygılarımızla.
Sudan İnsani Yardım Kampanyası
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelenyazıda, 2019 yılı Ağustos ayından bu yana Sudan genelini etkisi altına alan şiddetli yağışlar nedeniyle, özellikle Nil Havzasında bulunan bölgelerde meydana gelen sel ve su baskınları sebebiyle yüzbinlerce insanın can güvenliği, açlık, susuzluk, barınma ve salgın hastalık sorunları ile karşı karşıya bulunduğu ifade edilmektedir. Bu kapsamda, Sudan daki krizi teskin etmek amacıyla, 23 Ekim 2019 tarih 1692 sayılı Cumhurbaşkanlığı Kararı ile Sudan İnsani Yardım Kampanyası nın başlatıldığı bildirilmektedir. 23 Ekim 2019 tarih 1692 sayılı Cumhurbaşkanlığı Kararı, afiş örnekleri ve banka hesap bilgileri İçişleri Bakanlığı https://www.afad.gov.tr/sudan-yardim-kampanyasi web sitesinden temin edilmektedir. Bilgilerinize sunarız. Saygılarımızla,
Arnavutluk Özel Sektör Heyeti Programı, 1-3 Aralık 2019
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelenyazıda, Tiran Büyükelçiliğimiz, Arnavutluk Ticaret ve Sanayi Odaları Birliği (UCCIAL) ve Arnavutluk-Türk Ticaret ve Sanayi Odası (ATTSO) işbirliğinde, 2 Aralık 2019 tarihinde Arnavutluk un başkenti Tiran da, "Arnavutluk-Türkiye Ekonomi ve Yatırım Konferansı" düzenlenecektir. Foruma Türk ve Arnavut özel sektör temsilcilerinin yanı sıra, üst düzey hükümet temsilcilerinin ve akademisyenlerin katılımı beklenmektedir. Bu çerçevede, Birliğimizce, söz konusu Foruma katılmak üzere, 1-3 Aralık 2019 tarihlerinde, Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu başkanlığında, Arnavutluk-Tiran a yönelik bir Özel Sektör Heyeti Ziyaret Programı düzenlenmektedir. Forum kapsamında gündeme alınacak öncelikli sektörler enerji, altyapı, tarım ve turizm olarak tespit edilmiş olup, ikili iş görüşmelerinde Türk ve Arnavut özel sektör katılımcıları bu kapsamda görüşmeler gerçekleştirme fırsatı bulabileceklerdir. Ziyarete ilişkin program ve katılım formu arnavutluk.tobb.org.tr adresinde yer almaktadır. Ziyarete katılmak isteyen firma temsilcilerinin konaklama, uçak, transferler, yemek vb. organizasyon giderlerini karşılamak üzere, Birliğimizce görevlendirilen GOLDENBAY TURİZM YATIRIMLARI A.Ş. nin Türkiye İş Bankası Şişli Ticari Şubesi, TR10 0006 4000 0011 3980 0311 76 IBAN numaralı Türk Lirası hesabına 9.500,- Türk Lirası ön avans bedeli ödemeleri gerekmektedir. Katılım bedelinin kesinleşmesini takiben, bakiye tutar ziyaret öncesinde katılımcılardan talep edilecektir. Firma temsilcilerinin arnavutluk.tobb.org.tr adresinde yer alan başvuru formunu doldurduktan sonra yüksek çözünürlüklü "jpeg" formatında bir fotoğraf ve pasaportun renkli kısmı ile ödeme yaptıklarına dair dekontu arnavutluk@tobb.org.tr adresine iletmeleri beklenmektedir. Bilgilerinize sunarız. Saygılarımızla,
Sayın Üyemiz; TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğünden mahsül buğday satış ihalesi ile ilgili ayrıntılı bilgiye aşağıdaki adresten ulaşılabilecektir https://www.tigem.gov.tr . Saygılarımızla.
Türkiye-Almanya Tarım Yürütme Komitesi 23. Dönem Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelenyazıda,Tarım ve Orman Bakanlığından alınan 04.11.2019 tarihli ve 3378708 sayılı yazına istinaden, "Türkiye Cumhuriyeti Tarım ve Orman Bakanlığı ile Almanya Federal Cumhuriyeti Gıda ve Tarım Federal Bakanlığı Arasında Tarım Alanında Mutabakat Zabtı" kapsamında düzenlenen Tarım Yürütme Komitesinin (TYK) 23. Dönem Toplantısının 9 Aralık 2019 tarihinde Ankara da düzenleneceği belirtilmekte ve bu toplantı çerçevesinde Almanya ile tarımsal ticarette karşılaştığımız sorunları ve çözüm önerilerini, görüşmelerde gündeme getirilmesinde yarar görülen hususlara ilişkin bilgileri içeren bir bilgi notu talep edilmektedir. Görüşlerinizi en geç 18 Kasım 2019 Pazartesi günü saat:15:00’a kadar Borsamıza iletilmesini rica ederiz Saygılarımızla.
Sayın Üyemiz, Resmi Gazetenin 1770 sayılı kararında, ihracatçılara hususi damgalı pasaport verilmesine ilişkin esaslar hakkında kararda değişiklik yapılmasına dair ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla.
Incoterms 2020 Mena Bölgesi Açılış Zirvesi - 5 Aralık 2019, Fairmont Quasar Otel, İstanbul Hk.
Sayın Üyemiz, Türkiye Milletlerarası Ticaret Odası ndan gelenyazıda,5 Aralık 2019 tarihinde Fairmont Quasar Otel İstanbul’daMilletlerarası Ticaret Odası (International Chamber of Shipping –ICC) Türkiye Milli Komitesi tarafından uluslararası ticarette kullanılan, evrensel olarak standartlandırılmış ve malların satışı için dünya çapında kabul gören kuralları belirleyen“INCOTERMS 2020’nin MENA Bölgesi Açılış Zirvesi”ningerçekleştirileceği bildirilmektedir. İngilizce – Türkçe simültane tercümenin mevcut olduğu belirtilen bahse konu etkinliğe kayıt formununhttp://icc.tobb.org.tr/incoterms2020trinternet adresindenen geç 2 Aralık 2019 tarihine kadar doldurulmasıve kaydın tamamlanmasını teminen kayıt ücretinin belirtildiği şekilde ödenerek dekontun ICC-TR Milli Komitesine faks (0312 219 42 58) ya da e-posta yolu ile (icc-tr@tobb.org.tr) bildirilmesi talep edilmektedir. Saygılarımızla.
Türkiye-Katar İş Forumu, 21 Kasım 2019, İstanbul
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelenyazıda, TOBB ve Katar Odası tarafından Türkiye-Katar İş Forumu düzenlenecektir. Forum, Katar Başbakanı Abdullah bin Nasser bin Khalifa Al Thani’nin himayelerinde 21 Kasım 2019 Perşembe günü İstanbul’da gerçekleştirilecektir. Türkiye-Katar İş Forumu’na çeşitli sektörlerden yaklaşık 70 Katarlı firma ile yatırım, hukuk, sanayi, ulaştırma-lojistik, serbest bölgeler konularında önde gelen Katarlı bürokratın katılımı beklenmektedir. Türkiye ile Katar arasındaki ticaret hacmi 2018 sonunda, 2,5 milyar Dolar’a yaklaşmıştır. Müteahhitlik firmalarımızın bugüne kadar Katar’da üstlendikleri projelerin değeri 17 milyar Dolar düzeyindedir. 2022 Dünya Kupası ve 2030 Katar Ulusal Vizyonu çerçevesinde gerçekleştirilmesi gündemde olan alt ve üstyapı projeleri firmalarımız için yeni fırsatlar barındırmaktadır. Ülkemizde önemli yatırımları olan Katar sermayesinin Türkiye’ye ilgisi artmaktadır. Forum programının sonunda, Türk ve Katarlı firmalar arasında ikili görüşmeler gerçekleştirilmesi imkânı olacaktır. Katarlı firmaların listesi katılım teyidi veren firmalara bilahare iletilecektir. Söz konusu İş Forumuna katılım için firma temsilcilerinin, 20 Kasım 2019 tarihine kadarkatarforum.tobb.org.tradresinde yer alan başvuru formunu doldurmaları gerekmektedir. Konuyla ilgili detaylı bilgi için Sn.Kaan Gaffaroğlu (kaan.gaffaroglu@tobb.org.tr) ile irtibata geçebilir. Saygılarımızla.
Sayın Üyemiz; Et ve Süt Kurumu dondurulmuş tavuk eti satışı ile ilgili ayrıntılı bilgiye aşağıdaki adresten ulaşılabilecektir. https://www.esk.gov.tr/tr/13924/Yeni-Dondurulmus-Govde-Tavuk-Dondurulmus-Tavuk-Gogus-Eti-ve-Dondurulmus-Ucsuz-Tavuk-Kanat-Urunleri-Satisi-Yapilacaktir Saygılarımızla,
Sayın Üyemiz; TİGEM Polatlı Tarım İşletmesi Müdürlüğünden mahsül buğday satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla,
Sayın Üyemiz, TİGEM Gökhöyük Tarım İşletmesi Müdürlüğünden sellektöraltı buğday satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla.
Sayın Üyemiz, TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğünden mahsül buğday satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla.
Sayın Üyemiz; TMO tarafından yapılan Kamuoyu açıklaması ekte bilgilerinize sunulmuştur. Saygılarımızla.
Libya Ekonomi ve Yatırım Forumu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelenyazıda, Libya Planlama Bakanlığı, Fas Sanayi Ticaret ve Yatırım ve Dijital Ekonomi Bakanlığı himayesinde 1. Libya Ekonomi ve Yatırım Forumu nun (LEIF) Libya Ticaret ve Sanayi Odaları Birliği (GUCC) tarafından 11-12 Kasım 2019 tarihlerinde Fas ın Rabat şehrinde gerçekleştirileceği bildirilmektedir. Yazıda devamla, anılan etkinliğe Libya Ulusal Petrol Şirketi (NOC), Libya Yatırım Otoritesi (LIA) ve Libya Konut ve Kamu Hizmetleri Uygulama Otoritesi nin katılım sağlayacağı, etkinliğin Libya yatırımlarının potansiyelini belirlemek, yerel ve uluslararası şirketler hakkında daha fazla bilgi edinmek ve onlarla işbirliği yapmak için fırsatlar sunduğu kaydedilmektedir. Söz konusu etkinliğe ilişkin ayrıntılı bilgi www.leif.ly adresinden temin edileceği gibi info@leif.ly e-posta adresi ile temas kurularak da sağlanabilir. Saygılarımızla.
Türk Kırgız İş Forumu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden alınan yazıda, Türkiye Kırgız Cumhuriyeti 9. Dönem Karma Ekonomik Komisyon Toplantısı vesilesiyle Türk – Kırgız İş Forumu düzenleyecektir. 22 Kasım 2019 tarihinde Birlik Merkezinde gerçekleştirilecek "İş Forumuna", Cumhurbaşkanı Yardımcımız Sn. Fuat Oktay ve Kırgız Cumhuriyeti Başbakan Yardımcısı Sn. Kubatbek Boronov iştirak ederek, katılımcılara hitap edecektir. Türkiye ve Kırgızistan arasındaki ticaret hacminin, ülke ekonomisinin büyüyeceği beklentilerine dayanarak yakın bir dönemde 1 milyar dolar seviyesine çıkartılması hedeflenmektedir.2018 yılında Kırgızistan a ihracatımız bir önceki yıla göre % 9,8 oranında artmış ve 377,2 milyon dolar seviyesinde gerçekleşmiştir. Kırgızistan da ulaştırma altyapısı, telekomünikasyon, hidroelektrik, hidrokarbon sanayi, mineral, metal ve kıymetli taş madenciliği, tekstil, gıda işleme, tarım (buğday, tütün, bakliyat v.s.) ambalaj sanayi ve turizm sektörlerinde yatırım olanakları bulunmaktadır. Taslak Programı ekte sunulan söz konusu İş Forumuna katılım için firma temsilcilerinin kirgizistan.tobb.org.tr adresinde yer alan başvuru formunu doldurduktan son katılım teyitlerinin en geç 20 Kasım 2019 tarihine kadar TOBB a (kirgizistan@tobb.org.tr ) bildirmeleri gerekmektedir. Saygılarımızla.
2019 Yılında Yapılacak Tarımsal Desteklemelere İlişkin Karar
Sayın Üyemiz, "2019 Yılında Yapılacak Tarımsal Desteklemelere İlişkin Karar"ın yürürlüğü konulmasını teminen alınan Cumhurbaşkanı Kararı, 24.10.2019 tarih ve 30928 sayılı Resmi Gazete de yayınlanmıştır. Çevreye duyarlı tarımsal üretimi yaygınlaştırmak, verimi ve kaliteyi yükseltmek amaçlarıyla yayınlanan söz konusu Karara göre; Havza Bazlı Fark Ödemesi Kütlü Pamuk ta Kg başına 80 kr, Zeytinyağında 80 kr, Buğday, Arpa, Yulaf, Çavdar ve Tiritikale de 10 kr olarak belirlenmiştir. Ayrıca, anılan Karar kapsamında mazot ve gübre destekleme ödemeleri de belirlenmiştir. Buna göre Çeltik, Kütlü Pamuk ta dekara Mazot desteği 62 TL, Gübre desteği 4 TL ; Zeytin de Mazot desteği 15 TL, Gübre desteği 4 TL olarak belirlenmiştir. Anılan karar ekte bilginize sunulmuştur. Saygılarımızla.
Sayın Üyemiz; TİGEM Gözlü Tarım İşletmesi Müdürlüğünden mahsül buğday satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla.
Sayın Üyemiz; TMO tarafından mısır satışı hakkındaki kamuoyu açıklaması ekte bilgilerinize sunulmuştur. Saygılarımızla.
Bitkisel Üretim Desteklerinde Münavebe Uygulamaları
Sayın Üyemiz; Eskişehir Valiliği İl Tarım ve Orman Müdürlüğünden gönderilen yazıda; Bilindiği üzere tarım ürünlerinin yeterli, kaliteli ve uygun maliyetlerde üretimi; tarımyapılan arazinin, çiftçilerin, çevrenin ve doğal tarım kaynaklarının korunmasını geliştireceksistem ve uygulamalarla mümkündür. Tarım arazilerinde uzun yıllar aynı bitkinin yetiştirilmesi ile toprak yapısı bozulmakta,erozyon zararları artmakta, toprak verimliliğinde genel bir azalma görülmekte, belirli hastalıkve zararlılar ile yabancı otlar katlamalı olarak çoğalmaktadır. Ekim nöbeti uygulamaları ile; toprağın fiziksel, kimyasal ve biyolojik yapısıiyileştirilmekte, toprakta organik madde arttırılmakta, daha fazla su tutması sağlanmakta,toprağın verimliliği yükseltilmekte, yabancı otlar ve hastalık - zararlılarla mücadele etkinliğiartırılmaktadır. Sağlıklı ve besin kalitesi yüksek ürün elde etmek, doğaya zarar vermemek şartıylagelecek nesilleri korumak, kimyasal maddelerin zararlarının insan, çevre ve hayvanlarüzerinde oluşturduğu olumsuz etkilerden korunmak amacıyla, 8 Haziran 2018 tarih ve 30445sayılı Resmi Gazete de yayımlanan Bitkisel Üretime Destekleme Ödemesi Yapılmasına DairTebliğ (Tebliğ No: 2018/17) de Değişiklik Yapılmasına Dair Tebliğ (Tebliğ No: 2018/27) in22 inci maddesi 1 nci fıkrasının (kk) bendinde yer alan "2018 üretim yılından başlamak üzere,örtüaltı üretimler ve çeltik hariç olmak üzere bir parsele aynı tek yıllık bitki arka arkaya üç kezekilirse, üçüncü üretim için bu Tebliğde belirtilen destekleme ödemeleri yapılmaz." hükmü ile2018 yılından itibaren bitkisel üretim desteklemelerinden yararlanmada münavebe şartıgetirilmiştir. Ülkemiz sahip olduğu ekoloji ile, polikültür tarım yapılmasına ve aynı tarımarazisiüzerinde ekim nöbeti (münavebe) ile farklı türlerde ürün elde edilmesine uygundur. Bununla birlikte gerek genel münavebe uygulamalarında gerekse ana ürünlerin ekimleriarasında (örneğin art arda yapılan pamuk ve buğday ekimleri arasında) boş kalan sürede,toprak yapısının düzelmesine ve toprakta organik madde birikimine yardımcı olan, vejetasyonsüreleri kısa baklagiller yada buğdaygil ve baklagil yem bitkilerinin veya bunlarınkarışımlarının ekilmesi doğal üretim kaynaklarının sürdürülebilirliği açısından da büyük önem arz etmektedir. 2018 ve 2019 üretim yıllarında aynı ürünü yetiştirmiş olan ve 2020 üretim yılında daaynı ürünü yetiştirmeyi planlayan olan üreticilerimiz, Tebliğin İlgili maddeleri gereğince hemmazot/gübre desteğinden hem de varsa fark ödemesi desteklemeleri gibi diğer bitkisel üretimdesteklemelerinden faydalanamayacaktır. Bu nedenle üreticilerimizin desteklemelerden faydalanabilmeleri için 2019 üretimyılında ana ürününü hasat ettikten sonra yöre ekolojisine uygun vejetasyon süreleri kısabaklagiller yada buğdaygil ve baklagil yem bitkilerinin veya bunların karışımlarının ekilmesihususunda üreticilerimize tavsiyelerde bulunulması ve çiftçilerimizin bu ekilişlerini ÇiftçiKayıt Sistemine (ÇKS) kayıt ettirmeleri gerekmektedir. Böylece üreticilerimiz hem toprak yapısının düzelmesine ve toprakta organik maddebirikimine yardımcı olacakları gibi münavebe şartını da yerine getirerek desteklemelerdenfaydalanabileceklerdir. Ayrıca ara dönemde ekilecek yukarıda belirtilen ürünler için deşartların yerine getirilmesi durumunda bitkisel üretim desteklemelerinden yararlanabilecektir. Bu bağlamda; çiftçilerimizin bitkisel üretim desteklemelerinden faydalanmalarınoktasında olası mağduriyetleri yaşamamaları ve münavebe uygulamasının sürdürülebilirliği için gerekli hassasiyetin gösterilmesi gerekmektedir. Saygılarımızla.
E-Arşiv Fatura düzenlemesi hk.
Sayın Üyemiz, TOBB dan Borsamıza gönderilen yazıdaResmi Gazete de yayımlanan 509 sıra nolu Vergi Usul Kanunu Genel Tebliği ile e-Arşiv Fatura uygulamasına dahil olmayan mükelleflerce, 01/01/2020 tarihinden itibaren düzenlenecek faturaların, vergiler dahil toplam tutarının 30 bin TL yi, vergi mükelleflerine düzenlenenler açısından vergiler dahil toplam tutarının 5 bin TL yi aşması halinde, söz konusu faturaların e-Arşiv Fatura olarak Gelir İdaresi Başkanlığınca sunulan e-Belge düzenleme portalı üzerinden düzenlenmesi zorunlu hale getirilmiştir. Saygılarımızla
Türkiye-İsviçre Yüksek Düzeyli Ekonomik Ticari İşbirliği
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden alınan yazıda, T.C. Ticaret Bakanlığı’nın yazısına atfen, Türkiye-İsviçre Yüksek Düzeyli Ekonomik Ticari İşbirliği mekanizmasının 9. Dönem Toplantısı’nın 3 Aralık 2019 tarihinde Bern’de düzenlenmesi öngörüldüğü belirtilmiştir. Türkiye-İsviçre ticari ve ekonomik ilişkilerine dair görüşlerinizin ve varsa karşılaşılan sorunlar ile çözüm önerilerinizin 4 Kasım 2019 tarihine kadar Borsamıza bildirilmesi hususunu bilgilerinize sunarız. Saygılarımızla.
Fas Korunma Önlemi
Sayın Üyemiz, TOBB dan Borsamıza gönderilen yazıda,Fas Sanayi, Yatırım, Ticaret ve Sayısal Ekonomi Bakanlığı nın internet sitesinde 27.09.2019tarihinde yayımlanan 21/19 sayılı kamuoyu duyurusuna ithafen, Fas lı "Industube, Batıfer ve Longofer"firmalarının başvurusu üzerine, "demir ve çelikten tüp ve borular" (7305.31.10.00; 7305.31.99.00;7305.39.10.00; 7305.39.99.00; 7306.19.10.90; 7306.19.99.00; 7306.30.10.99; 7306.30.99.00; 7306.50.10.90;7306.50.99.00; 7306.61.10.00; 7306.61.90.00; 7306.69.10.00; 7306.69.99.00; 7306.90.10.90 et7306.90.99.00 Fas Gümrük Tarife İstatistik Pozisyonları altında yer alan) ithalatına karşı 7 Ekim 2019tarihinde korunma önlemi soruşturmasının başlatılmasına ve 200 gün süre ile % 25 oranında ek vergiuygulanmasına karar verildiği belirtilmekte olup, anılan soruşturmanın açılacağına ilişkin Dünya TicaretÖrgütü (DTÖ) Korunma Önlemleri Komitesi ne bildirim yapıldığı kaydedilmektedir. Söz konusu bildirime göre, geçici korunma önlemi buna ilişkin kararın resmi gazetede yayımlandığı günü takip eden gün yürürlüğe girecektir. Saygılarımızla,
ABD’de İş Yapma Semineri-4 Kasım
Sayın Üyemiz, TOBB dan Borsamıza gönderilen yazıda, ABD Ankara Büyükelçiliği Ticaret Müsteşarlığı ve ABD Ticaret Odası işbirliğinde, 4 Kasım 2019 Pazartesi günü, 13:30-18:30 saatleri arasında, "ABD de İş Yapma Semineri" düzenlenecektir. Bahse konu seminerde, ABD de yatırım yapmak isteyen ya da mevcut işlerini büyütmek isteyen iş sahiplerive girişimcilere, iş yeri açma ve ilerletme sürecinde, prosedürleri anlamalarına ve kolay yatırım yapmalarıamacıyla, ABD tarafından ücretsiz danışmanlık hizmetleri veren bir program olan "SelectUSA" hakkındabilgiler verilecektir.Seminerde ayrıca, ABD eyaletlerinden gelen yetkililer tarafından ilgili eyaletlerdeki iş fırsatları, ABDPazarına Giriş, ABD de yatırım imkanları, ABD vize süreci, ABD de bankacılık işlemleri ve ABD de yatırımyapmak isteyenlerin bilmesi gereken hukuki süreçler hakkında bilgiler verilmesi planlanmaktadır. Seminerintaslak programı ekte sunulmuştur.Seminere katılım ücretsiz olup, İngilizce-Türkçe tercüme hizmeti sunulacaktır. Seminere katılım teyidi içinhttp://abdisyapmasemineri.tobb.org.tr linkinde yer alan başvuru formunun en geç 1 Kasım 2019 Cuma günümesai bitimine kadar doldurulması gerekmektedir. Seminer ayrıntıları ekte bilgilerinize sunulmuştur. Saygılarımızla,
Tarım ve Gıda Politikaları Konferansı
Sayın Üyemiz, Gıda İçecek ve Tarım Politikaları Araştırmaları Merkezinden (GİFT) Borsamıza gönderilen yazı ve ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla.
KOBİ’lere Yönelik Devlet Destekli Ticari Alacak Sigortası
Sayın Üyemiz Borsamızda KOBİ’lere Yönelik Devlet Destekli Ticari Alacak Sigortası hakkında yapılan bilgilendirme toplantısına ait dokümanlar ekte bilgilerinize sunulmuştur. Daha fazla bilgi içinhttp://www.halksigorta.org/tr-TR/devlet-destekli-alacak-sigortasiadresi ziyaret edilebilir. Saygılarımızla
Türkiye-Bangladeş 5. Dönem KEK Toplantısı
Sayın Üyemiz, TOBB dan Borsamıza gönderilen yazıda, Türkiye-Bangladeş Karma Ekonomik Komisyon (KEK) 5. Dönem Toplantısının, Kültürve Turizm Bakanı Mehmet Nuri Ersoy eşbaşkanlığında 19-20 Kasım 2019 tarihlerinde Ankara dadüzenleneceği belirtilerek, Türkiye-Bangladeş ilişkilerine dair Birliğimiz görüşleri ile varsa karşılaşılansorunlar ile çözüm önerilerini içeren bir bilgi notu talep edilmektedir. Saygılarımızla,
Türkiye-Gürcistan Karma Ekonomik Komisyonu V. Dönem Toplantısı
Sayın Üyemiz, TOBB dan Borsamıza gönderilen yazıda, Türkiye-Gürcistan Karma Ekonomik Komisyon (KEK) 5. Dönem Toplantısının, Kültürve Turizm Bakanı Mehmet Nuri Ersoy eşbaşkanlığında 18-19 Kasım 2019 tarihlerinde Ankara dadüzenleneceği belirtilerek, Türkiye-Gürcistan ilişkilerine dair Birliğimiz görüşleri ile varsa karşılaşılansorunlar ile çözüm önerilerini içeren bir bilgi notu talep edilmektedir. Saygılarımızla.
Türkiye-Kanada İş Forumu
Sayın Üyemiz, TOBB dan Borsamıza gönderilen yazıda, madencilik, inşaat ve altyapı, ulaştırma ve lojistik, ileri teknoloji (fiber optik) ve sağlıkhizmetleri sektörlerinde faaliyet gösteren Kanadalı firmaların katılımıyla, 15 Kasım 2019 tarihinde TOBBİkiz Kuleler Binasında "Türkiye-Kanada İş Forumu" gerçekleştirilecektir. Türkiye ve Kanada daki iş imkanları konusunda sunumların ve sektörel oturumların yer alacağı İş Forumukapsamında Türk ve Kanadalı firmalar arasında ikili görüşmelerin ve akabinde bir öğle yemeğiningerçekleştirilmesi öngörülmektedir. Programa katılacak firmalarımızın, Forum ile ilgili taslak program ve Kanadalı firma listesine deulaşabileceği Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İşİmkânları/Yurt İçi Etkinlikler" bölümünde yer alan katılım formunu eksiksiz doldurarak en geç 10 Kasım2019 tarihine kadar (seda.gedik@tobb.org.tr) adresine iletmesi gerekmektedir. Saygılarımızla,
13. Arap İş adamları ve Yatırımcılar Konferansı (ABIC) ve 3. Dünya Girişimciler Yatırım Forumu 2019
Sayın Üyemiz, TOBB dan Borsamıza gelen yazıda, Bahreyn Kralı Majesteleri Hamad bin İsa Al Khalifa nın himayelerinde, Bahreyn Ticaretve Sanayi Odası, Arap Odalar Birliği, Arap Ligi, Arap Yatırım ve İhracat Kredi Garanti Kurumu ve BirleşmişMilletler Sanayi Geliştirme Organizasyonu işbirliğinde, "13. Arap İş adamları ve Yatırımcılar Konferansı(ABIC) ve 3. Dünya Girişimciler Yatırım Forumu 2019 (WEIF 2019) un, 11-13 Kasım 2019 tarihlerindeBahreyn Krallığı nda düzenleneceği bildirilmektedir.Etkinliğe ilişkin program ve broşüre Birliğimiz websayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki"Uluslararası İş İmkanları/Yurt Dışı Etkinlikler" bölümünden ulaşılabilmektedir. Saygılarımızla.
Irak Yenilenebilir Enerji Forum ve Konferansı
Sayın Üyemiz TOBB dan Borsamıza gelen yazıda, Irak Cumhuriyetinin Ankara Büyükelçiliğinden alınan Nota ya atfen, Birleşik ArapEmirlikleri (BAE) firması Creative Channel ın Bağdat Yenilenebilir Enerji ve Sürdürülebilirlik Merkeziişbirliğinde, Irak Cumhuriyeti Elektrik Bakanlığının koordinasyonunda, 24-26 Mart 2020 tarihleri arasında,Uluslararası Bağdat Fuar alanında "Irak Yenilenebilir Enerji Forum ve Konferansı"nın düzenleneceğibildirilmektedir. Yazıda devamla, söz konusu konferansa ilişkin olarak, mohammed@creative-channel.com,dhulfiqer_ali@creative-channel.com eposta adreslerinden veya www.creative-channel.com internetadresinden detaylı bilgi alınabileceği belirtilmektedir. Saygılarımla,
Fas/Korunma Önlemi Soruşturması
Sayın Üyemiz, TOBB dan Borsamıza gelen yazıda Fas Sanayi, Yatırım, Ticaret ve Sayısal Ekonomi Bakanlığı tarafından “Kaplamalı Ahşap Paneller” ithalatına karşı yürütülen korunma önlemi (safeguard measure) soruşturması kapsamında, 19 Eylül 2019 tarihinde Fas Resmi Gazetesinde yayımlanan bildirime göre, anılan ülke tarafından global kota uygulamasına gidilmiş olup, 20 Eylül 2019 – 31 Temmuz 2020 tarihleri arasında 26.460.000 kg, 1 Ağustos 2020 – 31 Temmuz 2021 tarihleri arasında 29.106.000 kg ve 1 Ağustos 2021 – 31 Temmuz 2022 tarihleri arasında 32.016.600 kg ürünün vergisiz olarak Fas’a ihraç edilebileceği bildirilmektedir. İlgi yazıda devamla belirtilen tarihler arasında belirlenen söz konusu kotaların aşımı durumunda ise kilogram başına 1,6 dirhem ek vergi alınacağı belirtilmektedir. Saygılarımızla.
Kenya da Altın Ticaretiyle İlgili Dolandırıcılık Vakaları
Sayın Üyemiz, TOBB dan Borsamıza gelen bilgilendirmede, T.C. Dışişleri Bakanlığı ndan alınan yazıya atfen, Nairobi Büyükelçiliğimizden alınan yazı doğrultusunda, Kenya daki altın ticaretiyle ilgili dolandırıcılık vakalarının geçtiğimiz Mayıs ayında Dubai Emiri Mohammed bin Raşit El Maktum un da bu kapsamda dolandırıldığının ortaya çıkmasıyla yeniden uluslararası gündeme taşındığı ve bu alanda faaliyet gösteren dolandırıcılık şebekelerinin mağdurları arasında vatandaşlarımızın da bulunduğu bildirilmektedir. Yazıda, Kenya dan veya Kenya üzerinden altın ve diğer değerli mineral ithal etmek üzere Büyükelçiliğimizle temasa geçen iş çevrelerimize, özellikle aracı kişilere karşı son derece ihtiyatlı yaklaşmaları, muhataplarının altın ihracatı için geçerli lisanslarının bulunup bulunmadığını teyit etmek üzere Kenya Madencilik Bakanlığıyla temas etmelerinin tavsiye edildiği, bu konuda Ticaret Müşavirliğimizin her tür yardımı sağlamaya hazır olduğu; bununla birlikte, altın ticareti yapmak isteyen vatandaşlarımızın büyük çoğunluğunun Büyükelçiliğimizle irtibat kurmadan, önemli meblağlarda ön ödemeler yaparak iş bağlantıları tesis ettikleri zannıyla dolandırıcılık çetelerinin ağına düştükleri ve mağdur edildiklerinin müşahede edildiği, söz konusu vatandaşlarımızın dolandırıldıklarını anladıktan ve büyük maddi kayba uğradıktan sonra Büyükelçiliğimizle temasa geçtikleri, dolandırılan vatandaşlarımızın polise yapılan asılsız ihbarlarla sindirildikleri veya uzun ve masraflı hukukî süreçler karşısında yargı yoluna başvurmaktan imtina ettiklerinin tespit edildiği; basın haberlerinde, bu dolandırıcılık şebekelerinin çökertilmesinin ve mağduriyetlerin yargı yoluyla giderilmesinin neredeyse imkânsız olduğuna dikkat çekildiği kaydedilmektedir. Yazıda devamla, son dönemde bu kapsamda mağdur olan vatandaşlarımızın sayısında artış olduğunun görülmesi üzerine (son olarak bir vatandaşımız 600 bin Dolar ödeme yaparak dolandırılmıştır) kamuoyumuzda bu tehlikeye dikkat çekilmesi amacıyla Anadolu Ajansı nın Kenya daki temsilcisiyle temasa geçilerek konunun haberleştirilmesi ve aşağıda kayıtlı haber bağlantılarında konunun yer almasının sağlandığı bildirilmektedir. Saygılarımızla.
9. Uluslararası Bakliyat ve Yağlı Tohumlar Konferansı 29-30 Kasım 2019, Addis Ababa Etiyopya
Sayın Üyemiz; TOBB dan Borsamıza gelen bilgilendirmede, Etiyopya Federal Demokratik Cumhuriyeti Ankara Büyükelçiliği’nin yazısına atfen, Etiyopya Ticaret ve Sanayi Bakanlığı desteğiyle, Etiyopya Bakliyat, Yağlı Tohumlar ve Baharat İşleyiciler ve İhracatçılar Birliği (EPOSPEA) tarafından 9. Uluslararası Bakliyat ve Yağlı Tohumlar Konferansı’nın 29-30 Kasım 2019 tarihlerinde Sheraton Addis Hotel, Addis Ababa Etiyopya’da düzenleneceği bildirilmektedir. Saygılarımızla,
Sayın Üyemiz; TİGEM Dalaman Tarım İşletmesi Müdürlüğünden mahsül yağlık ayçiçeği satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla,
Sayın Üyemiz; TİGEM Polatlı Tarım İşletmesi Müdürlüğünden mahsül buğday satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla,
Kamerun Yatırım Forumu 2019
Sayın Üyemiz Türkiye Odalar ve Borsalar Birliği tarafından gönderilen yazıda 27-29 Kasım 2019 tarihlerindeKamerun’un Douala şehrinde, Kamerun Yatırım Forumu düzenleneceği, özellikle tarımsal üretim ( mısır,Pirinç ve balık ) alanlarında yatırım yapacak firmaların davetli olduğu bildirilmiştir. Katılmak isteyen üyelerimiz,https://cif2019.com/public/adresinden forumla ilgili detaya ulaşabilirler. Saygılarımızla.
3. Küba Enerji, Petrol ve Gaz Konferansı
Sayın Üyemiz Türkiye Odalar ve Borsalar Birliği’nden gelen yazıda;3. Küba Enerji, Petrol ve Gaz Konferansı, Küba Devlet Petrol Şirketinin (Union Cuba-Petroleo, CUPET) organizasyon şirketi Global Event Partners (İngiltere) ve internet sayfasında Doğu Akdeniz de arama faaliyetlerinde bulunduğu belirtilen Al Fardouss (Lübnan) şirketi ile ortaklaşa olarak 27 Kasım 2019 tarihinde Havana da başlayacak ve 3 gün sürecektir.​ Saygılarımızla,
YÖREX Yöresel Ürünler Fuarı Etkinlik Programı
Sayın Üyemiz, Antalya Ticaret Borsası tarafından bu yıl onuncusu 23-27 Ekim tarihlerinde Antalya ANFAŞ Fuar Merkezi’nde düzenlenecek olan “YÖREX–Yöresel Ürünler Fuarı” kapsamında gerçekleştirilecek panel ve etkinliklerin programı EK-1’de yer almaktadır. Program kapsamında; Etkinlikler içerisinde bulunan ikili iş görüşme (B2B eşleştirme) programına katılmak isteyen üyeler/katılımcılar/ziyaretçilerin EK-2’de yer alan başvuru formunuen geç 16 Ekim 2019, saat 15.00’ekadarcetin@antalyaborsa.org.tre-posta adresine göndermeleri gerekmektedir. Üyelerimizin bilgilerine sunulur. Ek-1 Yörex Yöresel Ürünler Fuarı Programı Ek-2 B2B Eşleştirme Programı Katılımcı Başvuru Formu
Sayın Üyemiz, Azerbaycan Ziyareti ile ilgili TOBB dan alınan son yazı ektedir. Bilgilerinize sunarız.
Sayın Üyemiz; TİGEM Dalaman Tarım İşletmesi Müdürlüğünden mahsül yağlık ayçiçeği satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla,
Sayın Üyemiz; TİGEM Dalaman Tarım İşletmesi Müdürlüğünden mahsül yağlık ayçiçeği satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla,
TOBB Azerbaycan Ziyareti, İlave Bilgi
Sayın Üyemiz, 08.10.2019 tarih ve 9968 sayılı Türkiye Odalar ve Borsalar Birliği (TOBB) yazısında; Bakü de düzenlenecek Türk Dili Konuşan Devletler İş Forumu na katılmak üzere, 13-14 Ekim 2019 tarihlerinde TOBB tarafından Azerbaycan a yönelik bir Özel Sektör Heyeti Ziyaret Programı düzenleneceğinin bildirildiği hususu iletilmişti. TOBB’un 10.10.2019 tarih ve 10066 sayılı yazısında ise; Foruma, TOBB tarafından sağlanan uçuş ve konaklama hizmetlerini kullanmadan, kendi imkanları ile Azerbaycan dan katılım sağlamak isteyenler için 500,- TL "yerinden katılım ücreti" belirlendiği, Söz konusu 500,- TL lik meblağın GOLDENBAY TURİZM YATIRIMLARI A.Ş. nin Türkiye İş Bankası Şişli Ticari Şubesi, TR10 0006 4000 0011 3980 0311 76 IBAN numaralı Türk Lirası hesabına ödenmesi gerektiği hususları bildirilmektedir. Bilgilerinize sunarız.
TOBB Azerbaycan Ziyareti ve İş Forumu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden alınan yazıda, Türk Dili Konuşan Ülkeler İşbirliği Konseyi (Türk Keneşi) bünyesinde, Türk Ticaret ve Sanayi Odası nın (TTSO) kurulduğu, TTSO nun üyeleri arasında Azerbaycan İşverenler Konfederasyonu, Kazakistan Ulusal Girişimciler Odası, Kırgız Cumhuriyeti Ticaret ve Sanayi Odası ve TOBB un yer almakta olduğu ve Sn. M. Rifat Hisarcıklıoğlu nun TTSO nun ilk Başkanı olarak seçildiği bildirilmiştir. Yazıda devamla Türk Dili Konuşan Ülkeler İşbirliği Konseyi, TTSO, Azerbaycan İşverenler Konfederasyonu (ASK) ve TOBB’un katılımları ile14 Ekim 2019tarihinde, Azerbaycan ın başkenti Bakü de, Türk Keneşi 7. Liderler Zirvesi Kapsamında, Türk Dili Konuşan Devletler İş Forumu düzenleneceği belirtilmektedir. Foruma Özbekistan, Azerbaycan, Kazakistan, Kırgızistan, Türkmenistan ve Türk Dili Konuşan Ülkeler İşbirliği Konseyi gözlemci üyesi Macaristan dan iş insanlarının katılımı da beklenmektedir. Bu çerçevede, TOBB tarafından, söz konusu Foruma katılmak üzere, 13-14 Ekim 2019 tarihlerinde, Azerbaycan Bakü ye yönelik bir Özel Sektör Heyeti Ziyaret Programı düzenlenmesi öngörülmektedir. Ziyarete ilişkin taslak program ve katılım formu azerbaycan.tobb.org.tr adresinde yer almaktadır. Ziyarete katılmak isteyen firma temsilcilerinin konaklama, uçak, transferler, yemek vb. organizasyon giderlerini karşılamak üzere, TOBB tarafından görevlendirilen GOLDENBAY TURİZM YATIRIMLARI A.Ş. nin Türkiye İş Bankası Şişli Ticari Şubesi, TR10 0006 4000 0011 3980 0311 76 IBAN numaralı Türk Lirası hesabına 6.000,- Türk Lirası ön avans bedeli ödemeleri gerekmektedir. Katılım bedelinin kesinleşmesini takiben, bakiye tutar ziyaret öncesinde katılımcılardan talep edilecektir. Ödeme yapılırken açıklama kısmına "13-14 Ekim Azerbaycan Ziyareti Katılım Ücreti" açıklaması yazılması gerekmektedir. Firma temsilcilerinin azerbaycan.tobb.org.tr adresinde yer alan başvuru formunu doldurduktan sonra yüksek çözünürlüklü "jpeg" formatında bir fotoğraf ve pasaportun renkli kısmı ile ödeme yaptıklarına dair dekontu azerbaycan@tobb.org.tr adresine en geç11 Ekim 2019 Cuma günü saat 12.00 ye kadariletmeleri gerekmektedir. Kişi başı organizasyon giderleri, katılımcı sayısına göre tespit edilmektedir. Bu itibarla, katılım teyidini bildirip, avans ödemesini yapmış olan üyelerimizin ziyarete katılmaktan vazgeçmeleri halinde, yapılan ödemenin iadesinin yapılabilmesi için, en geç 11 Ekim 2019 tarihine kadar Birliğimize yazılı olarak bildirimde bulunmaları gerekmektedir. İlgili üyelerimize duyurulur.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen 07.10.2019 tarih, 34221550-720-9945 sayılı yazıda Kenya’da altın ticaretiyle ilgili dolandırıcılık vakaları duyurulmaktadır. Dışişleri Bakanlığı nın 30.09.2019 tarihli ve 92150458-150.05-2019/23955776 sayılı yazısı ile, Nairobi Büyükelçiliğimizden alınan bir yazıya atfen, Kenya’daki altın ticaretiyle ilgili dolandırıcılık vakalarının geçtiğimiz Mayıs ayında Dubai Emiri Mohammed bin Raşit El Maktum’un da bu kapsamda dolandırıldığının ortaya çıkmasıyla yeniden uluslararası gündeme taşındığı ve bu alanda faaliyet gösteren dolandırıcılık şebekelerinin mağdurları arasında vatandaşlarımızın da bulunduğu bildirilmektedir. Yazıda devamla, Kenya’dan veya Kenya üzerinden altın ve diğer değerli mineral ithal etmek üzere Büyükelçiliğimizle temasa geçen iş çevrelerimize, özellikle aracı kişilere son derece ihtiyatlı yaklaşmaları, muhataplarının altın ihracatı için geçerli lisanslarının bulunup bulunmadığını teyit etmek üzere Kenya Madencilik Bakanlığıyla temas etmelerinin tavsiye edildiği, bu konuda Ticaret Müşavirliğinin her tür yardımı sağlamaya hazır olduğu; bununla birlikte, altın ticareti yapmak isteyen vatandaşlarımızın büyük çoğunluğunun Büyükelçiliğimiz ile irtibat kurmadan, önemli meblağlarda ön ödemeler yaparak iş bağlantıları tesis ettikleri zannıyla dolandırıcılık çetelerinin ağına düştükleri ve mağdur edildiklerinin müşahede edildiği, söz konusu vatandaşlarımızın dolandırıldıklarını anladıktan ve büyük maddi kayba uğradıktan sonra Büyükelçiliğimizle temasa geçtikleri, dolandırılan vatandaşlarımızın polise yapılan asılsız ihbarlarla sindirildikleri veya uzun ve masraflı hukuki süreçler karşısında yargı yoluna başvurmaktan imtina ettiklerinin tespit edildiği; basın haberlerinde, bu dolandırıcılık şebekelerinin çökertilmesinin ve mağduriyetlerin yargı yoluyla giderilmesinin neredeyse imkansız olduğuna dikkat çekildiği kaydedilmektedir. Son dönemde bu kapsamda mağdur olan vatandaşlarımızın sayısında artış olduğunun görülmesi üzerine (son olarak bir vatandaşımızın 600 bin dolar ödeme yaparak dolandırıldığı belirtilmiştir) kamuoyumuzda bu tehlikeye dikkat çekilmesi amacıyla Anadolu Ajansı’nın Kenya’daki temsilcisiyle temasa geçilerek konunun haberleştirilmesi ve aşağıda kayıtlı haber bağlantılarında konunun yer almasının sağlandığı bildirilmektedir. https://www.aa.com.tr/tr/dunya/kenyada-altin-dolandiricilarinin-hedefinde-turkler-de-var/1592485 https://www.aa.com.tr/en/africa/turks-begin-conned-by-gold-scammers-in-kenya/1589822 Saygılarımızla,
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğ’nden (TOBB) alınan yazıda, Ticaret Bakanlığı’nın yazısına atfen, Ticaret Bakanı Sayın Ruhsar Pekcan ile muhatabı Pakistanlı Başbakan Danışmanı arasında 24 Ekim 2019 tarihinde ikili görüşme gerçekleştirileceği ve görüşme kapsamında gündeme getirilmesinde fayda görülen hususlara ilişkin görüş talebinde bulunulduğu belirtilmektedir. Bu kapsamda, Pakistan ile ilgili olarak gündeme getirilmesinde fayda gördüğünüz tespit, görüş ve önerilerinizin TOBB’a iletilmek üzere, 14 Ekim 2019 tarihi mesai bitimine kadar Borsamıza (eskisehirtb@gmail.com) bildirilmesi hususunu bilgilerinize sunarız.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) alınan yazıda, “14 Ekim Dünya Standartlar Günü”nün tüm dünya genelinde standardizasyonun önemini vurgulamak amacıyla kutlanan özel sektör açısından çok önemli bir gün olduğu vurgulanmakta ve bu kapsamda, Sanayi ve Teknoloji Bakanı Sayın Mustafa VARANK’ın teşrifleriyle, 14 Ekim 2019 tarihinde saat 09:30’da Swissotel The Bosphorus İstanbul’da “Uluslararası Standardizasyon Zirvesi”nin gerçekleştirileceği belirtilmektedir. Zirvenin amacı, ülkemizdeki standardizasyon bilincini ve farkındalığını artırmak, başta tüccar ve sanayiciler olmak üzere standardizasyon faaliyetlerine katılan tüm paydaşların çalışmalarını teşvik etmektir. Zirvenin teması “Standartlara Yön Ver” olarak belirlenmiş olup Zirveye uluslararası ve Avrupa standardizasyon kuruluşlarının başkanlarının da katılımı beklenmektedir. Zirvenin ayrıntılı programına ve katılım için kayıt formuna www.14ekim.com internet adresinden ulaşılabileceği hususunu bilgilerinize sunarız.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) alınan yazıda, Ticaret Bakanlığı’nın yazısına atfen, Pazara Giriş Komitesi’nin 27 Ağustos 2019 tarihinde gerçekleştirilen 10. Toplantısı akabinde, Komite üyelerinin görüş ve değerlendirmeleri ışığında, 2020-2021 dönemi Hedef ve Öncelikli Ülkeler listesinin belirlendiği belirtilmektedir. Söz konusu ülkeler aşağıda sıralanmaktadır: Hedef Ülkeler: Amerika Birleşik Devletleri (ABD), Brezilya, Çin Halk Cumhuriyeti, Etiyopya, Fas, Güney Afrika Cumhuriyeti, Güney Kore, Hindistan, Irak, İngiltere, Japonya, Kenya, Malezya, Meksika, Özbekistan, Şili, Rusya Öncelikli Ülkeler: Almanya, Azerbaycan, Bangladeş, Birleşik Arap Emirlikleri, Bulgaristan, Çekya, Demokratik Kongo, Endonezya, Fildişi Sahili, Filipinler, Fransa, Gana, Gürcistan, İran, İtalya, Kanada, Katar, Kazakistan, Mısır, Nijerya, Pakistan, Polonya, Romanya, Senegal, Sırbistan, Tanzanya, Ukrayna, Vietnam Bilgilerinize sunarız.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği (TOBB) öncülüğünde, Türkiye Ekonomi Politikaları Araştırma Vakfı (TEPAV) ve TOBB Ekonomi ve Teknoloji Üniversitesi (TOBB ETÜ) işbirliğinde gerçekleştirilen “Türkiye 100” programının altıncısı başlamıştır. Programda ilk 100’e giren şirketlere yeni ortaklıkların kapısı açılırken, birçok platformda tanıtım imkânı sağlanacak. Programa başvurular 15 Kasım 2019 tarihine kadar devam edecektir. -Türkiye 100’e başvuru koşulları: - 31 Aralık 2015 ve öncesinde kurulan, - 2016 yılında en az 500 bin TL satış gelirine sahip, - 2018 yılında en az 1,5 milyon TL satış gelirine sahip, - 2016 – 2018 döneminde satış gelirlerini en az yüzde 10 oranında artıran şirketler, - Başvuracak şirketlerin merkezlerinin Türkiye’de bulunması gereklidir. - Kamu ortaklığı ve/veya halka açık olan şirketlerin başvuruları geçerli sayılmaz. - Yurtdışı merkezli bir şirketin Türkiye şubesinin başvurusu geçerli sayılmaz. - Hisselerinin yüzde 51’inden fazlası halka açık başka bir şirkete ya da bir kamu şirketine ait olan şirketlerin başvuruları geçerli sayılmaz. - Kar amacı gütmeyen şirketlerin başvuruları geçerli sayılmaz. - Franchise işletmelerinin başvuruları geçerli sayılmaz. - Otomobil galerileri, kuyumcular, döviz şirketleri, bankalar, enerji dağıtım şirketleri ve elektrik, gaz, akaryakıt ve su sağlayıcıların başvuruları geçerli sayılmaz. - Holdinglerin başvuruları geçerli sayılmaz; bir holdingin çatısı altındaki şirketler başvurabilir. - Ortakları arasında Türkiye dışındaki ülkelerin vatandaşları (gerçek ve tüzel kişiler) olan şirketler başvurabilir. Başvurularhttp://turkiye100.tobb.org.trsitesinden yapılabilir. Son başvuru tarihi 15 Kasım 2019. Bilgilerinize rica ederiz.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden borsamıza iletilen ve Dışişleri Bakanlığı nın veJuba Büyükelçiliğimizden alınan yazıya atfen; "Afrika Oil & Power" şirketi tarafından, Güney Sudan Petrol Bakanlığı desteğiyle "Güney Sudan Petrol ve Enerji" konulu Konferansın 28-30 Ekim 2019 tarihlerinde Crown Otel de Juba da düzenleneceği belirtilmiştir. Yazıda devamla, söz konusu etkinliğe katılım öngörülmesi halinde heyet üyelerinin başta sarıhumma olmak üzere zorunlu aşıları yaptırmış olmalarının gerektiği ifade edilmiştir. Bu çerçevede, "Enerji ve Altyapı Finansmanı" ana temalı etkinliğe ilişkin güncel bilgilerehttps://africaoilandpower.com/event/aop-2019/adresinden ulaşılabilmekte olup, ayrıntılı bilgi için "Afrika Oil & Power" yetkilisi ile (James Chester, james@africaoilandpower.com) temas kurmaları gerekmektedir. Tüm ilgili üyelerimize duyurulur. Saygılarımızla.
Sayın Üyemiz; TMO Genel Müdürlüğünden yapılan kamuoyu açıklaması ve ayrıntılarına aşağıdakiadresinden ulaşılabilecektir. http://www.tmo.gov.tr/Main.aspx?ID=21192 Saygılarımızla.
Bursa Tarım & Hayvancılık 2019 Fuarları
Sayın Üyemiz; Bursa Ticaret Borsasından gelen yazıda; Bursa 17.Uluslararası Tarım, Tohumculuk,Fidancılık ve Süt Endüstrisi Fuarı ve Bursa 12.Uluslararası Hayvancılık ve Ekipmanları fuarı 8-11 Ekim 2019 tarihlerinde ziyarete açık olacaktır. Ayrıntılı bilgiyehttp://burtarim.com/adresinden ulaşılabilecektir. Saygılarımızla.
Dünya Helal Zirvesi ve 7. İİT Helal Expo Hk.
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden gelen yazıda;Dünya Helal Zirvesi İstanbul 2019 ile 7. İslam İşbirliği Teşkilatı (İİT) Helal Expo, Cumhurbaşkanımız Sayın Recep Tayyip ERDOĞAN ın yüksek himayelerinde 28 Kasım 2019 – 1 Aralık 2019 tarihlerinde, "Tüm Nesiller için Helal: Ailenin ve Gençliğin Önemi" teması ile İstanbul Avrasya Gösteri ve Sanat Merkezinde gerçekleştirilecektir. Ülkemizin uluslararası tanıtımına katkı sağlayacak organizasyona 250 nin üzerinde uluslararası firmanın da katılımı beklenmekte olup, dünyanın en büyük ve etkili helal fuarlarından biri olması hedeflenmektedir.Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla.
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden gelen yazıda;Hayvan ve Hayvansal Ürünler İthalat - İhracat Elektronik Kayıt Sistemine ilişkin Tarım ve Orman Bakanlığından alınan "ilgi" yazı ekte bilgilerinize sunulmuştur. Saygılarımızla.
Avrupa Birliği İşletmelerin ve KOBİ’lerin Rekabet Edebilirliği (COSME) Programı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen yazıda;Avrupa Birliğinin, "İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı (COSME)" kapsamında, "Uluslararası Kümelenme (Clusters Go International)" konulu proje teklif çağrısı yayınlanmış olup, söz konusu proje çağrısının amacı, sektörel ve coğrafi sınırlara bağlı kalmadan kümeler ve iş ağları arasındaki iş birliğini güçlendirmektir. Bu çağrı kapsamında, uluslararası işbirliği stratejilerinin geliştirilmesi, yeni marketler için ortak hedefler belirlenmesi ve Avrupa dışındaki ülkelerde bulunan KOBİ leri de içine alan uluslararası bir iş birliği ağının oluşturulması hedeflenmektedir. Son başvuru tarihi 30 Ekim 2019 olan proje teklif çağrısına, Avrupa Komisyonunun (https://ec.europa.eu/easme/en/section/cosme/cos-clusint-2019-3-01-clusters-go-international) internet sayfasından ulaşılabilmektedir. Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB), programın ulusal koordinasyonundan sorumlu kurum olarak yetkilendirilmiştir. Saygılarımızla.
Sayın Üyemiz; Alman-Türk Ticaret ve Sanayi Odasından alınan yazıda, 18 Ekim 2019 tarihinde 09.00-12.00 saatleri arasında “Kişisel Verilerin Korunması” konulu bir workshop düzenleneceği belirtilerek, toplantı kapsamında, şirketlerin KVKK ve ikincil mevzuat kapsamında yükümlülükleri, KVKK uyum süreci uygulamaları, Kişisel Veri Koruma Kurulu kararlarına ilişkin güncel bilgilerin paylaşılacağı iletilmektedir. Bahse konu toplantıya katılım ücretsiz olup, katılmak isteyenlerin kayıt yaptırması gerekmektedir. Bilgi ve Kayıt: Hilal Akyıldırım – E-Posta: hilalakyildirim@dtr-ihk.de – Telefon: 0212 363 05 00
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinde alınan yazı ekte bilgilerinize sunulmuştur. Saygılarımızla,
Uluslararası Gümrük Forumu Rusya Duyurusu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden gelen 24.09.2019 tarih ve 9529 sayılı yazıda; Rusya Federasyonu Türkiye Cumhuriyeti Ticaret Mümessilliği nin 21.09.2019 tarihli ve 02-08/176 sayılı yazısında, Uluslararası Gümrük Forumu nun, 24-25 Ekim 2019 tarihlerinde Moskova da Uluslararası Ticaret Merkezi nde düzenleneceği, Forumun katılımcıları arasında devlet yetkilileri, şirketler, sanayi dernekleri ve sendikaları ile yabancı heyet temsilcilerinin yer aldığı ve 2018 yılında, Foruma 2.500 den fazla katılım olduğu, Foruma kayıt web sitesi üzerinden yapılmakta olduğu, Forumla ilgili detaylı bilgiyehttps://customsforum.ru/adresinden veyacustomsforum@mail.rue-posta adresi üzerinden ulaşılabildiği belirtilmektedir. Bilgilerinize rica ederiz.
Türkiye - Yeni Zelanda 10. Dönem KEK Toplantısı
Sayın Üyemiz, TOBB tarafından Borsamıza gönderilen 24.09.2019 tarih ve 9532 sayılı yazıya istinaden; Eşbaşkanlığı Tarım ve Orman Bakanı Sayın Bekir PAKDEMİRLİ ile Yeni Zelanda Tarım, Biyogüvenlik, Gıda Güvenliği ve Kırsal Topluluklar Bakanı Sayın Hon Damien O’CONNOR’S tarafından yürütülen“Türkiye – Yeni Zelanda KEK 10. Dönem Toplantısı”nın 2019 yılı Kasım ayının üçüncü haftasında Yeni Zelanda’nın başkenti Wellington’da gerçekleştirilmesinin planlandığı belirtilmektedir. Bu çerçevede, söz konusu toplantıya yönelik hazırlık çalışmalarında yararlanılmak ve toplantı sonunda imzalanacak Protokolde yer almak üzere, Yeni Zelanda ile ticari ve ekonomik ilişkilerin artırılmasına yönelik işbirliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin görüşlerinen geç 3 Ekim 2019 Perşembe günü mesai bitimine kadarBorsamıza (eskisehirtb@tobb.org.tr)iletilmesi talep edilmektedir. Bilgilerinizi arz/rica ederim.
Özbekistan Ziyareti ve Türk Keneşi Özbekistan İş Forumu
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği nden Borsamıza iletilen yazıda;Türk Dili Konuşan Ülkeler İşbirliği Konseyi (Türk Keneşi) bünyesinde, 31 Temmuz 2019 tarihindeİstanbul da Türk Ticaret ve Sanayi Odası (TTSO) kurulmuştur. Türkiye Odalar ve Borsalar Birliği ile birlikte, Azerbaycan İşverenler Konfederasyonu, Kazakistan Ulusal Girişimciler Odası, Kırgız Cumhuriyeti Ticaret ve Sanayi Odası, Türk Odalar Birliği üyeleridir. Yapılan seçimlerde Birlik Başkanı Sn. M. Rifat HİSARCIKLIOĞLU, TTSO nun ilk Başkanı olarak seçilmiştir. Türkiye Odalar ve Borsalar Birliğince, Türk Dili Konuşan İşbirliği Konseyi, TTSO ve Özbekistan Yatırım ve Dış Ticaret Bakanlığı ile Özbekistan TSO işbirliğinde, 5 Ekim 2019 tarihinde, Türk Keneşi Özbekistan İş Forumu düzenlenecektir. Özbekistan ın başkenti Taşkent te gerçekleştirecek "Forum"a, ÖzbekistanCumhuriyeti Cumhurbaşkanı Sn. Şevket MİRZİYOYEV in katılımı da öngörülmektedir. Söz konusu Foruma Özbekistan, Azerbaycan, Kazakistan, Kırgızistan, Türkmenistan ve Türk Dili Konuşan İşbirliği Konseyi gözlemci üyesi Macaristan dan iş insanlarının katılımı beklenmektedir. İş Forumunun, tarım, gıda, inşaat ve inşat malzemeleri, sağlık hizmetleri ve eczacılık, bilgi teknolojileri, kimyasal ürünler ve üretimi, petrol ve gaz, otomobil sanayi ve yan parça üretimi, elektronik, enerji, tekstil, ulaştırma-lojistik, ticaret ve turizm sektörlerine odaklanması öngörülmektedir. Forum kapsamında, ayrıca iş görüşmelerinin gerçekleştirilmesi planlanmaktadır. Foruma katılması beklenen firmaların listesi ve faaliyet alanlarına dair bilgiler katılım teyidi veren firmalarımıza bilahare bildirilecektir. Programa katılmak isteyen firma temsilcilerinin konaklama, uçak, transferler, yemek vb. organizasyon giderlerini karşılamak üzere, Birliğimizce görevlendirilen ETS Ersoy Turistik Servisleri A. Ş. nin GarantiBankası Kadıköy Ticari Şubesi TR 54 0006 2001 6730 0006 2999 73 numaralı Türk Lirası hesabına,10.000,- Türk Lirası ön avans bedeli ödemeleri gerekmektedir. Katılım bedelinin kesinleşmesini takiben, bakiye tutar ziyaret öncesinde katılımcılardan talep edilecektir. Ödeme yapılırken açıklama kısmına "3-5 Ekim 2019 Özbekistan Heyeti katılım ücreti" açıklaması yazılması gerekmektedir. 5 Ekim 2019 tarihinde düzenlenecek İş Forumu na yerinden katılım ücreti 500,- Türk Lirası olup, meblağın yukarıda belirtilen banka hesabına yatırılması gerekmektedir. Ziyarete katılmak isteyen firma temsilcilerininozbekistan.tobb.org.tradresinde yer alan başvuru formunu doldurmaları ve yüksek çözünürlüklü "jpeg" formatında bir fotoğraf ve pasaportun renkli kısmı ile ödeme yaptıklarına dair dekontuozbekistan@tobb.org.tradresine en geç 30 Eylül 2019 Pazartesi günü mesai bitimine kadar iletmeleri gerekmektedir. Kişi başı organizasyon giderleri, katılımcı sayısına göre tespit edilmektedir. Bu itibarla, katılım teyidini bildirip, avans ödemesini yapmış olan firmalarımızın ziyarete katılmaktan vazgeçmeleri halinde, yapılan ödemenin iadesinin yapılabilmesi için, en geç 2 Ekim 2019 Çarşamba günü saat 14.00 e kadar Türkiye Odalar ve Borsalar Birliği ne yazılı olarak bildirimde bulunmaları gerekmektedir. Saygılarımızla.
Robotex Turkey 2019
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden Borsamıza iletilen yazıda;Türkiye de ilk kez gerçekleştirilecek olan Robotex Turkey festivali, dünyanın en büyük Robotik/Maker organizasyonlarındandır veTürkiyeRobotex International ın ortağı olup, festival kapsamında robotik yarışmaları; teknoloji, fütürizm, eğitim, inovasyon konularında çeşitli workshop ve seminerler organize edilecektir. Ayrıca stantlarda teknoloji ve eğitim kurumları gibi çeşitli kuruluşlar ve ortaklar hizmet ve ürünlerini sergileme fırsatı bulacaklar ve yarışma katılımcısı olarak 800 kişi, ziyaretçi olarak 5000 kişilik bir katılımın ön görüldüğü festivalde robotik yarışması olarak toplam 16 yarışma ana başlığı belirlenmiştir.Belirlenen kategori birincilerine Robotex International/Estonia da, ikinci ve üçüncülere Robotex Asia/Shangai da yarışmaya katılım hakkı vebirinci takıma16 adetAntalya tatili ödülleri verilecektir. Festival e katılmak isteyen şirketlerimiz Robotex Turkey web sayfası üzerinden yarışma kaydı, otel rezervasyonu ve ziyaretçi kaydı yapabilecek olup; yarışma kayıtları için yarışmacı takım ve robot başına olan ücretleri web sayfasında belirtilmiştir ve detaylı bilgilerehttps://www.robotexturkey.comadresinden; online biletlerehttps://www.biletantalya.comadresinden ulaşılmaktadır. Ayrıca ortaklık ve stant talepleri için 0538 796 38 24 numaralı telefondan vebilgi@robotexturkey.come-posta adresinden bilgi alınabilmektedir. Detaylı bilgiler ekte sunulmaktadır. https://mobil.tobb.org.tr/DuyuruResimleri/2778-1.pdf https://mobil.tobb.org.tr/DuyuruResimleri/2778-2.pdf Saygılarımızla.
Hizmet Ticareti Kısıtlılık Endeksi
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği nden Borsamıza iletilen yazıda, hizmet ticareti önündeki engellerin belirlenmesi ve bu engellerin sayısallaştırılmasını teminen iktisadi İşbirliği ve Kalkınma Teşkilatı (OECD) tarafından Hizmet Ticareti Kısıtlılık Endeksi Veritabanı (STRI) oluşturulduğu belirtilmektedir. Söz konusu veritabanının, OECD üyesi ülkelerde 22 hizmet sektörünü etkileyen düzenlemeler göz önünde bulundurularak hazırlandığı ifade edilmektedir. Yazıda devamla, Hindistan Dış Ticaret Enstitüsü (IIFT) tarafından, hizmet sektörleri önündeki engellerin ve ihracatçıların hizmet sunumunda karşılaştıkları kısıtlamaların tespit edilebilmesini teminen bir çalışma gerçekleştirildiği bildirilmektedir. Söz konusu çalışma kapsamında OECD veritabanında bulunan eksikliklerin giderilmesinin, ülkemiz gibi gelişmekte olan ülkelerin görüşleri ve öncelikleri hesaba katılarak kriterlerin belirlenmesinin ve ülkelerin hizmet ticareti alanında kısıtlılık endekslerinin oluşturulmasının öngörüldüğü ifade edilmektedir. Yapılacak çalışmanın sonuçlarının Nursultan da (Astana) gerçekleştirilecek 12. Bakanlar Konferansında sunulması ve medya ile paylaşılması öngörülmektedir. Yazıda, çalışma kapsamında hazırlanan anket formuna aşağıdaki linkten erişim imkanı mevcut olup, söz konusu anket formunun ilgili hizmet sektöründe faaliyet gösteren ihracatçı ve ithalatçılar tarafından doldurulmasının, ülkemiz hizmet sunucularının/iş insanlarının karşılaştıkları engellerin çalışmaya yansımasıbakımından önem arz ettiği bildirilmektedir. Bu kapsamda, aşağıda yer alan internet adreslerinden ulaşabileceğiniz bilgi notu ve rehberin anket çalışmasında yardımcı olabileceği değerlendirilmektedir. http://docs.iift.ac.in/survey/stri/ http://docs.iift.ac.in/survey/stri/brief.pdf http://docs.iift.ac.in/survey/stri/Guidelines.pdf Saygılarımızla.
Sayın Üyemiz; TİGEM Ceylanpınar Tarım İşletmesi Müdürlüğü tarafından yapılacak olan yağlık ayçiçek satış ihalesine dair ihale şartnamesi ve diğer gerekli evrak örnekleri ekte bilginize sunulmuştur. Saygılarımızla.
Yerinde Pazar Araştırmaları 2020 Programı
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliğinden aldığımız bir yazıda; Cumhurbaşkanlığı Yıllık Programı, Türkiye Stratejik Planı ve Yeni Ekonomi Programı gibi temel politika belgeleri çerçevesinde, hedef ülkelerde ihracat payımızın artırılması ana hedefi doğrultusunda "Yerinde Pazar Araştırmaları" (YPA) gerçekleştirildiği bildirilmektedir. YPA mekanizması çerçevesinde, gerek ülkemizin dış pazar çeşitliliğinin gerekse mevcut dış pazarlardaki pazar payımızın artırılması amacıyla sektörel dış pazar analizleri yapıldığı belirtilmektedir. 2019 yılı için YPA ların sayısının temel politika belgeleri ile 12 olarak belirlendiği ve 4 hedef ülkeye yönelik (Çin, Rusya, Meksika ve Hindistan) olarak düzenlenmelerinin öngörüldüğü ifade edilmektedir. Yazıda devamla, YPA ların 11. Kalkınma Planı ile İhracat Ana Planı hedefleri doğrultusunda, hedef pazar ve hedef sektör odaklı ihracatın geliştirilmesi, sürdürülebilir bir ihracat artışının sağlanması ve 2023 ihracat hedeflerine ulaşılması amaçlarıyla, 2020 yılı için Yerinde Pazar Araştırması takviminin oluşturulması için hazırlık çalışmaları Ticaret Bakanlığınca sürdürüldüğü bildirilmektedir. Bu doğrultuda, önümüzdeki dönemde, YPA ların mal ticaretinin yanı sıra hizmet ticaretini de odak alacak biçimde gerçekleştirilmelerinin, yeni ihracatçılarımızın pazara girişlerinin sağlanması için birer yol haritası olarak kullanılmalarının ve "Türk Malı"na yönelik yurtdışı pazarlardaki algının da araştırılması amacıyla gerçekleştirilmelerinin hedeflendiği belirtilmektedir. Bu çerçevede, yukarıda maruz hususlar doğrultusunda 2020 yılında Yerinde Pazar Araştırması gerçekleştirilmesinin uygun ve faydalı olacağı değerlendirilen ülke ve sektörlere ilişkin varsa görüş ve önerilerinizin gerekçeleri ile birlikte ekte yer alan form doldurularak, Bakanlığa iletilmek üzere 24 Eylül 2019 saat 16.00 ya kadar Borsamıza (eskisehirtb@gmail.com) iletilmesi hususunda gereğini rica ederim. Saygılarımızla,
VERBİS’e Kayıt Sürelerinin Uzatılması
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza gönderilen yazıda; Türkiye Odalar ve Borsalar Birliğinin, Kişisel Verileri Koruma Kurumu nezdindeki girişimleri neticesinde, yıllık çalışan sayısı 50’den çok veya yıllık mali bilanço toplamı 25 milyon TL’den çok olan gerçek ve tüzel kişi veri sorumluları ile yurt dışında yerleşik gerçek ve tüzel kişi veri sorumlularının sicile kayıt yükümlülüğünü yerine getirmeleri için belirlenen sürenin sonunun 30.09.2019 tarihinden 31.12.2019 tarihine kadar uzatılmasına karar verilmiştir. Bilgilerinize önemle sunulur.
Brezilya Yatırım Forumu 2019
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden Borsamıza iletilen 10.09.2019 tarih ve34221550-720-9098 sayılı yazıda; Brezilya Yatırım Forumu nun üçüncüsünün 10-11 Ekim 2019 tarihlerinde Brezilya nın Sao Paulo şehrinde düzenleneceği bildirilmektedir. Forum un, altyapı, enerji, endüstriyel tarım, teknoloji ve inovasyon gibi Brezilya ekonomisinin stratejik sanayi sektörlerinde yatırım fırsatlarını öne çıkaracağı belirtilmekte olup, aynı zamanda Brezilya iş ortamında son zamanlarda gerçekleşen gelişmeleri öğrenmek adına önemli bir fırsat sunacağı ifade edilmektedir. Açılışını Brezilya Devlet Başkanı Jair Bolsanaro nun yapacağı Forum a çok sayıda üst düzey Brezilya resmi makamlarının ve özel sektör yetkililerinin katılacağı, Brezilyalı Bakanlar ve önemli resmi kurumlar ile toplantıların gerçekleştirileceği bildirilmektedir. Söz konusu Forum a ait detaylı programa Türkiye Odalar ve Borsalar Birliği nin web sayfası (www.tobb.org.tr) "Hizmetler" başlığıaltındaki "Uluslararası İş imkânları/Yurt Dışı Etkinlikler" sayfasından ulaşılabilmekte olup, Forum a katılmak isteyen şirketlerimizhttp://www.brasilinvestmentforum.comadresinden katılım kaydını yapabilmektedir. Üyelerimize duyurulur.
Türkiye – Çek Cumhuriyeti KEK VII. Dönem Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden Borsamıza iletilen 13.09.2019 tarihli ve 9215 sayılı yazıda; Eşbaşkanlıkları T.C. Kültür ve Turizm Bakanı Sayın Mehmet ERSOY ve Çek Cumhuriyeti Başbakan Yardımcısı ve Sanayi ve Ticaret Bakanı Sayın Karel HAVLİCEK tarafından gerçekleştirilen Türkiye – Çek Cumhuriyeti Karma Ekonomik Komisyonu’nun (KEK) VII. Dönem Toplantısının 17 Ekim 2019 tarihinde Prag’da gerçekleştirileceği bildirilmekte olup, toplantı sonunda KEK Protokolünün imzalanacağı belirtilmektedir. Bu itibarla, Türkiye – Çek Cumhuriyeti Karma Ekonomik Komisyonu VII. Dönem Toplantısı hazırlık çalışmalarında yararlanılmak ve imzalanması planlanan Protokol metnine derç edilmek üzere Çekya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerininen geç 23 Eylül 2019 Pazartesi günü mesai bitimine kadarskisehirtb@gmail.come-posta adresine gönderilmesi hususunu bilgilerinize sunarız.
Kamboçya 2. Dönem KEK Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden Borsamıza iletilen 16.09.2019 tarih ve34221550-720-9240 sayılı yazıda; Türkiye-Kamboçya Karma Ekonomik Komisyonu nun (KEK) 2. Dönem Toplantısının Tarım ve Orman Bakanı Sayın Dr. Bekir Pakdemirli nin eşbaşkanlığında 2019 yılı Ekim ayının ikinci yarısında Ankara da yapılması öngörüldüğü belirtilerek, söz konusu toplantıya yönelik hazırlık çalışmalarında yararlanılmak ve toplantı sonunda imzalanacak Protokolde yer almak üzere Türkiye-Kamboçya ilişkileri hakkında ele alınmasında fayda görülen konulara ilişkin bilgi talep edilmektedir. Toplantının hazırlıklarında kullanılmak ve Protokolde yer almak üzere, Kamboçya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin varsa görüşlerinizin en geç 23 Eylül 2019 Pazartesi günü mesai saati bitimine kadar Borsamıza (E-posta:eskisehirtb@gmail.com) iletilmesi hususunu bilgilerinize rica ederiz.
Türkiye-Gürcistan Ortak Gümrük Komitesi 2. Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden alınan 16.09.2019 tarih ve 9267 sayılı yazıda; T.C. Ticaret Bakanlığı tarafından, Gürcistan Gümrük İdaresi ile Ticaret Bakanlığı arasında tesis edilen Ortak Gümrük Komitesi nin ikinci toplantısının, 19 Kasım 2019 tarihinde Ankara da gerçekleştirilmesinin planlandığının bildirildiği, söz konusu toplantıda faydalanmak üzere Borsamız görüş ve önerileri talep edilmektedir. Bu kapsamda, konuya ilişin tespit, görüş ve önerilerinizi23 Eylül 2019 Pazartesi günü saat 12.00’yekadareskisehirtb@gmail.come-posta adresine gönderilmesi hususunu bilgilerinize sunarız.
Sayın Üyemiz, TMO tarafından yapılan kamuoyu açıklaması ve ayrıntıları linkte bilgilerinize sunulmuştur. http://www.tmo.gov.tr//Main.aspx?ID=20182 Bilgilerinize rica ederiz. Saygılarımızla
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden alınan yazıda, Türk Standartları Enstitüsü (TSE) tarafından ihracatçılarımızdan gelen talepler üzerine TSE’den alınan test raporu ve belgelerinin ilave şart aramadan yurt dışında kabul edilmesi amacıyla son dönemde farklı ülkelerdeki yetkili otoritelerle görüşmelerin yapıldığı belirtilmektedir. Yazıda devamla, Kuala Lumpur Ticaret Müşavirliği’nden alınan yazıya atıfla TSE’den bir heyetin, aktif ve pasif yangın malzemelerinde TSE tarafından yapılan testlerin tanınması amacıyla 2-5 Temmuz 2019 tarihlerinde Malezya’ya bir ziyaret düzenlediği, söz konusu ziyaret kapsamında yapılan görüşmeler sonucunda Malezya’ya yangın malzemeleri ihracatı yapacak firmalarımızın TSE’nin akreditasyonu kapsamında aldıkları belgelerin Yangın Güvenliği Kurumu (BOMBA) tarafından kabul edilmesine dair yetkilendirmenin alındığı ifade edilmektedir. Bu çerçevede, ekte yer alan belgeye göre, Malezya’da bulunan yerli veya yabancı firmaların pasif ve aktif yangın koruma sistemleri alımında bundan böyle TSE tarafından verilen test raporlarını tanıyabileceği belirtilmektedir. Bilgilerinize rica ederiz.
Sayın Üyemiz; TİGEM Dalaman Tarım İşletmesi Müdürlüğünden mahsül yağlık ayçiçeği satış ihalesi ile ilgili ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla,
Macaristan Hakkında
Sayın Üyemiz. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gönderilen yazıda;Sanayi ve Teknoloji Bakanı Sayın Mustafa Varank ile Macaristan Dışişleri ve Ticaret Bakanı Sayın Péter Szijjártó eşbaşkanlıklarında 25-26 Haziran 2019 tarihinde Budapeşte de gerçekleştirilen Türkiye-Macaristan 6. Dönem KEK Toplantısı sonrasında imzalanan Mutabakat Zaptında Türk-Macar Ortak Sanayi İşbirliği Komitesi II. Dönem Toplantısının 2019 yılı ikinci yarısında Budapeşte de düzenlenmesinin kararlaştırıldığı, bu bağlamda Macar yetkilileri ile yapılan görüşmelerde Türk-Macar Ortak Sanayi İşbirliği Komitesi nin II. Dönem Toplantısı nın 23-24 Eylül 2019 tarihleri arasında Macaristan ın Szeged şehrinde gerçekleştirileceği bildirilmektedir. Bu itibarla, Türk-Macar Ortak Sanayi İşbirliği Komitesi II. Dönem Toplantısının hazırlık çalışmalarındayararlanılmak ve toplantı sonrasında imzalanması planlanan Protokol metnine derç edilmek üzere Macaristanile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkanları, öncelik verilecek sektörler, ticaretingeliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 18 Eylül 2019Çarşamba günü mesai bitimine kadar Birliğimize (e-posta: seda.gedik@tobb.org.tr) iletilmesini rica ederim. Bilgilerinize sunarız. Saygılarımızla,
Endonezyalı Firmaların 88. İzmir Enternasyonal Fuarı’na Katılımı Hk.
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden (TOBB) alınan yazıda,6-10 Eylül 2019 tarihlerinde İzmir Kültürpark ta düzenlenmesi planlanan 88. İzmirEnternasyonal Fuarı na Endonezya tarafından katılım sağlanacağı ve anılan fuarda dokuz firma ile Hol2 de Endonezya standının açılacağı bildirilmektedir. Anılan yazıda devamla, fuarda yer alacak ve ürünlerini sergileyecek olan Endonezya firmalarının Türkfirmaları ile tanışmayı ve çalışma fırsatlarını değerlendirmeyi arzu ettikleri ifade edilmektedir. Bu çerçevede, gıda, kâğıt, tüketim, spor malzemeleri, bitkisel ürünler, baharatlar ve diğer Endonezyaürünleri hakkında bilgi edinmek ve Endonezyalı firmalar ile işbirliği yapmak isteyen firmalarımızEndonezya Standı na davet edilmektedir. Fuara katılan Endonezyalı firmalarının listesine Birliğimiz web sitesi (www.tobb.org.tr) sağ panelinde"Hizmetler" başlığı altındaki Uluslararası İş İmkânları/Yurtiçi Etkinlikler bölümünden teminedilebilmekte olup, 88. İzmir Enternasyonal Fuarı na ilişkin güncel bilgilerehttps://ief.izfas.com.tr/index.php/tr/web adresinden ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla,
Manila FAME Ticaret Fuarı, Filipinler
Sayın Üyemiz. Türkiye Odalar ve Borsalar Birliği’nden Borsamıza gönderilen yazıda; Filipinler Uluslararası Ticaret Sergileri ve Heyetleri Merkezi (CITEM) tarafından "70th Edition Manila Fame" Ticaret Fuarının 19-21 Ekim 2019 tarihlerinde Filipinler de Pasay şehri Uluslararası Ticaret Merkezinde düzenleneceği belirtilmektedir. Yazıda devamla, söz konusu ticaret fuarının mobilya, ev eşyaları, aydınlatma ürünleri, hediyelik ve süs eşyalar, aksesuarlar, iç mimari çözümleri, tekstil ve giyim gibi sektörleri kapsayacağı belirtilmektedir. Bu çerçevede, etkinliğe ilişkin güncel bilgilerehttp://www.manilafame.com/web adresinden ulaşılabilmekte olup, ayrıntılı bilgi için Filipinler Cumhuriyeti Ankara Büyükelçiliği ile (Mr. Froilan Pamintuan, Ticaret Ataşesi, E-posta:paris@dti.gov.ph;ankarape@gmail.com) temas kurulması mümkün olduğu belirtilmektedir. Bilgilerinize sunarız. Saygılarımızla,
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği’nden (TOBB) alınan yazıda, “2. Uluslararası Coğrafi İşaretli Ürünler Zirvesi”nin, “Anadolu’dan Dünya’ya” temasıyla 19-20-21 Eylül 2019 tarihlerinde Ankara Ticaret Odası Congresium International Convention & Exhibition Center’da yapılacağı bildirilmektedir. Söz konusu Zirve’ye ilişkin Ankara Ticaret Odası’nın duyuru yazısı ile Zirve’de yapılması planlanan ikili iş görüşmelerine katılım sağlayacak perakende firmalar-üretici ve çatı kuruluşların doldurulacağı formalar ekte sunulmaktadır. “2. Uluslararası Coğrafi İşaretli Ürünler Zirvesi”ne katılım için kayıt işlemlerinin www.cografiisaretlerzirvesi.comüzerinden yapılması hususunu bilgilerinize sunarız.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) alınan yazıda, Ticaret Bakanlığı’nın yazısına atfen, Bakanlık ile İran Gümrük İdaresi arasında, 7. Dönem Gümrük İdareleri Başkanları Toplantısı’nın, 2 Ekim 2019 tarihinde Tahran’da gerçekleştirilmesinin planlandığı bildirilmekte ve söz konusu toplantıda faydalanmak üzere güncel bilgi notuna ihtiyaç duyulduğu ifade edilmektedir. Bu kapsamda, TOBB’a iletilmek üzere, Borsamız görüş ve önerilerinin oluşturulmasını teminen, İran ile ilgili tespit, görüş ve önerilerinizin 16 Eylül 2019 tarihine kadar Borsamıza (eskisehirtb@gmail.com) gönderilmesi hususunu bilgilerinize sunarız.
Abhazya TSO ile işbirliği
Sayın Üyemiz, Türkiye Odalar veBorsalar Birliği’nden aldığımızyazıda; Dışişleri Bakanlığı’nın yazısı gereğiülkemizin, stratejik ortaklık ilişkisinesahipbulunduğu Gürcistan’ınbağımsızlığını, egemenliğini ve toprak bütünlüğünü desteklemekle ve Gürcistan’dan tektaraflı bağımsızlık ilan eden Abhazya ve Güney Osetya yönetimlerinin sözde bağımsızlıklarını tanımamakta olduğu belirtilmektedir. Öte yandan, ülkemizde yaşayan Abhaz /Oset kökenli vatandaşlarımızın anılan bölgelerle temasına ise insani saiklerle karşıçıkılmamakta olduğuifade edilmektedir. Buçerçevede, Abhazya veGüney Osetya’yı bağımsız ülkeler gibi tanıdığımız anlamına gelebilecek şekilde ilişki kurulmasından imtina edilmesinin, dolayısıyla AbhazyaTicaret ve SanayiOdası ile işbirliği tesis edilmemesinin (menfi) ve Abhazya’ya ziyaret düzenlenmemesininuygun olacağının değerlendirildiği bildirilmektedir. Bilgilerinize rica ederiz.
Sayın Üyemiz, Daha önce Togo’daki birçok hayali firmanın ülkemizdeki şirket ve şahıslara yönelik dolandırıcılık girişimlerinde bulunduğu genellikle Lome/Togo’da adres gösteren hayali firmaların ülkemizdeki şirketlere elektronik posta göndererek Lome’da yerleşik ECOWAS (Economic Community of Western African Countries) ve REDA (Regional Economic Development Agency) gibi kuruluşların ihale kapsamında ihtiyaçlarına yönelik firmalarımızdan teklif almaya çalıştıkları bildirilmiştir. Türkiye Odalar ve Borsalar Birliği’nden (TOBB) alınan yazıda, Dışişleri Bakanlığı’na Kotonu Büyükelçiliğimizden ulaşan yazıya atfen, bahse konu hayali firma ve şahısların şirketlerimize, benzer sahte belge ve kontrat örneklerini göndermeye devam ettiği, son dönemde anılan Büyükelçiliğimizin kurumsal elektronik elektronik posta adresine bu yönde gönderilen mesajlarda artış gözlemlendiği belirtilmekte ve herhangi bir durumda, şirketlerimizin Kotonu Büyükelçiliğimizle temasa geçebileceği ifade edilmektedir. Bilgilerinize rica ederiz.
KOBİ lere Yönelik Devlet Destekli Ticari Alacak Sigortası
Sayın Üyemiz, Birlik Başkanımız SayınM. RifatHisarcıklıoğlu’nun ısrarla takibi sonucunda hayata geçen ve KOBİ lerimizin öngörülmeyen tahsilat problemlerine karşı korunması yoluyla finansal yapılarının güçlendirilmesi, böylece asıl faaliyet alanlarına odaklanmalarını amaçlayan"KOBİ lere Yönelik Devlet Destekli Ticari AlacakSigortası"hakkındaKOBİ lere yönelik devlet destekli ticari alacak sistemine ilişkin farkındalığı artırmak amacıyla ekte yer alan bilgilendirme mektubunubilgilerinize rica ederiz. Saygılarımızla,
İran - 4. Asya Uluslararası Taşımacılık Fuarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği`nden Borsamıza iletilen yazıda,İran Yol ve Şehir Planlama Bakanlığınca, 4. Asya Uluslararası Taşımacılık, Lojistik ve İlgiliSanayi Fuarı nın, 15-17 Aralık 2019 tarihleri arasında Tahran da düzenleneceği bildirilmektedir. Fuara ilişkin detaylı bilgi http://iranroadtech.com/en/ adresinde yer almaktadır. Saygılarımızla,
İran - Gıda ve içecek mamullerine ilişkin sağlık sertifikası
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği`nden Borsamıza iletilen yazıda,İran Sağlık, Tedavi ve Tıbbi Eğitim Bakanlığınca, işlenmemiş (ham) hayvan ve deniz ürünleri dışında kalan gıda ve içecek mamulleri için sağlık sertifikası veren tek yetkili merciin "İran Gıda ve İlaç Kurulu" olduğunun bildirildiği belirtilmektedir. Saygılarımızla,
Türkiye-Romanya Karma Ekonomik Komisyon (KEK) 27. Dönem Toplantısı
Sayın Üyemiz, Ticaret Bakanlığı’nın yazısına atfen, Türkiye-Romanya Karma Ekonomik Komisyon (KEK) 27. Dönem Toplantısının, Cumhurbaşkanı Yardımcımız Sn. Fuat Oktay eşbaşkanlığında 1-2 Ekim 2019 tarihlerinde Ankara’da düzenleneceği belirtilmektedir. Bu kapsamda, söz konusu toplantı hazırlık çalışmalarında faydalanılmak üzere, Türkiye-Romanya ilişkilerine ilişkin karşılaşılan sorunlar ile çözüm önerilerini içeren bir bilgi notu talep edilmekte olup olabilecek görüşlerinizin 11 Eylül 2019 tarihi mesai bitimine kadar damla.tufan@tobb.org.tr adresine iletilmesi hususunu bilgilerinize sunarız. Saygılarımızla,
7. Irak Enerji Konferansı ve Fuarı
Sayın Üyemiz, "Business Glory Exhibitions Company" isimli firma tarafından 20-22 Nisan 2020 tarihlerinde Uluslarararası Bağdat Fuar Alanı nda "7. Irak Enerji Konferansı ve Fuarı"nın (7th Iraq Energy Exhibition and Conference)" düzenleneceği bildirilmektedir. Konuya ilişkin detaylı bilgiye eng.shahal@bg-iq.net eposta adresinden veya +9647905984770/+9647712782919 telefon numaralarından ulaşılabilmektedir. Saygılarımızla,
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) alınan yazıda, Ticaret Bakanlığı’nın yazısına atfen, Türkiye-Romanya Karma Ekonomik Komisyon (KEK) 27. Dönem Toplantısının, Cumhurbaşkanı Yardımcımız Sn. Fuat Oktay eşbaşkanlığında 1-2 Ekim 2019 tarihlerinde Ankara’da düzenleneceği belirtilmektedir. Bu kapsamda, söz konusu toplantı hazırlık çalışmalarında faydalanılmak üzere, Türkiye-Romanya ilişkilerine ilişkin karşılaşılan sorunlar ile çözüm önerilerini içeren bir bilgi notu talep edilmekte olup olabilecek görüşlerinizin 11 Eylül 2019 tarihi mesai bitimine kadar damla.tufan@tobb.org.tr adresine iletilmesi hususunu bilgilerinize sunarız. Saygılarımızla,
Plastik Poşet Uygulamaları
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği tarafından Borsamıza gönderilen 27.08.2019 tarih ve 8632 sayılı yazıda; Çevre ve Şehircilik Bakanlığı’nca hazırlanan 2872 Sayılı Çevre Kanunu’nun “Poşet Ücreti” başlıklı Ek-13’üncü maddesinde “Kaynakların verimli yönetimi ve plastik poşetlerden kaynaklanan çevre kirliliğinin önlenmesi amacıyla plastik poşetler satış noktalarında kullanıcıya veya tüketiciye ücret karşılığı verilir. Uygulanacak taban ücret 25 kuruştan az olmamak üzere Bakanlıkça oluşturulacak komisyon aracılığı ile belirlenir ve her yıl için güncellenir. Bu maddedeki düzenlemelere ilişkin usul ve esaslar Bakanlıkça belirlenir.” hükmünün yer aldığı ve bu hükme istinaden “Plastik Poşetlerin Ücretlendirilmesine İlişkin Usul ve Esaslar”ın yürürlüğe girdiği hatırlatılarak; Bu kapsamda, satış noktaları tarafından satılan plastik poşetlere ilişkin beyanların verilmesi ve geri kazanım katılım paylarının ödenmesi için tahakkuk eden miktarların ödenme sürelerinin 2872 Sayılı Çevre Kanunu’nca belirlenmiş olduğu, bahse konu beyanname ve ödeme işlemlerinin Hazine ve Maliye Bakanlığı Gelir İdaresi Başkanlığı tarafından yürütüldüğü ifade edilmekte olup; Bildirim ve beyan yükümlülüğünü zamanında ve/veya tam olarak yerine getirmediği tespit edilenlere 2872 Sayılı Kanunun 20’nci maddesinin (g) bendi, geri kazanım katılım payını ödemediği tespit edilenlere (z) bendi ve plastik poşetleri ücretsiz verdiği tespit edilen satış noktalarına ise (bb) bendi uyarınca idari para cezalarının verildiği, yanlış ve yanıltıcı beyanda bulunanlar hakkında ise adli süreç başlatıldığı hususları belirtilmektedir. Bilgilerinize rica ederiz.
Türkiye – Çek Cumhuriyeti Çalışma Yemeği
Sayın Üyemiz, Çek Cumhuriyeti Başbakanı Andrej Babiš’in ülkemizi ziyareti kapsamında Birliğimiz ev sahipliğinde, 3 Eylül 2019 Salı günü Türkiye Odalar ve Birliği (TOBB) İkiz Kulelerde “Türkiye – Çek Cumhuriyeti Çalışma Yemeği” gerçekleştirilecektir.​ Çek Cumhuriyeti Başbakanı Andrej Babiš’in beraberinde Çek Cumhuriyeti Ticaret ve Sanayi Bakanı Karel Havlícek, Çek Ticaret Odası Başkanı Vladimir Dlouhy ile Çek firmalarının iştirak edeceği Çalışma Yemeğini T.C. Ticaret Bakanımız Ruhsar Pekcan’ın da onurlandırmaları öngörülmektedir. Özellikle enerji, havacılık sanayi, otomotiv, motorlu taşıtlar ve tedarik sanayi, inşaat ve alt yapı, bankacılık ve finans, elektrik ve mühendislik sistemleri, lojistik ile ileri teknoloji alanlarında faaliyetleri bulunan Türk firmalarımız, Çek firmaları ile ikili görüşme gerçekleştirme imkânı bulacaktır. Söz konusu heyet listesi ve Türkiye-Çek Cumhuriyeti Çalışma Yemeği’ne ilişkin taslak programa ekte ulaşılabilmekte olup, Çalışma Yemeğine katılmak isteyen firmalarımızın katılımları içinhttp://tobbcek.tobb.org.tradresinde yer alan katılım formunu 30 Ağustos 2019 Cuma gününe kadar (tercihen İngilizce olacak şekilde) doldurarak kayıt yaptırması gerekmektedir. Bilgilerinize rica ederiz. Saygılarımızla,
Türkiye-Belarus Ticaret Çalışma Grubu Toplantısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği`nden Borsamıza iletilen yazıda, Türkiye-Belarus Hükümetlerarası Karma Ekonomik Komisyonu 10. Dönem Toplantısı çerçevesinde oluşturulan "Ticaret Çalışma Grubu"nun toplantısının, 23 Eylül 2019 tarihinde Ankara`da düzenlenmesinin planlanmakta olduğu bildirilmektedir. Söz konusu toplantı kapsamında kullanılmak üzere, Belarus ile ikili ticaretimizde ihracatçılarımızın karşılaştığı tarife ve tarife dışı engellerin yanı sıra, Belarus pazarına girişte karşılaşılan engellere ve varsa, engelleri aşmada göz önüne alınacak çözüm önerilerine ilişkin görüşlerinizieskisehirtb@gmail.com adresine bildirmenizi rica ederiz. Saygılarımızla,
Güçlü bir Ulusal Ekonomi için Fikri Mülkiyetin Rolü Zirvesi
Sayın Üyemiz, Milletlerarası Ticaret Odası (ICC) tarafından Borsamıza iletilen davette, ICC Türkiye Milli Komitesi, TOBB ve Ankara Üniversitesi işbirliğiyle, 7 Ekim 2019, Pazartesi günü Hilton İstanbul Bomonti Hotel & Conference Center’da, “Güçlü bir Ulusal Ekonomi için Fikri Mülkiyetin Rolü Zirvesi”nin düzenleneceği bildirilmiştir. Kayıt ve detaylı bilgi için konferans kayıt formununhttp://icc.tobb.org.tr/icctrfikrimulkiyetadresinden en geç 2 Ekim 2019 tarihine kadar doldurulması ve kaydın tamamlanmasını teminen konferans ücretinin kayıt formunda belirtildiği şekilde ödenerek dekontunun ICC Türkiye Milli Komitesi’ne bildirilmesi (faks/e-posta ile) gerekmektedir. Daha fazla bilgi için: ICC Türkiye Milli Komitesi Tel: +90 312 219 4254 (55-56-57) / Faks: 0.312.219 42 58 / E-posta:icc-tr@tobb.org.tr Saygılarımızla,
COSME Programı- Turizm Çağrısı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliğinden alınan yazıda, KOSGEB den alınan bir yazıya atfen; Türkiye ve Avrupa Komisyonu arasında İşletmelerin ve KOBİlerin Rekabet Edebilirliği Programı(COSME) anlaşmasının 16 Ekim 2014 tarihinde imzalandığı ve KOSGEB in, AB ve Dış İlişkiler Dairesi Başkanlığı COSME Programına ilişkin ulusal koordinatör olarak yetkilendirildiği bildirilmiştir. COSME Programı kapsamında, "Çok Uluslu İşbirliği ve Bilgi Transferi ile Sürdürülebilir Turizm Gelişimini ve Turizm Sektöründeki KOBİ lerin Kapasitesini Artırma- Boosting Sustainable Tourism Development and Capacity of Tourism SMEs through Transnational Cooperation and Knowledge Transfer" proje teklifi çağrısı yayımlanmış olup, söz konusu çağrıya ilişkin bilgiler ekte bilgilerinize sunulmuştur.
Plastik Poşetlerin Ücretlendirilmesi Uygulamaları
Sayın Üyemiz; Çevre ve Şehircilik Bakanlığının ilgili yazısında 09.01.2019 tarihli Makam Oluru ile taraflarınca yayımlanarak yürürlüğe giren ve 25.03.2019 tarihli Olur ile değişiklik yapılan “Plastik Poşetlerin Ücretlendirilmesine İlişkin Usul ve Esaslar” uyarınca plastik poşetlerin ücret karşılığında tüketici veya kullanıcı verildiği ifade edilmektedir. Bakanlığın yazısınıda, bu kapsamda, satışa tabii plastik poşetlere dair Plastik Poşetlerin Ücretlendirilmesine İlişkin Usul ve Esasların Geçici 4. Maddesinde yer alan “Bu Usul ve Esasların 5 inci maddesinin onuncu ve on birinci fıkrasındaki şartları sağlayan plastik poşetler en geç 30.06.2019 tarihinden itibaren satışa sunulur ve şartları sağlamayan plastik poşetlerin satışını izin verilmez.” hükmü dahilinde; Ücrete tabi plastik poşetlerin en az bir yüzeyinde çevreci slogan ve sıfır atık logosu kullanılması, Plastik poşetler de yer alan satış noktalarının marka ve logolarının bulunduğu yüzey (sap ve körükler hariç) alanın yüzde yirmisini geçmemesi, Sıfır atık logosunun Bakanlık web sayfasından temin edilen haliyle veya poşet rengine bağlı olarak görünür olması şartıyla tek renk olarak kullanılması ve Ücrete tabi plastik poşetlerin çift kat kalınlığının 40 mikron ve üzerinde olmasına dair esasların sağlanması, gerektiği bildirilmiştir. Bilgilerinize rica ederiz.
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nden alınan yazıda, KOSGEB den alınan bir yazıya atfen; Türkiye ve Avrupa Komisyonu arasında İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı(COSME) anlaşmasının 16 Ekim 2014 tarihinde imzalandığı ve KOSGEB in, AB ve Dış İlişkiler Dairesi Başkanlığı COSME Programına ilişkin ulusal koordinatör olarak yetkilendirildiği bildirilmiştir. COSME Programı kapsamında, "WEgate Platformunun Yönetimi Çağrısı - Management of WEgate Platform" proje teklif çağrısı yayımlanmış olup, söz konusu çağrıya ilişkin bilgiler ekte bilgilerinize sunulmuştur.
2019 Yılı yüksek öğrenim görecek öğrencilere vereceğimiz karşılıksız eğitim bursu başvuru şartları ekte bilgilerinize sunulmuştur.
Sayın Üyemiz Yöresel ürünlerin ticarete kazandırılması, tüketimlerinin yaygınlaştırılması, katma değerinin arttırılması, ve coğrafi işaret ile tescil ettirilerek standartlarının oluşturulması gibi amaçlarla YÖREX/Yöresel Ürünler Fuarının 23-27 Ekim 2019 tarihlerinde ANFAŞ/Antalya Fuar ve Kongre Merkezinde gerçekleştirilecek fuar hakkında tüm bilgilerehttp://www.yorexfuar.com/index.htmladresinden ulaşabilirsiniz. Bilgilerinize rica ederiz.
Sayın Üyemiz TMO tarafından yapılan kamuoyu açıklaması ve ayrıntıları linkte bilgilerinize sunulmuştur. http://www.tmo.gov.tr/Main.aspx?ID=19175 Bilgilerinize rica ederiz. Saygılarımızla
Saraybosna Helal Fuarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza iletilen 29.07.2019 tarih ve 7900 sayılı yazıda,bu sene ikincisi düzenlenecek olan Saraybosna Helal Fuarının, 26-28 Eylül 2019 tarihlerinde, Bosna Hersek Cumhurbaşkanlığı Konseyi Üyesi Sn. Sefik Dzaferovic in himayelerinde, Bosna Bank International, İslam Kalkınma Bankası ve Bosna Hersek Hükümeti işbirliğinde Saraybosna da gerçekleştirileceği bildirilmekte ve Türkiye den helal ürün üreticileri Fuara katılmak üzere davet edilmektedir. Fuara ilişkin detaylı bilgiye www.sarajevohalalfair.com linkinden ulaşılabilmektedir. Bilgilerinize rica ederiz. Saygılarımızla
Sayın Üyemiz; T.C. Tarım ve Orman Bakanlığınca; Kırsal alanda ekonomik ve sosyal gelişmeyi sağlamak, tarım ve tarım dışı istihdamı geliştirmek, gelirleri artırmak ve farklılaştırmak için kadın ve genç girişimciler öncelikli olmak üzere gerçek ve tüzel kişilerin ekonomik faaliyetlerine yönelik yatırımlara verilen yüzde 50 hibe desteği uygulamasına başvurular başlamıştır. Kırsal Kalkınma Yatırımlarının Desteklenmesi Programı kapsamında uygulanacak olan yatırımlara yönelik desteklemelerin usul ve esaslarını belirleyen "Kırsal Kalkınma Destekleri 13. Etap Kapsamında Tarıma Dayalı Yatırımların Desteklenmesi Hakkında Tebliğ (Tebliğ No: 2019/30)" 2 Ağustos 2019 tarihli ve 30850 sayılı Resmi Gazete de yayımlanarak yürürlüğe girmiştir. Başvuruların, Tebliğin yayımı tarihinden itibaren 60 gün içerisindewww.tarimorman.gov.trinternet adresinden yapılması gerekmektedir. 2019/30 sayılı Tebliğ için;www.resmigazete.gov.tr/eskiler/2019/08/20190802-14.htm
İş Dünyası için Kişisel Verilerin Korunması Kanunu’ na Uyum Kılavuzu
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği (TOBB) tarafından Borsamıza gönderilen 29.07.2019 tarih ve 7925 sayılı yazıda ; 6698 sayılı Kişisel Verilerin Korunması Kanunu (KVKK) kapsamında getirilmiş olan yükümlülükler dolayısıyla, ileride oluşabilecek mağduriyetlere sebebiyet verilmemesi açısından özellikle Veri Sorumluları Sicili’ ne kayıt firmalar için çok büyük önem arz etmektedir. Kanunu uygulamakla görevli olan Kişisel Verileri Koruma Kurumu ile yapılan görüşme ve yazışmalar neticesinde, pek çok gerçek ve tüzel kişi tacirin halen VERBİS’ e kayıt yükümlülüğünü yerine getirmediği, bu yükümlülüğün yerine getirilmemesi halinde söz konusu olabilecek cezai yatırımlar ile genel olarak Kanunla veri sorumlularına getirilen diğer yükümlülükler konularında bilgiler edinmeniz büyük önem arz etmektedir. Kişisel Verileri Koruma Kurulu’nun hazırlamış olduğu “İş Dünyası için Kişisel Verilerin Korunması Kanununa Uyum Kılavuzu” ekte sunulmuştur. Üyelerimize önemle duyurulur. Saygılarımızla.
AB COSME Programı Çağrı Duyurusu
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza iletilen 29.07.2019 tarih ve 7900 sayılı yazıda, Türkiye ve Avrupa Komisyonu arasında İşletmelerin ve KOBİ’lerin Rekabet Edebilirliği Programı (COSME) Anlaşması’nın 16 Ekim 2014 tarihinde imzalandığı, KOSGEB AB ve Dış İlişkiler Dairesi Başkanlığı’nın COSME Programına ilişkin ulusal koordinatör olarak yetkilendirildiği üzerinde durulmuştur. COSME Programı kapsamında, “Sosyal Ekonomi Misyonları-Social Economy Missions” proje teklifi çağrısının yayınlandığı belirtilmiştir. Söz konusu çağrıya ilişkin bilgiler ekte sunulmuştur. Bilgilerinize rica ederiz. Saygılarımızla
Geçit Kuşağı Tarımsal Araştırma Enstitüsüne ait sap satışına ait ihale ilanı
Sayın üyemiz Geçit Kuşağı Tarımsal Araştırma Enstitüsü Döner Sermaye İşletmesine ait sap satışına ait ihale ilanı ile ilgili gerekli bilgiler ekte bilgilerinize sunulmuştur.
1. Türk Odalar Birliği Genel Kuruluna Davet
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği’nden (TOBB) Borsamıza gönderilen yazıda; Türk Dili Konuşan Ülkeler İşbirliği Konseyi (Türk Keneşi) bünyesinde, 17 Mayıs 2019 tarihinde Kazakistan’m başkenti Nur-Sultan’da Türk Ticaret ve Sanayi Odası/Türk Odalar Birliği (Turkic Chamber of Commerce and Industry) kurulmuştur. Türkiye Odalar ve Borsalar Birliği ile birlikte, Azerbaycan İşverenler Konfederasyonu, Kazakistan Ulusal Girişimciler Odası, Kırgız Cumhuriyeti Ticaret ve Sanayi Odası Türk Odalar Birliği üyeleridir. Türkmenistan ve Özbekistan ise henüz üye olmayıp, söz konusu etkinliklere katılım sağlamaktadır. Türk Ticaret ve Sanayi Odası, genel olarak, Ülkemiz ile Azerbaycan, Kazakistan, Kırgız Cumhuriyeti, Türkmenistan ve Özbekistan arasındaki karşılıklı ticaret ve yatırım ilişkilerinin gelişimine destek olmak amacıyla kurulmuştur. Türkiye Odalar ve Borsalar Birliği (TOBB) ev sahipliğinde 31 Temmuz 2019 tarihinde gerçekleştirilecek, Türk Ticaret ve Sanayi Odası (Turkic Chamber of Commerce and Industry) 1. Genel Kurul’unda, Oda’nın Başkanı seçilecek, Oda Genel Sekreteri atanacak ve böylece Oda işlevsel hale gelecektir. Söz konusu etkinliğe katılmayı düşünen firmalarımızın en geç 29 Temmuz 2019 tarihine kadar adem.kula@tobb.org.tr mail adresine başvurması gerekmektedir. Saygılarımızla,
17. Türkiye Çin Dönem KEK Toplantısı
Türkiye Odalar ve Borsalar Birliği’nden Borsamıza iletilen 22.07.2019 tarih ve 7713 sayılı yazıda,İlgide kayıtlı yazıda, Eşbaş