"Hiçbir şeye ihtiyacımız yok, yalnız bir şeye ihtiyacımız vardır; çalışkan olmak!" M.Kemal Atatürk
24 Ekim 2021 Pazar

Tüm Duyurular

Ortak Küme Girişimleri
Sayın Üyemiz, KOSGEB Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığından alınan 13.10.2021 tarih ve E-60014838-746.99-7157 sayılı ve "Ortak Küme Girişimleri (EUROCLUSTERS) Çağrısı" proje teklif çağrısı konulu yazı ektedir. Söz konusu çağrıya yönelik olarak, ekli gündem doğrultusunda 25-26 Ekim 2021 tarihlerinde, online eğitim düzenlenecektir. Eğitime, https://cosme.kosgeb.gov.tr adresinden erişilebilecek kayıt formu aracılığıyla gerekli bilgiler girilerek katılım sağlanacaktır. Çağrı için özet bilgiye; https://cosme.kosgeb.gov.tr/cosme-cagrilari, detaylı bilgiye ise https://ec.europa.eu/easme/en/section/cosme/cosme-open-calls-proposals adresi aracılığıyla ulaşılabilir Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Tüm Yönleriyle Teknik İflas ve Alınması Gereken Önlemler Eğitimi
Sayın Üyemiz, İş dünyasının temsilcileri, bireysel ve kurumsal yatırımcılara yönelik olarak internet üzerinden "Tüm Yönleriyle Teknik İflas ve Alınması Gereken Önlemler Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. Bu eğitim ile iflas hakkında genel mahiyette kısa bilgiler verildikten sonra; iflas nedenleri, kimlerin iflasa tabi olduğu, iflas yolları (takipli ve doğrudan iflas), iflas kararı ve kararın borçlu ve alacaklılar bakımından ne gibi sonuçlar doğuracağı, iflas masasının oluşması, masaya alacak yazdırılması, iflasta rehinli alacaklıların durumu, iflas idaresi, alacaklara ilişkin sıra cetveli ve buna karşı koyma yolları, iflasın kaldırılması ve kapanması ile iflas takibi başlamadan ya da iflas davası açılmadan önce iflastan korunma yolları ile iflas ve konkordato ilişkisi üzerinde durulacaktır. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Sayın Üyemiz; TMO web sitesinden yapılan açıklamadalinktebilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-Bulgaristan İş Forumu, 1 Kasım 2021
Sayın Üyemiz, Birliğimiz ve Bulgaristan Ticaret ve Sanayi Odası işbirliğinde, 1 Kasım 2021 tarihi, 11:00-13:15 saatleri arasında, zoom üzerinden, Pandemi Sonrası Ekonomik İlişkilerin Canlandırılması temalı Türkiye-Bulgaristan İş Forumu gerçekleştirmesi planlanmaktadır. Taslak programı ekte iletilen İş Forumu nda, Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu ve Bulgaristan Ticaret ve Sanayi Odası Başkanı Tsvetan Simeonov un yanı sıra, iki ülkenin Büyükelçileri de katılımcılara hitap edecektir. Etkinliğin katılım formu aşağıda verilen internet adresinde yer almaktadır. İş Forumu nun son oturumunda söz almak isteyen firmalar kendilerini tanıtabilecek ve soru-cevap kısmında sorularını iletebileceklerdir. Bilgilerinizi rica ederim. Saygılarımla, Katılım için: tobb-org.zoom.us/webinar/register/WN_Cbzstw7lSmq2wDXYnSYGRw
Yurt İçi fuar Duyuruları
Sayın Üyemiz, 2022 Yılı Ana Fuar Takvimi 18 Ekim 2021 tarihli Ticaret Sicil Gazetesinde ve Birliğimizin internet sayfasında yayımlanmıştır. Ayrıntılı bilgiye https://www.tobb.org.tr/FuarlarMudurlugu/Sayfalar/AnaSayfa.php adresinden ulaşılabilmektedir. Bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
Gürcistan - Rusya Sınırındaki İnşaat Çalışmaları hk.
Sayın Üyemiz, Gürcistan - Rusya arasındaki Zemo-Larsi gümrük geçiş noktasının Rusya tarafında gerçekleştirilen inşaat çalışmaları nedeniyle Rusya nın yeterli sayıda yük taşıtının geçiş işlemini gerçekleştiremediği bildirilerek Türk nakliye firmalarının alternatif gümrük geçiş noktalarını (Tsiteli Khidi - Siniq Korpu Kırmızı Köprü ve/veya Lagodekhi - Mazimchay) kullanmalarının tavsiye edildiği belirtilmektedir. Söz konusu notada yer verilen hususların Ticaret Bakan Yardımcısı Rıza Tuna TURAGAY ın 8 Ekim 2021 tarihinde İzmir de Gürcü ve Azerbaycanlı muhataplarıyla yaptığı toplantıda gündeme getirildiği, söz konusu görüşmeler çerçevesinde Azerbaycan Devlet Gümrük Komitesi Başkanı Safar MEHDİYEV in, Gürcistan dan Rusya ya geçişte yaşanan sorunların çözümüne yardımcı olmak adına Azerbaycan Cumhuriyeti olarak Türk taşımacıların ve ihracatçıların Gürcistan yerine Azerbaycan rotasını kullanmaları hususunda gerekli yardımı ve desteği sağlamaya hazır olduklarını ifade ettiği bildirilmektedir. Ayrıca söz konusu hususun, Ticaret Bakanlığımız tarafından Rus yetkili makamlarıyla yapılan ve yapılacak olan toplantılarda da gündeme getirilmekte olduğu ifade edilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Tek Pazar Programı – Ortak Küme Girişimleri (EUROCLUSTERS) Çağrısı
Sayın Üyemiz, Tek Pazar Programı–Ortak Küme Girişimleri (EUROCLUSTERS) Çağrısı ile ilgili yazı ekte yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Türkiye-Yunanistan Ticari ve Ekonomik İşbirliği Çalışma Grubu
Sayın Üyemiz, Ülkemiz ile Yunanistan arasında Ticari ve Ekonomik İşbirliği Çalışma Grubu Toplantısı nın 26 Ekim 2021 tarihinde düzenleneceği bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Yunanistan ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 19 Ekim 2021 Salı günü mesai bitimine kadar Birliğimize (sila.kozanli@tobb.org.tr) iletilmesi gerekmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İspanya Hak. Görüş
Sayın Üyemiz, Türkiye-İspanya 7. Hükümetler arası Zirve nin, Sayın Cumhurbaşkanımız eş başkanlığında 17-18 Kasım 2021 tarihlerinde ülkemizde düzenleneceği bildirilmektedir. Bu itibarla, bahse konu toplantının hazırlıklarında kullanılmak üzere, İspanya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin varsa görüşlerinizin en geç 26 Ekim 2021 Salı günü saat 12.00’ye kadar Borsamıza (E-posta: egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türk KOBİ’leri için Enerji Verimliliği Eğitimi
Sayın Üyemiz, Türk KOBİ’lerine yönelik TEBD Enerji Verimliliği Eğitimi; 21 Ekim 2021 tarihinde Türkiye-Avrupa Birliği İş Diyaloğu (TEBD) Projesi kapsamında; Türkiye Odalar ve Borsalar Birliği (TOBB) ile Avrupa Ticaret ve Sanayi Odaları Birliği (EUROCHAMBRES) tarafından Avrupa Birliği ülkelerindeki deneyimli uzmanlar ile iş birliğinde düzenlenecektir. Etkinlik, enerji verimliliği konusunda farkındalık yaratmak amacı ile Türk Odaları için gerçekleştirilen TEBD Enerji Verimliliği Denetimi programının devamı niteliğinde düzenlenecektir. TEBD enerji verimliliği eğitimi; KOBİ lere enerjinin verimli kullanımından bahsederek nasıl daha rekabetçi konuma gelecekleri konusunda tavsiyelerde bulunacak, enerji verimliliğinin örnekleri, yasal gereklilikleri ve çok daha fazlası gündeme getirilecek. Program ve kayıt linki; https://us06web.zoom.us/webinar/register/WN_nZcMGgciScy6GCUymsblhg PROGRAM • 10:00 – 10:05 TRT – Açılış • 10:05 – 10:10 TRT – Enerji Verimliliği Uzman Ekibinin Tanıtılması • 10:10 – 11:30 TRT – Enerji Verimliliği Hakkında Bilinmesi Gerekenler • 11:40 – 12:30 TRT – Avrupa’da Enerji Verimliliği Etkinlik boyunca Türkçe ve İngilizce simultane çeviri yapılacaktır. Saygılarımızla,
Akkuyu Nükleer Santrali İhaleleri Bilgilendirme Semineri
Sayın Üyemiz; "Akkuyu Nükleer Santrali İhaleleri Bilgilendirme Semineri" 26 Ekim 2021 Salı günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Enerji ve Tabii Kaynaklar Bakanlığı, Türkiye Odalar ve Borsalar Birliği ve Akkuyu Nükleer Santrali A.Ş. işbirliğinde gerçekleştirilecek olan; "Akkuyu Nükleer Santral Projesi nde İhalelerin Takibi ve Tedarikçi Olmak İçin Yapılması Gerekenler" konulu seminerde; projede yerli katkının artırılması açısından potansiyel Türk tedarikçilerin Akkuyu NGS Projesi ve ihale kurallarıyla ilgili bilgilendirilmesi ve ana yüklenici ile bir araya getirilmesi amaçlanmaktadır. Seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Helal Belgelendirme Destekleri
Sayın Üyemiz; Dünya genelinde helal belgelendirmesi alanında güvenilir bir akreditasyon mekanizması kurulması, ihracatçıların pazara güvenilir ürünlerle girmesi ve "Türk Malı" ibareli ürünlerin itibar kazanmasını teminen yapılan çalışmalar neticesinde Helal Akreditasyon Kurumu tarafından akredite helal belgeleri, Ticaret Bakanlığı nın 2014/8 sayılı "Pazara Giriş Belgelerinin Desteklenmesine İlişkin Karar"ı kapsamına alınmıştır. Helal Akreditasyon Kurumu tarafından akredite edilmiş kurum ve kuruluşların listesine Ticaret Bakanlığı nın pazara giriş desteklerine ilişkin internet adresinden (ticaret.gov.tr/destekler/ihracat-destekleri/tebligbazinda-destek-mevzuati/2014-8-sayili-pazara-giris-belgelerinin-desteklenmesine-iliskin-karar/destek-1-pazara-giris-belgeleri) erişim sağlanabilmektedir. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-14.10.2021
Sayın Üyemiz, İlgi : 01.10.2021 tarihli ve E-10823049-202.01.01-536854 sayılı yazı. İlgi yazımızın genel hükümler kısmında Ekim ayı satışları için "TMO ELEKTRONİK SATIŞ PLATFORMU üzerinden satışı yapılacak ürünler ile Şube Müdürlükleriniz kanalıyla dağıtımı yapılacak ürünler için Tarihleri 04 Ekim – 12 Ekim (dahil) 2021 (Saat 17.00 a kadar) arasında talep toplanacaktır" denilmektedir. Bu defa sadece besici ve yetiştiricilere yapılacak olan arpa satışlarında son başvuru tarihi 14 Ekim 2021 tarihi saat 17.00 olarak yeniden belirlenmiştir. Diğer hususlarda cari talimatımızda belirtilen fiyat, usül ve esaslar dâhilinde hareket edilecektir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
"Türk Patent ve Marka Vekilliği Dünyasının Geleceği" Webinarı - 22 Ekim saat 14.30
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği Türkiye Patent ve Marka Vekilleri Meclisi tarafından22 Ekim 2021 tarihinde saat 14.30 da"Türk Patent ve Marka Vekilliği Dünyasının Geleceği" isimli bir seminer gerçekleştirilecektir. Toplantıyahttp://webinar.tobb.org.tradresinde yer alan linkten erişim sağlanabilecektir. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tedarikçi Yönetimi ve Tedarikçi Risk Yönetimi Semineri
Sayın Üyemiz; TOBB Tedarikçi Geliştirme Programı kapsamında, Tedarikçi Yönetimi ve Tedarikçi Risk Yönetimi Toplantısı 21 Ekim 2021 Perşembe günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; iş dünyasının beklentilerine katkıda bulunmak amacıyla tedarik zinciri yönetimi prensipleri ve iyi uygulamaları, tedarik zinciri yönetim uygulamalarındaki ihtiyaçlar anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yeşil Dönüşüme Nasıl Ayak Uyduracağız? -Webinar (Tarım ve Hayvancılık)
Sayın Üyemiz, Birliğimiz ve Horizon danışmanlık firması işbirliği ile gerçekleştirilecek olan "Yeşil Dönüşüme Nasıl Ayak Uyduracağız?" webinarı 14 Ekim 2021 tarihinde saat 14:00 te tarım ve hayvancılık sektörü özelinde gerçekleştirilecektir. Konuyla ilgili ayrıntılı bilgiyewebinar.tobb.org.tr/ adresinden ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla,
Sayın Üyemiz, İlimizdeki sanayi,ticaret ve esnaf kuruluşları başta olmak üzere kurum ve kuruluşlarımızın ihtiyaçlarının karşılanması ve mesleki eğitimin yaygınlaştırılması amacıyla Milli eğitim Bakanlığı nın onayı ile Gazi Mesleki ve Teknik Anadolu Lisesi bünyesinde Mesleki eğitim merkezi programı açılmıştır. Okulda, tüm kişi, kurum ve işletmelerin ihtiyaçlarını karşılamaya yönelik olarak çıraklık, kalfalık, usta öğreticilik eğitimleri, mesleki kurslar, kalfalık, ustalık sınavları faaliyetleri başlamıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
İran a ait Eyalet Tanıtım Kartları
Sayın üyemiz, İran da bulunan 31 eyaletin (Ostan) tamamı için Tebriz ve Urumiye Ticaret Ataşeliklerimizin de katkılarıyla, Ostan (İran Eyaleti) Tanıtım Kartları oluşturulduğu ifade edilmektedir. Ostan Tanıtım Kartları nda her bir eyaletin nüfusu, sosyoekonomik gelişmişlik seviyesi, sanayi bölgeleri, hizmet sektörleri, dış ticaretindeki önde gelen ürün ve ülkeler bulunmakta olup kartların İran daki yatırımcılarımızın çalışmalarını kolaylaştırması, eyaletlere yatırım veya iş seyahati yapmak isteyenler için genel bir perspektif vermesinin hedeflendiği belirtilmektedir. Söz konusu kartlara ticaret.gov.tr/yurtdisi-teskilati/guney-asya/iran/raporlar/musavirlik-raporlariadresinden ulaşılabilir. Bilgilerinize sunarız.
HepsiTürkiye den Eğitim Programı
Sayın Üyemiz, Yöresel ürünlerimizin; ticarete kazandırılması, tüketimlerinin yaygınlaştırılması, katma değerlerinin artırılması ve coğrafi işaret ile tescil edilerek standartlarının oluşturulması gibi amaçlarla "Sizin Oraların Nesi Meşhur" sloganıyla bu yıl on birincisini düzenleyeceğimiz YÖREX-Yöresel Ürünler Fuarı 20-24 Ekim 2021 tarihlerinde ANFAŞAntalya Fuar ve Kongre Merkezi nde gerçekleştirilecektir. TOBB ve Hepsiburada iş birliğiyle gerçekleştirilen coğrafi işaretlerin e-ticaretine yönelik HepsiTürkiye den projesi kapsamında coğrafi işaret üreticileriyle bir araya gelinerek proje hakkında bilgilendirme yapılacak ve eğitim verilecektir. "HepsiTürkiye den Eğitim Programı" 22-23-24 Ekim tarihlerinde her gün saat 11:00 ve 14:00 de Anfaş Fuar Merkezi Hall 1 Etkinlik alanında gerçekleştirilecektir. Bilgilerinize rica ederiz. Program içeriği; - Yerelden Ulusala e-ticaret desteği - HepsiTürkiye den hedefleri - Dijital Dönüşüm Desteği - Coğrafi İşaretli Ürünler - HepsiTürkiye den lansman özel fırsatları - Hepsiburada ile e-ticaret adımları
Soğuk Zincir Finansal Kiralama Destek Programı
Sayın üyemiz, Sebze ve meyve zayiatının azaltılması için soğuk zincir oluşturulmasını temin etmek amacıyla Bakanlığımız ile Hazine ve Maliye Bakanlığı arasında yürütülen çalışmalar sonucunda, Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı tarafından toptancı hallerinde faaliyet gösteren tüccar, komisyoncu meslek mensupları ile sebze ve meyve taşımacılığı yapan lojistik firmalarının desteklenmesi kapsamında “Sebze ve Meyve Soğuk Zincir Finansal Kiralama Destek Programı” yürürlüğe konulmuştur. Söz konusu destek programı kapsamında, “Küçük ve orta ölçekli işletmelerin, sebze ve meyve zayiatını azaltmak üzere soğuk zincir oluşturmaları sürecinde, finansal kiralama yöntemiyle temin edecekleri, yerli malı ve yeni soğuk hava ünitesi ve/veya soğutucu frigorifik kasa/ünite yatırımları için finansal kiralama faiz/ kâr payı masraflarına katkı sağlanması.” amaçlanmakta olup, desteğe başvuru kosgeb.gov.tr internet adresi üzerinden yapılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Port Sudan Limanı nın ve Hartum a Bağlanan Karayolunun Kapanması
Sayın üyemiz, Doğu Sudan ın Beja Kabileleri üyelerinin, bölgedeki siyasal otorite boşluğu ve kötü ekonomik koşulları protesto etmek için Port Sudan Limanı ndaki faaliyetlerin durmasına sebebiyet verecek şekilde bir isyan başlattıkları bildirilmektedir. Anılan isyan çerçevesinde, Hartum a bağlanan anayolu kapattıkları ve söz konusu limanın kapanmasından önce limana indirilmiş konteynerlerin gümrük işlemlerinin gerçekleştirilememesi nedeniyle büyük miktarlarda demuraj masraflarının oluştuğu bildirilmektedir. Yazıda devamla, ihracatçılarımızın, mal teslimi yapan acentalar ile mücbir sebep durumundan dolayı yeniden bir değerlendirme yapılmasını talep etmelerinde ve Sudan daki durumu takip ederek yükleme yapmalarında fayda görüldüğü belirtilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
ICC SME360X” KOBİ’ler için Çevre Üzerindeki Etkilerini Ölçme ve Değerlendirme Platformu
Sayın üyemiz, Türkiye Odalar ve Borsalar Birliği (TOBB) çatısı altında faaliyet göstermekte olan Milletlerarası Ticaret Odası (ICC) Türkiye Milli Komitesi, 1934 yılından bu yana, ülkemizde ICC nin temsilciliğini üstlenmektedir. ICC nin küresel ağı, 100 den fazla ülkede 6 milyonun üzerindeki teşebbüs, ticaret odaları ve meslek birliklerini kapsamaktadır. 92 ülkede Milli Komitesi bulunan ICC nin en etkili Milli Komitelerinden biri olan Türkiye Milli Komitesi güçlü ve köklü bir Milli Komite olarak uzun yıllardır faaliyetlerini sürdürmektedir. Türkiye nin önde gelen hukuk büroları, bankaları, firmaları, iş dünyası kuruluşları ve ticaret odaları dahil olmak üzere 250 den fazla üyeyi temsil etmektedir. ICC Türkiye Milli Komitesi, Türk iş dünyasının uluslararası çalışmalarına katkı sağlamak hedefiyle, başta tahkim, bankacılık, gümrük, rekabet, dijitalleşme, fikri mülkiyet ve dış ticaret olmak üzere ICC nin faaliyet gösterdiği alanlarda faaliyetlerini sürdürmektedir. ICC nin bir girişimi olarak, Sürdürülebilir Kalkınma Hedefleri (SDG) İş Dünyası Forumu yla eş zamanlı olarak SME360X Platformunun açılışı yapılmıştır. KOBİ ler için Çevre Üzerindeki Etkilerini Ölçme ve Değerlendirme Platformu; KOBİ lerin dijital ekonomiye dahil edilmesi ve büyümelerine, ticaret yapmalarına ve dirençli olmalarına yardımcı olmayı amaçlamaktadır. SME360X; KOBİ lerin çevre üzerindeki etkilerini ölçmeleri ve değerlendirmeleri için dijital bir değerlendirme aracıdır. Bir KOBİ, temel ortam verilerini SME360X e girdikten sonra, platform otomatik olarak küresel bir kıyaslama sistemine dayalı olarak tahmini bir sürdürülebilirlik puanı ve değerlendirme sağlamaktadır. KOBİ lerin daha çevreci ve daha rekabetçi olmasını amaçlayan SME360X platformunun tanıtım broşürü ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Teknoloji Odaklı Sanayi Hamlesi Programı Dijital Dönüşüm Çağrısı Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz organizasyonunda, 12 Ekim 2021 Salı günü saat 14:30 da internet üzerinden, "Teknoloji Odaklı Sanayi Hamlesi Programı Dijital Dönüşüm Çağrısı Bilgilendirme Webinarı" düzenlenecektir. Seminere ilişkin davet ekte sunulmaktadır. Sanayi ve Teknoloji Bakanlığı, Türkiye Odalar ve Borsalar Birliği ve Organize Sanayi Bölgeleri Üst Kuruluşu iş birliğinde gerçekleştirilecek olan webinarda Teknoloji Odaklı Sanayi Hamlesi Programı kapsamında teknoloji tedarikçilerine yönelik olarak ilan edilen ve dijital dönüşüm alanında 188 ürün ve 54 yenilikçi teknoloji yatırımını destekleyen Dijital Dönüşüm Çağrısı anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
11.YÖREX İkili İş Görüşmeleri
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nin desteğinde Antalya Ticaret Borsası organizasyonunda 20-24 Ekim 2021 tarihlerinde Antalya da 11.YÖREX–Yöresel Ürünler Fuarı düzenlenecektir. Coğrafi işaretli ve yöresel ürünlerin ekonomiye kazandırılması, iş bağlantılarının kurulması ve geliştirilmesi amacı ile YÖREX in düzenlendiği fuaye alanında yer alan Türkiye Odalar ve Borsalar Birliği ile ulusal market zincirleri, e-ticaret siteleri ve restoran zincirlerinin stantlarında yapılacak olan ikili iş görüşmeleri (B2B eşleştirme) programına katılmak isteyen üyelerinizin /katılımcılarınızın/ ziyaretçilerin https://yorex.com.tr/b2b/adresinde yer alan başvuru formunu doldurmaları gerekmektedir. Görüşmeye katılacak firmalar: CARREFOURSA MİGROS METRO ÖZDİLEK TRENDYOL PTT AVM HEPSİBURADA GİTTİGİDİYOR GETİR ONEDİO Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Yöneticiler İçin Vergi Eğitimi
Sayın üyemiz, İş dünyasının temsilcileri, bireysel ve kurumsal yatırımcılara yönelik olarak internet üzerinden "Yöneticiler İçin Vergi Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. Bu eğitim ile güncel vergi düzenlemeleri hakkında bilgi sahibi olunmasının sağlanması, mevzuatta yer alan önemli ve özellikli konuların incelenerek uygulamada karşılaşılabilecek sorunların çözümüne katkıda bulunulması, olası vergi incelemeleri öncesinde ve sonrasında süreç yönetiminin aktarılması amaçlanmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Türkiye-Macaristan 5. Dönem YDSK Toplantısı
Sayın Üyemiz, Türkiye-Macaristan 5. Dönem Yüksek Düzeyli Stratejik İşbirliği Konseyi (YDSK) Toplantısının, Cumhurbaşkanımız Sayın Recep Tayyip Erdoğan ve Macaristan Başbakanı Sayın Viktor Orban eşbaşkanlıklarında 11 Kasım 2021 tarihinde ülkemizde gerçekleştirilmesi planlandığı ve söz konusu toplantıya Ticaret Bakanımız Sayın Mehmet Muş un da iştirak etmesi öngörüldüğü belirtilerek, toplantının hazırlık çalışmalarında yararlanılmak üzere, ülkemiz ile Macaristan arasındaki ilişkilere dair Birliğimizin görev ve yetki alanına giren konular ile ilgili güncel bilgi notuna ihtiyaç duyulduğu ifade edilmektedir. Bu itibarla, bahse konu toplantının hazırlıklarında kullanılmak üzere, Macaristan ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin görüşlerinizin en geç 18 Ekim 2021 Pazartesi günü saat 12.00 ye kadar Borsamıza (E-posta:egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederim. Gültekin Güler Genel Sekreter
ABD - İran Yaptırımları Hk. Güncel Bilgi Notu
Sayın Üyemiz, Amerika Birleşik Devletleri Ankara Büyükelçiliği nin ilgide kayıtlı e-posta yazısında yer alan ve ABD nin İran a uyguladığı yaptırımları konu alan bilgi notunun ilgili bölümleri ekte iletilmektedir. Konuyla ilgili Ticaret Bakanlığımızdan alınan görüşte, ülkemizi hukuken yalnızca Birleşmiş Milletler kararları bağlamakla birlikte, ABD nin yaptırım kararlarının denizaşan etkilerinin de söz konusu olabileceği ifade edilmektedir. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
Rusya Federasyonu Tula Bölgesi temsilcilerinin ziyareti
Sayın Üyemiz, Rusya Federasyonu Tula Bölgesi Ekonomik Kalkınma Bakanı Pavel Tatarenko ile Sanayi ve Ticaret Bakanı Vyacheslav Romanov un, 21 Ekim 2021 Perşembe günü Ankara ya bir ziyaret düzenleyeceği belirtilmektedir. Tula Bölgesi, Moskova ya 180 kilometre mesafede konumlanması sebebiyle stratejik, lojistik ve ulaşımı kolay konuma sahip olmakla birlikte, 1.5 milyon nüfusu ve eğitimli iş gücüyle ülke ekonomisinin önemli lokomotiflerinden biridir. Tula Bölgesi özellikle sanayi üretimiyle ön plana çıkmakta olup, Bölgede makine inşası, kimya endüstrisi, metalürji, gıda sanayi, kömür madenciliği ve askeri-sanayi kompleks inşası setkörlerinde büyük aktörler yer almaktadır. Bu çerçevede, Birliğimizce, 21 Ekim 2021 Perşembe günü, 11.00-12.00 saatleri arasında, TOBB Sosyal Tesisler Toplantı Salonu nda, Tula Bölgesi Tanıtım Etkinliği düzenlenecektir. Etkinlikte Türkçe-Rusça tercüme hizmeti bulunacak olup, etkinliğe katılmayı arzu edenlerin ekteki katılım formunu Birliğimize eposta (kaan.gaffaroglu@tobb.org.tr) ile iletmeleri gerekmektedir. Etkinliğe katılmak için 2 aşı olunduğunu belirten belge veya 72 saatlik PCR testi talep edilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, TMO Yem Regülasyon Çalışmasına dair yapılan kamuoyu açıklamasına ulaşmak için tıklayınız. Saygılarımızla,
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında) - 04.10.2021
Sayın Cumhurbaşkanımızın Togo Ziyareti
Sayın Üyemiz, Sayın Cumhurbaşkanımızın 20 Ekim 2021 tarihinde Togo ya resmi bir ziyaret gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bahse konu ziyaretin hazırlık çalışmalarında yararlanılmak üzere Togo ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 4 Ekim 2021 Pazartesi günü mesai bitimine kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederim. Genel Sekreter Gültekin Güler
Temel Göstergeler Işığında Türkiye Ekonomisi ve Finansal Piyasaları Eğitimi
Sayın Üyemiz, İş dünyasının temsilcileri, bireysel ve kurumsal yatırımcılara yönelik olarak internet üzerinden "Temel Göstergeler Işığında Türkiye Ekonomisi ve Finansal Piyasaları Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. Türkiye piyasalarına yabancı girişlerinin tekrar başladığı bir dönemde, iş dünyasının ve yatırımcıların dikkat etmesi gereken hususlar üzerinde durulacaktır. Böyle bir konjonktürde; iş dünyasının ve yatırımcıların ekonomik göstergeleri doğru okuması, finans piyasalarının mekanizmasını anlamaları büyük önem arz etmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Birleşik Krallık a İhracatta Karşılaşılan İhracat Engellerinin İhracat Performansı Üzerindeki Etkisi Üzerine Yürütülen Anket Çalışması
Sayın Üyemiz, Birleşik Krallık a ihracat yapan "Motorlu Araçlar ve Aksam Parçaları", "Makine, Elektrikli Makine, Kablo", "Tekstil Hazır Giyim", "Kıymetli Metaller", "Plastik ve Mamulleri", "Mobilyalar, Aydınlatma Cihazları", "Tıbbi Cihazlar" başta olmak üzere ilgili tüm sektörlerde yer alan ihracatçı firmaların karşılaştığı ihracat engellerinin belirlenerek, ihracat performansı ile arasındaki ilişkinin bir anket çalışması ile ortaya konulmasının amaçlandığı ifade edilmiştir. E-postada devamla, anketin işletme yöneticisi ya da ihracat birim sorumlusu tarafından değerlendirilerek, en uygun olan cevabın işaretlenmesi talep edilmektedir. Ayrıca, anket soruları üzerinden güvenilir sonuçlara ulaşılabilmesi için cevapların gerçeği yansıtır nitelikte ve eksiksiz olmasının gerektiği vurgulanmıştır. Bu itibarla, Odanızın/Borsanızın ilgili üyelerinin https://anketler.ticaret.gov.tr/index.cfm?ID=95 linki üzerinden 22 Ekim 2021 tarihine kadar anketi eksiksiz olarak doldurması gerekmektedir. Bilgilerinizi ve gereğini rica ederiz. Not-1: Cevaplar toplu olarak değerlendirileceğinden lütfen isim ve iletişim bilgilerini belirtmeyiniz. Not-2: Firefox veya Google Chrome kullanarak anket sorularını görüntüleyebilirsiniz. Not-3:Çalışma ile ilgili herhangi bir sorunuz olması durumunda sakalsize@ticaret.gov.tr e-posta adresine tüm sorularınızı iletebilirsiniz. Gültekin Güler Genel Sekreter
YYS Elektronik Başvuru İşlemleri
Sayın Üyemiz, Gümrük İşlemlerinin Kolaylaştırılması Yönetmeliğinin 11 inci maddesi kapsamında yetkilendirilmiş yükümlü sertifikasına ilişkin e-Devlet Kapısı aracılığıyla yapılacak başvuru işlemlerini daha detaylı açıklamak üzere "YYS Elektronik Başvuru İşlemleri" konulu 2021/24 sayılı Genelge hazırlandığı ve söz konusu Genelgeye ve ekinde yer alan yetkilendirme formu ile kılavuza www.ticaret.gov.tr/gumruk-islemleri/yetkilendirilmis-yukumlu-statusu/belgeleradresi üzerinden ulaşılmasının mümkün olduğu belirtilmiştir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Slovak Matchmaking Fair 2021
Sayın Üyemiz, Slovak Ticareti ve Yatırımı Geliştirme Ajansı (SARIO) tarafından, Slovakya Ekonomi Bakanlığının himayesinde ve açılışını Başbakan Yardımcısı ve Ekonomi Bakanı Richard Sulik in gerçekleştireceği Slovak Eşleştirme Fuarı 2021 in (Slovak Matchmaking Fair) 21 Ekim 2021 tarihinde çevrimiçi olarak düzenleneceği bildirilmektedir. Yazıda devamla, on beş yıldır Slovak Eşleştirme Fuarı nın, Slovak ve uluslararası girişimciler ile kurumların ilgi duyduğu bir platform haline geldiği, Fuar ın, güncel endüstri konularını etkin bir şekilde kapsadığı, doğrudan yeni iş bağlantıları kurmak ve potansiyel iş birliklerini güvence altına almak için fırsatlar sunduğu belirtilmektedir. Söz konusu Fuar a ilişkin detaylı bilgilere www.sario.sk/en/events-projects/slovak-matchmaking-fair- 2021-online-0adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Kalite Değerleri Bakımından Öne Çıkan Buğday Çeşitleri
Borsamıza işlem görmesi için getirilen 2021 yılı hasadı buğdaylarda laboratuvarımızda yapılan satış öncesi analizlerin sonuçlarına göre “kalite değerleri bakımından öne çıkan çeşitler” aşağıda verilmektedir. Halen ilimizde ekiliş alanı bulunan buğday çeşitlerinden bazılarının potansiyellerinin altında kalite değerleri verdiği görülmüştür. Bu durumun; 2020 sonbaharında başlayan ve 2021 yılında da devam eden kurak koşulların etkisiyle çeşidin kendi genetik yapısından kaynaklanma olasılığı olduğu gibi, ilkbahar üst gübrelemesinde uygulanan azotlu gübre miktarının azaltılması da neden olabilmektedir. Bilgilerinize sunulur. Gültekin GÜLER GENEL SEKRETER RUMELİ ENERGO EKİZ SÖNMEZ 2001 KATE A-1 HÜSEYİNBEY KRASUNIA ODESKA UKRAYNA ESPERIA DROPIA AHMETAĞA HÜNKAR SYRENA ODESKA FLAMURA 85 ALMERIA BEZOSTAJA 1 ENOLA REİS NACİBEY YUNUS
Fashion Eskişehir Moda Tasarım Yarışması
Sayın Üyemiz, Fashion Eskişehir – Eskişehir Moda Tasarım YarışmasıEskişehir Ticaret Odası tarafından, Eskişehir Teknik Üniversitesi işbirliği ve T.C. Ticaret Bakanlığı desteğiyle bu yıl ilk kez düzenlenen bir moda tasarım yarışmasıdır. Gelinlik, abiye ve günlük kıyafet kategorilerinde hem genç tasarımcı adaylarını; hem de sektörde yer alan profesyonelleri bir araya getirecek bir platform olanFashion Eskişehir, sağlayacağı ödül ve yurtdışında öğrenim imkanlarıyla tasarımcılar için önemli kaynakları bir araya getirecektir. Yarışma, 10 Eylül – 15 Ekim 2021 tarihleri arasında başvuru kabul etmekte olup, potansiyel yarışmacıların bu tarih aralığında başvuru için hazır olmaları beklenmektedir. Detaylı bilgiyewww.fashioneskisehir.comadresinden ulaşabilirsiniz. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
İşyerlerinde Covid-19 tedbirleri
Sayın Üyemiz, Çalışma ve Sosyal Güvenlik Bakanlığı tarafından işverenlerin işçilerinden isteyeceği PCR testi ve işçilerini Covid-19 riskleri ve tedbirleri konusunda bilgilendirmesini içeren 2/9/2021 tarihli genel yazı 81 il valiliğine gönderilmiş ve Birliğimizle de paylaşılmıştır. Söz konusu yazının kamuoyunda duyulmasını müteakip, konu yazılı ve görsel medyada hukukçu ve uzmanlar tarafından değerlendirilmeye başlanmış, birçok farklı görüş dile getirilmiştir. Hukukçu ve uzmanların konu hakkında farklı görüş belirtmeleri nedeniyle ortaya çıkan bilgi kirliliğine bağlı olarak uygulamada sorunlar oluşmuştur. Bu sorunların açıklığa kavuşturulmasını teminen, özellikle aşı yaptırmayan ve PCR testi ibraz etmeyen çalışanların iş sözleşmelerinin geçerli veya haklı sebep ile sona erdirilmesi veya bu kişilerin işyerlerine alınmaması durumunda çalıştırılmadıkları sürelerde ücretlerinin ödenip ödenmeyeceği konularında çalışma mevzuatında açık hükümler bulunmadığından, Çalışma ve Sosyal Güvenlik Bakanlığının görüş ve değerlendirmeleri istenmiştir. Konu ile ilgili olarak Çalışma ve Sosyal Güvenlik Bakanlığı (Çalışma Genel Müdürlüğü) tarafından Birliğimize gönderilen 17.09.2021 tarihli ve E-41515602-000-38611 sayılı yazı ekte sunulmuştur. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
Sayın Cumhurbaşkanımızın Angola ve Burkina Faso Ziyaretleri
Sayın Üyemiz, Sayın Cumhurbaşkanımızın; 17-18 Ekim 2021 tarihlerinde Angola Cumhuriyeti ne,20 Ekim 2021 tarihinde Burkina Faso ya resmi bir ziyaret gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bahse konu ziyaretlerin hazırlık çalışmalarında yararlanılmak üzere Angola ve Burkina Faso ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 24 Eylül 2021 Cuma günü saat 12:00 ye kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederiz. Gültekin Güler Genel Sekreter
Engelli Eğitim ve İstihdam Çalıştayı
Sayın Üyemiz, Engelli Eğitim Kültür Sağlık Spor Vakfı tarafından 16-20 Kasım 2021 tarihleri arasında Ankara da "Engelli Eğitim ve İstihdam Çalıştayı" düzenleyecekleri belirtilerek, çalıştay kapsamında hazırlanmış olan ve https://www.handicappeconference.org/internet adresinde bulunan işveren anketine katkı sağlanması talep edilmektedir. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
İş Yerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, Birliğimiz organizasyonunda, 6 Ekim 2021 Çarşamba günü saat 14:00 te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Akıllı KOBİ Platformu Lansman Toplantısı (İnternet Üzerinden)
Sayın Üyemiz, İşini dijitale taşımak ve dijital dönüşümünü gerçekleştirmek isteyen KOBİ lerin ihtiyaç duyduğu ürün ve hizmetlerin tek bir noktadan ulaşılabilir olmasını sağlamak ve bu konuda rehberlik ve eğitim hizmetleri sunmak amacıyla Birliğimiz ve Visa iş birliğinde Akıllı KOBİ platformu çalışmalarının başlatıldığı ilgi yazı ile tarafınıza iletilmişti. Bu kapsamda platformun açılışını yapmak üzere Akıllı KOBİ Platformu Lansman Toplantısı Sanayi ve Teknoloji Bakanı Sn. Mustafa Varank, Birliğimiz Başkanı Sn. M. Rifat Hisarcıklıoğlu ile Visa Türkiye Genel Müdürü Sn. Merve Tezel in katılımıyla 17 Eylül 2021 Cuma günü saat 16:00 da gerçekleştirilecek olup, lansmana ilişkin program ekte sunulmaktadır. Katılımınız önemle rica olunur. Gültekin Güler Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler-Mısır
Sayın Üyemiz, 16 Eylül Perşembe günü 14.00-15.30 saatleri arasında Mısır da görev yapmakta olan Ticaret Müşavir ve Ataşelerimizin katılımıyla "Mısır da Yatırım, Ticaret ve Yeni Gümrük Sistemi: Gönderi Ön Bilgilendirme (Advance Cargo Info-ACI)" konulu bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Toplantıya ilişkin detayların yer aldığı doküman ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Türkiye-Almanya JETCO II. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Almanya II. Dönem Ortak Ekonomi ve Ticaret Komitesi (JETCO) Toplantısının 13 Ekim 2021 tarihinde video konferans yöntemiyle gerçekleştirileceği bildirilmekte ve söz konusu toplantıya yönelik hazırlık çalışmalarında yararlanılmak ve Mutabakat Zaptında yer almak üzere Türkiye-Almanya ticari ve ekonomik ilişkileri hakkında ele alınmasında fayda görülen konulara ilişkin bilgi notu talep edilmektedir. Bu itibarla, hazırlanacak Birliğimiz görüşünde yer almak üzere, Almanya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin varsa görüşlerinizi içeren bir bilgi notunun en geç 24 Eylül 2021 Cuma günü saat 12.00 ye kadar Borsamıza (E-posta: egemenakbulut@esktb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Yeşil Dönüşüme Nasıl Ayak Uydurucağız? Webinar Daveti
Sayın Üyemiz, Birliğimiz bünyesinde yürütülen Avrupa Yeşil Mutabakatı çalışmaları kapsamında, "Yeşil Dönüşüme Nasıl Ayak Uyduracağız?" başlıklı bir webinar dizisi başlatılmıştır. 16 Eylül 2021 tarihinde saat 14.00 te gıda, içecek ve perakende sektörleri özelinde gerçekleştirilecek webinarın konu başlıklarından bazıları aşağıda yer almaktadır. · Şirketiniz 2030 a hazır mı? · Karbon ayak izinizi biliyor musunuz? · Şirketinizin iklim karnesi nedir? · Fit For 55 nedir? · Sınırda Karbon Düzenlemesi ne getiriyor? · Türk ihracatçısı için tehditler-fırsatlar nelerdir? · Şirketler ne yapmalı? Webinar programı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Suriye Hibe Un Hibesi
Sayın Üyemiz; Suriye de yaşayan ve bu ülkedeki olaylardan zarar gören sivil halka yardım amacıyla ekmeklik buğday karşılığı 17.500 ton (± %20 TMO opsiyonunda) çuvallı unun temin ihalesi, 17.09.2021tarihi saat 10.30 da TMO Genel Müdürlüğünde yapılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7326 sayılı Kanun tanıtımı
Sayın Üyemiz, 7326 sayılı Bazı Alacakların Yeniden Yapılandırılmasına İlişkin Kanunun 9 Haziran 2021 tarihinde Resmi Gazete de yayımlanarak yürürlüğe girmiş, Kanunla başta vergi borçları olmak üzere kamuya ait borçların (Motorlu taşıtlar vergisi, trafik para cezası, idari para cezaları, öğrenim ve katkı kredisi ve ecrimisil gibi) yapılandırılması ile matrah ve vergi artırımı, işletme kayıtlarının düzeltilmesi gibi mükelleflere ve vatandaşlara büyük kolaylık ve imkanlar sağlanmıştır. Kanunun son başvuru süresi olan 30 Eylül 2021 tarihine kadar ülke ekonomimiz açısından önemli olan bu düzenlemenin tanıtılması ve hatırlatılması, daha çok mükellefe ve vatandaşa ulaştırılabilmesi amacıyla beş adet farklı içeriklerde hazırlanan "TV Spotları" aşağıdaki linkte yer almaktadır. Bilgilerinize sunulur. 7326 Sayılı Kanun TV Spotları linki: drive.google.com/drive/folders/1DVNe6qqg16sbE_HWMk3sgKASLQWWfaAd
EUROCHAMBRES: Avrupa yı Canlandırmak Etkinliği
Sayın Üyemiz, Birliğimizin üyesi olduğu ve Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu nun Başkan Vekilliğini yürüttüğü Avrupa Ticaret ve Sanayi Odaları Birliği (EUROCHAMBRES) tarafından 12-14 Ekim 2021 tarihleri arasında Avrupa daki bütün yerel/bölgesel odaların davetli olduğu "Reviving Europe" adlı etkinlik düzenlenecektir. Etkinliğin amacı; ekonomik toparlanmayı hızlandırmak, işletmelerin istediği Avrupa hakkında somut fikirler sağlamak ve katılımcılara Avrupa nın zorlukları ve önceliklerini tartışma fırsatı sunmaktır. Birlik Başkanı M. Rifat Hisarcıklıoğlu 14 Ekim 2021 de 11.00 -12.15 (TSİ) saatleri arasında "Komşuluk ve Genişleme" politikası kapsamında "Batı Balkanlar, Türkiye ve Doğu Ortaklığı ülkelerinde toparlanma için kilit faktörler" oturumuna katılım sağlayacaktır. Etkinliğin ve 3 gün boyunca yapılacak bütün oturumların dili İngilizce olup çeviri imkânı bulunmamaktadır. Etkinliğe https://chambers4eu.eu adresinden kayıt yapılabilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Mısır ile İlişkilerde Yaşanan Sorunlar
Sayın Üyemiz, Birliğimiz çalışmalarında yararlanılmak üzere, Mısır ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 20 Eylül 2021 Pazartesi günü mesai bitimine kadar Birliğimize (sila.kozanli@tobb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Autoshow 2021 Mobility fuarı
Değerli Üyelerimiz, Dijital ortamda, Otomotiv Distribütörleri Derneği (ODD)ev sahipliğinde gerçekleştirilenAutoshow 2021 Mobilityfuarı ziyarete açıldı. ODD web sitesinden tek adımla giriş yaparak dünyanın ilk dijital Autoshowunu sizler de ziyaret edebilirsiniz.http://www.odd.org.tr/autoshow2021/ 14-26 Eylül tarihleri arasında 2021 yılının bu en heyecanlı dijital etkinliğini, 7/24 mobil ve masa üstü tüm cihazlardan ziyaret edebilir, bu yepyeni teknolojiyi sizler de deneyimleyebilirsiniz. Saygılarımızla,
T.C. Eskişehir Ticaret Borsası nın 2021-2022 öğretim yılında üniversite öğrencileri için sağlayacağı karşılıksız burs için başvuru koşulları ve başvuru formu ekte yer almaktadır. Bilgilerinize sunarız.
Yeşil Dönüşüme Nasıl Ayak Uydurucağız? Webinar Daveti
Sayın Üyemiz, Birliğimiz bünyesinde yürütülen Avrupa Yeşil Mutabakatı çalışmaları kapsamında, "Yeşil Dönüşüme Nasıl Ayak Uyduracağız?" başlıklı bir webinar dizisi başlatılmıştır. 9 Eylül 2021 tarihinde saat 14.00 te otomotiv sektörleri özelinde gerçekleştirilecek webinarın konu başlıklarından bazıları aşağıda yer almaktadır. · Şirketiniz 2030 a hazır mı? · Karbon ayak izinizi biliyor musunuz? · Şirketinizin iklim karnesi nedir? · Fit For 55 nedir? · Sınırda Karbon Düzenlemesi ne getiriyor? · Türk ihracatçısı için tehditler-fırsatlar nelerdir? · Şirketler ne yapmalı? Webinar programı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
AB’nin Dijital Kovid-19 Sertifika Sistemine Ülkemizin Dâhil Edilmesi
Sayın Üyemiz, Dışişleri Bakanlığı nın yazısına atfen, Avrupa Birliği nin (AB) "Dijital Kovid-19Aşı Sertifikası Sistemi"ne ülkemizin de dâhil edilmesi ve ülkemiz tarafından tanzim olunan aşı sertifikalarına eşdeğerlik verilmesine yönelik bir basın açıklaması yapıldığı ve konuyla ilgili bir Yeterlilik Kararı yayımlandığı bildirilerek, bahsi geçen basın açıklamasında; ülkemizin, Avrupa Birliği nin sertifika sistemine dâhil edileceği ve ülkemiz tarafından düzenlenen Dijital Aşı Sertifikalarının Avrupa Birliği tarafından düzenlenen sertifikalara denk olacağı ifade edilmekle birlikte, Kovid-19 salgını döneminde, AB ile ülkemiz, Kuzey Makedonya ve Ukrayna arasındaki güvenli seyahatin kolaylaştırılacağı belirtilmiştir. Yazıda devamla, bununla birlikte, 20.08.2021 tarihinde Avrupa Birliği Resmi Gazetesi nde yayımlanan Karar da; 26 Temmuz 2021 tarihinde yapılan değerlendirme neticesinde ülkemizin Kovid-19 kapsamındaki aşı, test ve iyileşme sertifikalarının 2021/953 sayılı Tüzükte belirtilen şartları taşıdığının tespit edildiği ve bu kararla birlikte, ülkemizin "Avrupa Birliği Dijital Kovid-19 Aşı Sertifikası Sistemi"ne dâhil edildiği ve Türkiye Cumhuriyeti tarafından "Health Pass" sistemine göre düzenlenen Kovid-19 aşı, test ve iyileşme sertifikalarının (sadece AB de onaylı Covid-19 aşıları için geçerlidir) Birlik içinde serbest dolaşım hakkının kolaylaştırılması amacıyla 2021/953 sayılı Tüzük uyarınca düzenlenen sertifikalara eşdeğer olduğunun kabul edildiği belirtilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Hububat ve Bakliyat İthalatında Gümrük Vergisi Sıfırlandı
Resmî Gazete’de yayınlanan karar ile buğday, arpa, çavdar, yulaf, mısır, mercimek, nohut ithalatında 31 Aralık 2021 tarihine kadar gümrük vergisi sıfırlandı. Resmi Gazete nin bugünkü sayısında yayımlanan ve ithalat rejimi kararında değişiklik yapan Cumhurbaşkanı kararı ekinde yer alan listeye göre, nohut, yeşil ve kırmızı mercimek, buğday, mahlut, tohumluk çavdar, beyaz ve maltlık arpa, tohumluk yulaf, mısır ve buğdaygiller ailesinden bir yem bitkisi olan sorgum tohumu ithalatında gümrük vergisi 31 Aralık a kadar sıfır olarak uygulanacak. Aynı gazetede yayımlanan ve ithalat rejimi kararında değişiklik yapan diğer Cumhurbaşkanı kararına göre ise kahve ithalatının gümrük vergisi AB ve EFTA ülkeleri için yüzde 11 den yüzde 6 ya, Kosova için yüzde 13 den yüzde 8 e, D-8 ülkeleri için yüzde 10 dan yüzde 8 e, ve diğer ülkeler için yüzde 13 den yüzde 8 e düşürüldü. Bu ürünün en az gelişmiş ülkelerden yapılan ithalatında ise gümrük vergisi yüzde 11 den yüzde 6 ya indirildi. Ayrıntılar için tıklayınız. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Endonezya - Merkez ve Doğu Avrupa İş Forumu
Sayın Üyemiz, Cakarta Ticaret Müşavirliğinden alınan yazıya atfen, Endonezya Dışişleri Bakanlığı tarafından 07 Ekim 2021 tarihinde 10:30-15:45 saatleri arasında (Türkiye saati ile) hibrit formatta "Endonezya - Merkez ve Doğu Avrupa İş Forumu"nun (Indonesia- Central and Eastern Europe Business Forum, INA-CEE) düzenleneceği bildirilmektedir (Endonezya Dışişleri Bakanlığınca Türkiye Avrupa ülkeleri arasında değerlendirilmektedir). Anılan yazıda devamla, "Doing Business with Indonesia: Asia s Economic Power House" teması iledüzenlenmesi planlanan INA-CEE platformuna iş dünyasının katılımcı veya ziyaretçi olarak katılım sağlayarak iş ilişkilerinin kurulması, paydaşlarla iletişim sağlanması ya da kendi ürünlerinin tanıtımı için kullanılabileceği ifade edilmektedir. Detaylı bilgi için organizasyon komitesi ile ina-cee@kemlu.go.id e-posta adresinden temasa geçilebileceği bildirilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Mahsul Yağlık Ayçiçeği Satış İhalesi.
Sayın Üyemiz, Dalaman Tarım İşletmesinin 2021 yılı istihsali 1.245.380 Kg. yağlık ayçiçeği mahsulü satış ihalesi 16.09.2021 Perşembe günü saat 14.00’ de Dalaman Tarım İşletmesinde yapılacak olup, ihaleye ait ilan ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Rusya Federasyonu ile E-Ticaret hk.
Sayın Üyemiz, Moskova Ticaret Müşavirliği nden alınan bir yazıya atfen, Rusya nın en önde gelen e-ticaret ve epazaryeri siteleri arasında yer alan OZON firması (https://corp.ozon.com) yetkilileri ile bir toplantı yapıldığı, anılan toplantıda firma yetkilileri tarafından gerçekleştirilen sunumda COVID-19 pandemisi sürecinde 2020 yılında Rusya da e-ticaret hacminin %59 oranında artarak 3,2 trilyon Rubleye (43,7 Milyar ABD Doları) ulaştığı, toplam satışların %86 sının ise yurt içi e-ticaret sitelerinden gerçekleştirildiği belirtilmiştir. Yazıda devamla, firma yetkililerince yabancı ülkelere yönelik olarak OZON web portalında ülke sayfalarının oluşturulduğu, anılan ülke sayfalarında ülkemiz firmalarının bir örneği EK-1 de yer alan tabloda belirtilen komisyon ücretleri dâhilinde öncelikle elektronik, sağlık ve bakım, hazır giyim, ev tekstili, kuru/sert kabuklu meyve ve diğer gıda ürünlerini (çabuk bozulabilen yaş meyve sebze, süt ve muhtelif et ürünleri hariç) doğrudan tüketiciye satabileceği, ilgili firmalarımız için gümrük/lojistik işlemlerinin ifası sırasında profesyonel bir aracı firma üzerinden destek sağlanabileceği ve söz konusu işlem bedellerine EK-2 de yer alan tablo üzerinden ulaşılabileceği ve bu doğrultuda ihracatçı firmalarımızdan daha çok ürün tedariki yapılmasının talep edildiği belirtilmiştir. Ayrıca, Moskova Ticaret Müşavirliğimizce de ülkemiz firmalarının OZON ile doğrudan iletişime geçebilmesini teminen, ilgili firma yetkililerinin iletişim bilgilerinin paylaşılmasının önemli olduğu, OZON firması yetkililerinin katılımıyla düzenlenecek olan bir "webinar" ile OZON da ürün satılırken dikkat edilmesi gereken hususlar hakkında bilgilendirme yapılmasının faydalı olacağı belirtilmiştir. Konuyla ilgilenen firmaların EK 3 te yer alan Firma Bilgileri Tablosu nu kendi taleplerine istinaden vebilgileri dahilinde doldurmaları halinde, söz konusu tablo Moskova Ticaret Müşavirliğimizce paylaşılmak üzere Ticaret Bakanlığımıza iletilecektir. Konuyla ilgili firmaların, Birliğimize (kaan.gaffaroglu@tobb.org.tr) bilgi vermelerini rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
Türkiye-Kırgızistan İş Forumu
Sayın Üyemiz, Ağustos ayında yapılması planlanan ancak ülkemizdeki doğal afetler nedeniyle ertelenen "Türkiye-Kırgızistan Hükümetlerarası Karma Ekonomik Komisyonu (KEK) 10. Dönem Toplantısı"nın 10-11 Eylül 2021 tarihlerinde Bişkek te gerçekleştirilmesi planlanmaktadır. KEK Eş Başkanı T.C. Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay ın bu vesileyle yapacağı Kırgızistan ziyareti kapsamında, 10 Eylül 2021 tarihinde Türkiye-Kırgızistan İş Forumu Bişkek te düzenlenecektir. Sayın Cumhurbaşkanı Yardımcımız ve Kırgız Cumhuriyeti Bakanlar Kurulu Başkanı Sayın Ulukbek Maripov un teşrifleri ile gerçekleştirilmesi öngörülen İş Forumuna katılmayı arzu eden firma ve kurum temsilcilerinin 7 Eylül 2021 Salı günü saat 12.00 ye kadar portal.deik.org.tr/KatilimFormu/1305/17316 linkinden kayıt oluşturmaları gerekmektedir. Detaylı bilgi için (Elnur Osmanov, DEİK/Türkiye-Avrasya İş Konseyleri Koordinatörü, Tel.: 0212 339 50 67, eposta: eosmanov@deik.org.tr ) ile iletişime geçilebilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden alınan hububat satışları ile ilgili yazı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, Malumunuz olduğu üzere; son zamanlarda Türkiye nin farklı bölgelerinde yaşanan orman yangınları nedeni ile yardım kampanyası başlatılmış; daha sonra sel felaketi için de toplanacak yardımlar bu kampanyaya dahil edilmiştir. Söz konusu kampanyaya gösterilen yoğun ilgi üzerine Ankara Valiliğinden alınan izin ile kampanyanın süresi 01.10.2021 tarihinde son bulacak şekilde 1 ay uzatılmıştır. Diğer taraftan, kurumlar vergisi mükelleflerinin 13.08.2021 tarihli Resmi Gazete de yayımlanan 4372 sayılı Cumhurbaşkanlığı kararı ile açıklanan yardım kampanyası kapsamında yapmış oldukları bağışların Kurumlar Vergisi Kanununun 10 uncu maddesinin birinci fıkrasının e bendi kapsamında kurum kazancının tespitinde indirim konusu yapılabilecektir. Bu nedenle tüzel kişilerin göndereceği yardım için dekonta mümkün olduğunca adres ve telefon numaralarını eklemesi gerekmektedir. Yardım için açılan banka hesapları ektedir. Bilgilerinize rica olunur. Gültekin Güler Genel Sekreter
Bölgesel Kalkınma, Yatırım İşbirliği Forum ve Fuarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği, Şanlıurfa Ticaret ve Sanayi Odası, Şanlıurfa Ticaret Borsası, Şanlıurfa Valiliği, Şanlıurfa Büyükşehir Belediyesi, GAP Bölge Kalkınma İdaresi Başkanlığı, Harran Üniversitesi ve Karacadağ Kalkınma Ajansı işbirliğinde düzenlenecek Bölgesel Kalkınma, Yatırım İşbirliği Forum ve Fuarı 2-3 Eylül tarihlerinde Şanlıurfa Uluslararası Fuar ve Kongre Merkezinde gerçekleştirilecektir. Fuar kapsamında aşağıdaki etkinlikler düzenlenecektir: Girişim Sermayeleri Anadolu Buluşmaları Bölgesel Kalkınma Sürecinde Kalkınma İdareleri ve Kalkınma Ajanslarının Rolü ve Önemi Paneli Gelişen ve Değişen Sektörün Yatırımcı ve Girişimcilere Sağladığı Kolaylıklar Paneli Akıllı Tarım Uygulamaları ve Kırsal Kalkınma Paneli Kalkınma Sürecinde Ulusal ve Küresel Fon Kuruluşlarının Rolü ve Sürdürülebilir Finans Uygulamaları Paneli Yöresel Kalkınmada E-Ticaretin Rolü Oturumu Türkiye Malzeme Ofisi (TMO) Bölgesel Sektör Toplantısı Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
TÜBİTAK 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz organizasyonunda, 08 Eylül 2021 Çarşamba günü saat 10:00 da internet üzerinden, "TÜBİTAK 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı Bilgilendirme Semineri" düzenlenecektir. Seminere ilişkin davet ekte sunulmaktadır. TÜBİTAK, TOBB, TOBB ETÜ işbirliğinde internet üzerinden gerçekleştirilecek olan seminerde ilk çağrısı 2020 yılında yapılan, Türkiye de patent lisanslamaya bir kültür oluşturmak adına uygulamaya alınan ve müşteri kuruluşa 2 Milyon TL ye kadar %75 e varan destek sağlayan 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz; 31.08.2021 tarih ve 31584 sayılı Resmi Gazetede yayımlananÇÇİĞ SÜT DESTEĞİ VE SÜT PİYASASININ DÜZENLENMESİ UYGULAMATEBLİĞİ (TEBLİĞ NO: 2021/22)’NDE DEĞİŞİKLİK YAPILMASINADAİR TEBLİĞ (TEBLİĞ NO: 2021/32)aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kamu Alacaklarının Yapılandırma Süresi 1 Ay Uzatıldı
Sayın Üyemiz, Bazı kamu alacaklarının yapılandırmasını düzenleyen 7326 sayılı kanunda, 31 Ağustos 2021 olan son başvuru ve ilk taksit ödeme süresi 1 ay uzatıldı. Resmi Gazete nin 27 Ağustos 2021 gün 31581 no lu sayısında yer alan Cumhurbaşkanı kararına göre; bazı kamu alacaklarının yeniden yapılandırılması için ön görülen son başvuru ve ilk taksit ödeme süresi 31 Ağustos 2021 tarihinden 1 ay sonrasına ertelendi. Karar, 7326 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılmasına İlişkin Kanun kapsamında yer alan; bazı vergi ve vergi cezaları, gecikme faizi ve gecikme zamları, idari para cezaları, sigorta primi, emeklilik keseneği, işsizlik sigortası primi, sosyal güvenlik destek primi ile bunlara bağlı gecikme cezası ve gecikme zammı alacakları, belediyelerin bazı alacaklarının yeniden yapılandırılmasını kapsıyor. İlgili karara ulaşmak için tıklayın. Genel Sekreter Gültekin Güler
Sayın Üyemiz, Ankara Valiliği nin 2/8/2021 ve 17/8/2021 tarihli olurları ile orman yangınlarından ve sel felaketlerinden etkilenen afetzedelerin zararlarının karşılanmasına katkı amacıyla Birliğimizce 3/8/2021 tarihinde kampanya başlatılmıştır. Yardım kampanyası oda ve borsaların yanı sıra üyelerin de değerli katkılarıyla halen sürmektedir. Kampanyaya değerli katkılarıyla destek veren kurumlar vergisi mükelleflerinin, nakdi bağışlarının kurum kazancından indirim konusu yapılabilmesiyle ilgili olarak Gelir İdaresi Başkanlığı ndan Birliğimizce talepte bulunulmuştur. Gelir İdaresi Başkanlığı cevabi yazısında, 5520 sayılı Kurumlar Vergisi Kanunu nun 10/1-e maddesi uyarınca Cumhurbaşkanı nca başlatılan yardım kampanyalarına makbuz karşılığı yapılan ayni ve nakdî bağışların tamamının vergi yükümlülerince beyanname üzerinden indirim konusu yapılabileceğine işaret etmiştir. Yazıda belirtildiği üzere; kampanya kapsamında duyurulan banka hesaplarına, aktarılan bağış tutarlarının, Birliğimizce 4372 sayılı Cumhurbaşkanı Kararı nın yürürlük tarihi olan 13/8/2021 tarihinden sonra (bu tarih dahil), bu karar kapsamındaki Acil ve Afet Yönetimi Başkanlığı nca duyurulan hesaplara aktarılması kaydıyla, kurumlar vergisi matrahının tespitinde indirim konusu yapılabilmesi mümkün bulunmaktadır. Bu kapsamda her bir mükellefe ilişkin bilgiler ile yapılan bağış tutarının ayrı ayrı gösterildiği makbuz veya banka dekontlarının indirimin tevsiki için muhafazası gerektiğinden, ilgili belgeler Birliğimizce bağış yapan kurumlar vergisi mükelleflerine iletilecektir. Kurumlar vergisi mükellefi üyelerimizin bilgilerine sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, 27.08.2021 cuma günü saat 10.00’da Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 2.000 ton mahsul yağlık ayçiçeği 7 (yedi) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, 27.08.2021 cuma günü saat 11.00’de Ceylanpınar Tarım İşletmesinde 50.000 dekar parselde mısır sapı 2 (iki) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Hamburg Invest le tanışın
Sayın Üyemiz, Hamburg Yatırım Ajansı (HIW) adına düzenlenecek olan “Hamburg - Kuzey deki İş Metropolü ve Ticaret Bağlantı Noktası” etkinliğine sizleri davet etmekten mutluluk duyuyoruz. Etkinlikte, Hamburg da şirket kuruluşu ve fırsatlar hakkında bilgilendirme ve başarı hikâyelerinin sunumu yapılacaktır. HIW Ajansı, Hamburg eyaletinin resmi Kalkınma Ajansı olarak, şirketler ve yatırımlar için tüm hizmetleri tek noktadan sunmaktadır. Hamburg yüksek ekonomik gücü ve yaşam kalitesi sayesinde, Kuzey Avrupa nın “dünyaya açılan kapısı” ve ekonomik kalbi olarak kabul görmektedir. Avrupa Birliği nin en göz alıcı metropollerinden biri olmakla beraber her ülkenin önemli şirketleri, kurumları ve uzmanları için bir cazibe merkezidir. Hamburg, ticaret merkezi olarak bin yıllık bir geleneğe sahiptir ve dünyanın dördüncü büyük ekonomisi olan Almanya’nın en büyük ikinci şehridir. 830 yıl önce gerçekleşen liman kuruluşundan bu yana Hamburg da, kozmopolitlik, hoşgörü ve misafirperverlik sürekli olarak gelişmeye devam etmiştir. Günümüzde teknoloji, üretkenlik ve araştırma alanlarında önemli bir yere sahip olan Hamburg, bunu 18. yüzyılından itibaren önemli bir endüstri merkezi olmasına borçludur. Etkinliğe katılım ücretsizdir, ancak dijital bilgilendirme toplantısına kayıt yapmanız zorunludur. Güncel program akışınıburadabulabilirsiniz. Dijital bilgilendirme toplantısına kaydınızı aşağıdaki butondan oluşturabilirsiniz. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
İşletme Değerlendirme Raporu (İDR)
Sayın Üyemiz, İşletmelerin mevcut durumlarını, sektörünün gelişimini, sektör içerisindeki konumlarını görebilmeleri ve ekonomik faaliyetlerinin yürütülmesinde alacakları kararlara yardımcı olması, ulusal ve uluslararası iş ilişkilerinde ve finans kuruluşlarında referans olarak kullanabilmeleri amacı ile 2016-2020 yıllarına ilişkin idari kayıtlar esas alınarak Türkçe ve İngilizce olarak hazırlanan, İşletme Değerlendirme Raporu (İDR) nin 2020 versiyonu e-devlet üzerinden işletmelerin erişimine ücretsiz olarak açılmış bulunmaktadır. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
İşyerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, Birliğimiz organizasyonunda, 1 Eylül 2021 Çarşamba günü saat 14.00’te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Arjantin Hk.
Sayın Üyemiz, Eş başkanlığı Sanayi ve Teknoloji Bakanı Sayın Mustafa VARANK ile Arjantin Dışişleri, Uluslararası Ticaret ve Din İşleri Bakanlığı Uluslararası Ekonomik İlişkiler Devlet Sekreteri Jorge NEME tarafından yürütülen Türkiye-Arjantin Karma Ekonomik Komisyon IV. Dönem Toplantısı nın 29 Eylül-1 Ekim 2021 tarihleri arasında Ankara da düzenlenmesinin kararlaştırıldığı bildirilmektedir. Bu kapsamda, Ticaret Bakanlığı tarafından Türkiye-Arjantin KEK IV. Dönem Toplantısı na yönelik hazırlık çalışmalarında yararlanmak üzere, Türkiye - Arjantin ticari ve ekonomik ilişkilerinde yaşanan sorunlar ve çözüm önerilerine dair görüşlerinizin 7 Eylül 2021 Salı günü mesai bitimine kadar Borsamıza (Egemen Akbulut, eposta:egemenakbulut@esktb.org.tr) iletilmesini ricaederiz. Gültekin Güler Genel Sekreter
Türkiye-Yunanistan Gümrük İdareleri Başkanları 3. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Yunanistan Gümrük İdareleri Başkanları 3. Toplantısı nın 9-10 Eylül 2021 tarihlerinde İstanbul da düzenlenmesi planlanmaktadır. Bu itibarla, anılan toplantı hazırlıklarında kullanılmak üzere Yunanistan ile ikili gümrük alanında gündeme getirilmesinde fayda görülen sorun, öneri ve yeni iş birliği imkanları yaratılması hususunda görüşlerinizin 31 Ağustos 2021 tarihine kadar Borsamıza (Egemen Akbulut, eposta:egemenakbulut@esktb.org.tr) iletilmesini rica ederiz. Gültekin Güler Genel Sekreter
Bazı Faaliyetler İçin PCR Zorunluluğu
Sayın Üyemiz, İçişler Bakanlığı-İller İdaresi Genel Müdürlüğünce hazırlanan PCR zorunluluğu konulu yazıya ait detaylar aşağıdadır. Koronavirüs(Covid­19)salgınınıntoplumsağlığıvekamudüzeniaçısındanoluşturduğuriskinasgari seviyeyedüşürülmesiiçinsalgınlamücadelesürecinintemelprensipleriolantemizlik,maskevemesafe kurallarınınyanısırasalgınlamücadeledeelimizdekiengüçlüunsurgönüllülükesasınagöreyürütülen aşılamafaaliyetleridir. Ülkemizdeaşılamaçalışmalarındabüyükmesafealınmışolupaşıprogramınadahiledilenlerbaz alındığındabirincidozaşılamada%73,ikincidozaşılamadaise%55,5düzeyineulaşılmıştır.Aşılama faaliyetlerindeönemlibirivmeninyakalandığıbudönemdeaşılamasüreçlerinitamamlamışkişilerdesalgın kaynaklıvaka,hastavevefatsayılarınınoldukçadüşükseviyelerdeolduğugörülmektedir. Önümüzdekidönemdedesalgınlamücadeleninbaşarılıbirşekildesürdürülmesi,vaka,hasta,yoğun bakımvevefatsayılarınınasgariseviyeleredüşürülmesivesalgınınolumsuzekonomikvesosyaletkilerinin tamamenbertarafedilerekkalıcıvesürdürülebilirnormalleşmeninsağlanmasıaçısındantoplumunbazı kesimlerindemevcutolanaşılamayailişkintereddütleringiderilerekaşılamanıntoplumsalbağışıklığı sağlayacakdüzeyegetirilmesigiderekönemkazanmaktadır. Budoğrultuda,SayınCumhurbaşkanımızınbaşkanlığında19Ağustos2021tarihindetoplanan CumhurbaşkanlığıKabinesindesalgınınülkemizdekiseyri,aşılamafaaliyetlerindekatedilenmesafe,yerli aşıgeliştirilmesineyönelikçalışmalarveaşılamafaaliyetlerineilişkintoplumunbazıkesimlerindegözlenen tereddütkonularıSağlıkBakanlığıveKoronavirüsBilimKurulununtavsiyelerigözönündebulundurularak elealınmışveaşağıdakitedbirlerinhayatageçirilmesinekararverilmiştir. 1.Aşılamaçalışmalarıgönüllülükesasınagöreyürütülmeyedevamedilmeklebirlikteaşıyakarşı tereddütiçerisindeolankesimlerinkaygıvetereddütlerinigidermeyeyönelikbilgilendirmeverehberlik faaliyetlerinevalivekaymakamlarınkoordinasyonundaağırlıkverilecektir.Buamaçlailgilikamukurumve kuruluşlarının,yerelyönetimlerin,siviltoplumkuruluşlarının,muhtarlarınvekanaatönderlerininkatılımı vedesteğiylegeniştabanlıçalışmalaryürütülecektir. 2.6Eylül2021Pazartesigünündenitibarenaşıolmayankişilerin;konser,sinema vetiyatrogibi vatandaşlarımızıntopluolarakbulunduğufaaliyetlerekatılımındanegatifsonuçluPCRtestizorunluluğu getirilecektir.Buçerçevedeişletmeciler/organizatörlertarafındanetkinlikleregirişteHESkoduüzerinden kişilerinaşılı/geçirilmişhastalık(Covid­19hastalığısonrasıbilimselolarakbağışıkkabuledilensüreye göre)veyaazami48saatönceyapılmışnegatifPCRtestisorgulamasıyapılacaktır.Kişihastalığı geçirmemişveyaaşılıdeğilveyanegatifPCRtestiyokiseetkinliğekatılmasınamüsaadeedilmeyecektir. 3.Aşısızveyahastalığıgeçirmemişkişilerinözelaraçhariçuçak,otobüs, trenveyadiğertoplu ulaşımaraçlarıylagerçekleştireceklerişehirlerarasıseyahatleriçindenegatifsonuçluPCRtesti bulunmalıdır. Buçerçevede6Eylül2021Pazartesigünündenitibarenseyahatfirmalarınca aracakabul aşamasında HESkoduüzerindenkişilerinaşılı/geçirilmişhastalık(Covid­19hastalığısonrasıbilimsel olarakbağışıkkabuledilensüreyegöre)veyaazami48saatönceyapılmışnegatifPCRtestisorgulaması yapılacaktır.KişihastalığıgeçirmemişveyaaşılıdeğilveyanegatifPCRtestiyokisebukişilerinseyahatine müsaadeedilmeyecektir. 4. Valilikler/kaymakamlıklarcaillerinde/ilçelerindekişilerintopluolarakbulunduğudiğeretkinlikler veyafaaliyetlerdenfaydalanacakhastalığıgeçirmemişveyaaşısızkişileriçinİl/İlçeHıfzıssıhhaKurulu kararlarıylaHESkoduüzerindenPCRtestkontrolüzorunluluğugetirilebilecektir. 5.Salgınsüreciilebirliktemesafekuralıdoğrultusundaimtinaedilensarılmavetokalaşmabenzeri davranışlarınözelliklesondönemdetoplumiçerisindeyaygınlaştığıgörülmektedir.Kültürümüzünbir parçasıolmaklabirliktesalgınlamücadelesürecindesalgınınyayılımınıartırantokalaşma/sarılmagibi faaliyetlerdenbirmüddetdahauzakdurulmasınınönemininvatandaşlarımızahatırlatılmasınayönelik çalışmaların sürdürülmesigerekmektedir. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
Binalarda Yenilenebilir Enerji - Solar ve Jeotermal ve Enerji Verimliliği
Sayın Üyemiz, Almanya dan ilgili firmaların katılımları ile 14 Eylül 2021 tarihinde elektronik ortamda "Binalarda güneş enerjisi ve jeotermal enerji odağında yenilenebilir enerji ve enerji verimliliği" konulu bir sempozyumun gerçekleştirilmesi öngörülmektedir. Sempozyum kapsamında, Türkiye den ve Almanya dan uzman konuşmacıların katılımıyla çerçeve koşulları, teknolojik gelişmeler ve iyi uygulama örneklerinin ele alınması planlanmaktadır. Sempozyumda Almanca-Türkçe simültane tercüme hizmeti sunulacaktır. Ayrıca, sempozyumu takiben, Türk ve Alman firma temsilcileri arasında elektronik ortamda görüşmeler düzenlenecektir. Sempozyuma kayıt yaptırmak, sempozyumda yer alacak Alman firmaların faaliyet ve ilgi alanlarına ilişkin detaylı bilgiye ulaşmak ve ikili görüşmelere katılmak için www.dtr-ihk.de/tr/etkinlikler/etkinlikbilgileri/erneuerbare-energien-und-energieeffizienz-in-gebaeuden-mit-fokus-auf-solar-und-geothermielinkinin ziyaret edilmesi gerekmektedir. Bilgilerinize önemle sunarız. Gültekin Güler Genel Sekreter
Sayın Üyemiz, 26.08.2021 perşembe günü saat 10.00’da Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 3.840 ton mahsul yağlık ayçiçeğinin 13 (on üç) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, 25.08.2021 çarşamba günü saat 10.00’da Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 2.600 ton mahsul yağlık ayçiçeğinin 9 (dokuz) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, 02.09.2021 perşembe günü saat 14:00 de Ceylanpınar Tarım İşletmesinde 5.000 ton balyalı buğday sapı 7 (yedi) parti halinde açık artırma usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Münster de FMO nun Türk Yatırımcılar Tarafından Ofis ve Lojistik Merkezi Olarak Kullanılması
Sayın Üyemiz, Münster Başkonsolosumuzun Kuzey Vestfalya Sanayi ve Ticaret Odası ile Münster-Osnabrück Havalimanı (FMO) yetkilileriyle gerçekleştirdiği görüşmeye ilişkin Dışişleri Bakanlığı nın bir yazısında özetle, pandemi sürecinden olumsuz etkilenen FMO nun yabancı yatırımcılar için bir ofis ve lojistik merkezi12 bin metrekare) haline getirilmek istendiği ve buna ilaveten 10 hektarlık alana 2 kiralama ya da satın alma yoluyla lojistik, kargo ve depolama alanlarının inşa edileceği, Münster in Kuzey-Güney (Köln-Hamburg) ve Doğu-Batı (Amsterdam-Berlin) ekseninde bir çok önemli kent ve limana kısa sürede ulaşım imkanı sunduğu belirtilmekte olup, yatırım yapmak isteyen Türk şirketleri için bölgenin avantajlı olduğu bildirilmektedir. Söz konusu yazıda ayrıca, FMO dan Corendon ve Sun Express şirketleri tarafından Ülkemizde Antalya,Adana, Ankara, İzmir, Kayseri ve Zonguldak olmak üzere altı şehre uçuşlar gerçekleştirildiği, FMO kullanan en büyük yolcu grubunu vatandaşlarımızın oluşturduğu, öte yandan THY nin FMO-İstanbul Havaalanıarasında sefer başlatmasının arzu edildiği kaydedilmektedir. Yazıda devamla, Almanya nın, Avrupa da hem en büyük ticaret ortağımız hem de önemli bir transit geçiş ülkesi olması nedeniyle ve de bölgede yaşayan Türk nüfusu dikkate alındığında, ikili ilişkilerimizin daha üst seviyeye çıkarılması açısından bölgeye yatırım yapılmasının önemli kazanç sağlayacağının düşünüldüğü ifade edilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Standardizasyon Sisteminin Geliştirilmesi ve Farkındalığın Artırılmasına Yönelik Teknik Yardım Projesi Bilgilendirme Semineri
Sayın Üyemiz, Avrupa Birliği ve Türkiye Cumhuriyeti ortak finansmanıylaTürk Standardları Enstitüsü (TSE)tarafından yürütülen "Standardizasyon Sisteminin Geliştirilmesi ve Farkındalığın Artırılmasına Yönelik Teknik Yardım Projesi"Standartlara Yön Ver!farkındalık kampanyası kapsamında düzenlenen bilgilendirme semineri25 Ağustos 2021 Çarşambagünü09.30- 15.30saatleri arasındaRamada Plaza by Wyndham Eskişehir’de düzenlenecektir. Projemiz, ülkemizdeki standardizasyon çalışmalarına çağdaş ve profesyonel bir yaklaşım getirmeyi amaçlamakta; bu kapsamda kurulum çalışmaları devam eden Çevrimiçi Standardizasyon Platformu yoluyla, standardizasyon sistemini ülke geneline yaymayı, etkinliğini, verimliliğini ve paydaş katılımını iyileştirerek standardizasyon konusunda kamuoyu bilincini oluşturmayı hedeflemektedir. Bu bağlamda, ürün ve hizmetlerin kalite standartlarını oluşturmak için tüketicilerin, sanayicilerin ve üniversitelerin katkısının önemini vurgulamak, görüş ve önerilerini almak ve söz konusu platformu tanıtmak amacıyla düzenlediğimiz seminerimize katılımınızdan büyük memnuniyet duyarız. Elektronik davetiyemiz ekte bilginize sunulmuştur. Ekin yüklenmemesi halindeburayatıklayarakdavetiyemizi görüntüleyebilirsiniz. Katılımınızı bildirmek içinanil.yazicilar@wygprojects.comveyailayda.karakapici@wygprojects.comadresine mail atabilir veya +90 549 800 64 76 numaralı telefonu arayabilirsiniz. Her türlü sorunuz için; Anıl Yazıcılar,anil.yazicilar@wygprojects.com,+90 549 800 64 76 İlayda Karakapıcı,ilayda.karakapici@wygprojects.com Gültekin Güler Genel Sekreter
Yardım Kampanyası hk.
Sayın Üyemiz, Ülkemizde son günlerde yaşanan orman yangınları ve sel felaketlerinin meydana getirdiği tahribatın giderilmesi ve afetlerden zarar gören vatandaşlarımızın mağduriyetlerinin bir an evvel karşılanması için başlatılan insani yardım kampanyası kapsamında, Batı Karadeniz Sel Felaketi Ayni Yardım İhtiyaç Listesi ve Ayni Yardım Toplama Depoları ve İletişim Bilgileri ekte bilgilerinize sunulmuştur. Gültekin Güler Genel Sekreter
AB nin Import One Stop Shop (IOSS) KDV Sistemi
Sayın Üyemiz, Avrupa Birliği nin (AB) sınır ötesi e-ticaret işlemlerinde uyguladığı yeni Katma Değer Vergisi (KDV) kurallarının, 1 Temmuz 2021 tarihinden itibaren yürürlüğe konacağıyla ilgili bilgi verilmişti. AB nin söz konusu kurallara dair işletmeden tüketiciye (B2C) satışlar özelinde, kıymeti 150 Avro yu aşmayan sevkiyatlarda geçerli olacak "Import One Stop Shop (IOSS)" adında yeni bir KDV sistemi kurduğu açıklanmıştır. Yazıda devamla, bahse konu sistemin işleyişi ile ilgili Ticaret Bakanlığı Gümrükler Genel Müdürlüğünce bir broşür hazırlandığı belirtilmiştir. İlgili broşür ekte yer almaktadır. Bilgilerinize sunarız. Genel Sekreter Gültekin Güler
AB Sınırda Karbon Düzenleme Mekanizması Taslağı Geri Bildirim Süreci
Sayın Üyemiz, Bilindiği üzere, 11 Aralık 2019 tarihinde açıklanan Avrupa Yeşil Mutabakatı ile AB, 2030 yılına yönelik sera gazı emisyon azaltımını en az %55 oranına yükseltmeyi ve Avrupa’nın 2050 yılına kadar dünyanın ilk iklim-nötr kıtasına dönüştürülmesi hedefini ortaya koymuş ve AB’nin söz konusu hedeflerinin yasal çerçevesini oluşturan AB’nin ilk İklim Kanunu 9 Temmuz 2021 tarihinde AB Resmi Gazetesinde yayımlanmıştır. Avrupa İklim Kanunu ile yasalaşan hedeflere ulaşmak amacıyla Avrupa Komisyonu tarafından 14 Temmuz 2021 tarihinde bir dizi yasal düzenleme içeren “Fit for 55” yeşil paket taslağı sunulmuştur.“Fit for 55” isimli “yeşil paket” taslağının yasalaşması uluslararası ticaret için çok önemli sonuçlar doğuracaktır. Nitekim, anılan paket, mevcut AB Emisyon Ticareti Sisteminin sıkılaştırılarak deniz ve kara ulaştırmasına yansıtılması, sınırda karbon düzenlemesi, yenilenebilir enerji kullanımının artırılması, daha fazla enerji verimliliği, düşük emisyonlu ulaşım modlarının ve bunları destekleyecek altyapı ve yakıtların daha hızlı kullanıma sunulması, bu kapsamda motorlu araçlarda fosil yakıt kullanıma 2035 itibariyle son verilmesi, vergilendirme politikalarının Avrupa Yeşil Mutabakatı hedefleriyle uyumlu hale getirilmesi ve benzeri bir çok önlemi içermektedir. “Fit for 55” paket taslağı kapsamında yer alan düzenlemeler arasında, özellikle ihracatçılarımız tarafından yakından takip edilen Sınırda Karbon Düzenleme Mekanizması (SKD) kapsamında AB, öngörülen politika değişikliklerinin Avrupa sanayi üzerinde yaratacağı maliyet karşısında Avrupa’nın rekabetçiliğinin korunabilmesi ve üretimin emisyon azaltım hedefi AB’den az olan ülkelere kaymasının (karbon kaçağının) önlenmesini hedeflemektedir. Fit for 55 paket taslağı kapsamında birbiri ile bağlantılı ve birbirlerini tamamlayan politika tedbirlerine ve SKD taslağına ilişkin hazırlanan bilgi notu ekte sunulmaktadır. Bilindiği üzere, Avrupa Komisyonu tarafından “Sınırda Karbon Düzenlemesi” mekanizmasının içeriğinin belirlenmesi ve bundan etkilenebilecek tüm paydaşlarla birlikte etkilerinin ele alınabilmesi adına 4 Mart-1 Nisan 2020 tarihleri arasında bir “geri bildirim süreci” ile 22 Temmuz-28 Ekim 2020 tarihinde ise 3 aylık bir kamu danışma süreci yürütülmüştür. Bu çerçevede, ilgili özel sektör temsilcilerimiz ile kamu kurumlarımız tarafından Bakanlığımıza intikal ettirilen görüşler de dikkate alınarak ülke görüşlerimiz (https://ticaret.gov.tr/dis-iliskiler/avrupa-birligi/sinirda-karbon-duzenleme-mekanizmasi) hazırlanmış ve Avrupa Komisyonuna iletilmiş bulunmaktadır. Bu defa, Avrupa Komisyonu tarafından açıklanan sınırda karbon düzenleme mekanizmasıtaslağına ilişkin geri bildirim süreci başlatılmış olup; 5 Ekim 2021 tarihine kadar devam edecek süreç kapsamında Komisyona iletilecek geri bildirimlerin, Komisyon tarafından mevzuat çalışmaları çerçevesinde Parlamento ve Konseye iletileceği belirtilmektedir. Ülkemiz sektörlerinin de hem kendileri hem de AB’de yakın işbirliği içinde oldukları sektör/kullanıcı sektör kuruluşları aracılığıyla sınırda karbon düzenleme mekanizması taslağının nihai hale getirilmesine ilişkin bu süreçte görüşlerini mümkün olduğu ölçüde yansıtmalarının önem arz ettiği düşünülmektedir. Bu çerçevede, geri bildirimde bulunmak isteyen kuruluşlarımızın, https://ec.europa.eu/info/law/better-regulation/have-your-say/initiatives/12228-EU-Green-Deal-carbon-border-adjustment-mechanism-_en linki üzerinden görüşlerini iletmeleri mümkündür. Bu çerçevede, SKD taslağı metni de istifadeleri için ekte sunulmaktadır. Ayrıca, söz konusu geri bildirim kapsamında, varsa Komisyona iletilmesinde fayda görülen hususların Bakanlığımız ile de paylaşılması halinde, Avrupa Komisyonu nezdinde dikkate getirilmesi de mümkün olacaktır. Bilgilerinizi ve söz konusu geri bildirim süreci kapsamında varsa Bakanlığımıza iletilmesinde fayda görülen hususların en geç 3 Eylül 2021 tarihine kadar abtekpazar@ticaret.gov.tr adresine iletilmesi hususunda gereğini rica ederiz. Gültekin Güler Genel Sekreter
Bangladeş le Ticaret Yapan Firmalarımıza Yönelik Uyarı
Sayın Üyemiz, Bangladeş te Md. Sakhawat Hossain isimli şahsın Türkçe bilmesinin avantajını da kullanarak Türk firmalarla kurmuş olduğu ilişkilerde kötü niyetli ve dolandırmaya yönelik davranışlar sergilediği yönünde şikayetler alındığı, son günlerde bazı Türk firmalarla denim/denim kumaşı ticareti yapacağı (veya yapmakta olduğu) bilgisi edinildiği bildirilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
ETUYS Yetkilendirme KEP ile Evrak Gönderimi
Sayın Üyemiz, Borsamıza iletilen; Elektronik Teşvik Uygulama ve Yabancı Sermaye Bilgi Sistemi (E-TUYS) yetkilendirmesi için yapılacak başvurulara dair yazı ekte yer almaktadır. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Hibe Satışlar
Sayın Üyemiz, Filistin de yaşanan insani krize müdahale kapsamında ekmeklik buğday karşılığı 26.000 ton (±%20 TMO opsiyonunda) çuvallı unun temini ihalesi 19.08.2021 günü, saat 10.30 de TMO Genel Müdürlüğünde yapılacak olup konu ile ilgili detaylar ektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Helal Akreditasyon İşlemleri
Sayın Üyemiz, Helal Akreditasyon Kurumu tarafından Birliğimize iletilen 06.08.2021 tarih ve 66117731 sayılı "Helal Akreditasyon İşlemleri" konulu yazı kapsamında, "Personel Belgelendirme Kuruluşlarının Helal Akreditasyonu" ve "Helal Uygunluk Alanında Deney Yapan Laboratuvarların Akreditasyonu" olmak üzere iki yeni akreditasyon programının oluşturulduğu bilgisi iletilmekte olup bahsi geçen programlara yönelik oluşturulan temel uygulama dokümanlarınawww.hak.gov.tr/helal-akreditasyon/helal-akreditasyon-programlari adresi üzerinden erişilebildiği ifade edilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Kazakistan’da yaşanan işçi sorunları
Sayın Üyemiz, Dışişleri Bakanlığı ndan alınan yazıya atfen, Kazakistan da iş yapan bazı firmaların istihdam ettiği işçilerin hak edişlerinin ödenmesi ve yurda dönüşleri konusunda basına da yansıyan sorunlar yaşandığı; hem işçilerin mağduriyetine, hem genel olarak Türk firmalarının itibarının zedelenmesine yol açan bu tür sorunların çoğunlukla işçilerin çalışma vizesi ve/veya iş sözleşmesi bulunmadan Kazakistan a getirilmesinden ve kayıt dışı çalıştırılmasından kaynaklandığının bilindiği; işçilerin ise, bilgi eksikliği veya seçeneksizlik nedeniyle bu şartlarda istihdamı kabul ettikleri ifade edilmektedir. Söz konusu yazıda devamla, Nur-Sultan Büyükelçiliğimizin bu sorunların önlenmesi amacıyla; Kazakistan da proje üstlenen şirketlerimizin, projeyi üstlenme aşamasında yerel makamlardan ülkemizden işçi getirmelerine izin verileceğine ve bu işçilerin giriş-çıkış ve çalışma izinleri konusunda gerekli kolaylığın sağlanacağına dair yazılı taahhüt almalarını veya çalıştıracakları işçilere öncesinde uzun süreli çalışma vizesi temin etmelerini tavsiye ettiği belirtilmektedir. Bilgilerinize rica ederim. Gültekin Güler Genel Sekreter
Türkmenistan ile Yaşanan Sorunlar
Sayın Üyemiz, Eşbaşkanlığını Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay tarafından deruhte edilen Türk-Türkmen Komisyonu (HEK) 6. Dönem toplantısının 9-10 Eylül 2021 tarihlerinde gerçekleştirileceği ifade edilerek, firmalarımızın Türkmenistan da yaşadıkları sorunlar ve bu sorunların aşılmasına yönelik olası çözüm önerilerine dair görüşler talep edildiği bildirilmektedir. Bilgilerinizi ve iki ülke arasında yaşanan sorunlara dair ilişkin görüşlerin derlenerek 16 Ağustos 2021 tarihi saat 14.00 e kadar Borsamıza (egemenakbulut@esktb.org.tr) adresine iletilmesini rica ederiz. Gültekin Güler Genel Sekreter
Kuşak ve Yol Zirvesi Kayıt Kodu
Sayın üyemiz, Daha önceden duyurusunu yaptığımız Kuşak ve Yol Zirvesi nin kayıt koşullarında güncelleme olmuştur. Buna göre, kayıt aşamasında 06P30SOCGTUR kodunun girilmesi gerektiği, bu kod ile %30 indirimli fiyat uygulanacağı ve anılan kodun 20 Ağustos a dek geçerli olduğu kaydedilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Kongo Demokratik Cumhuriyeti Bilgi Notu
Sayın Üyemiz, Kongo Demokratik Cumhuriyeti (KDC) Cumhurbaşkanı Félix Tshisekedi nin ülkemize yakın zamanda resmi bir ziyaret gerçekleştirmek istediği bildirilmektedir. Bu kapsamda, bahse konu ziyaretin hazırlık çalışmalarında yararlanılmak üzere Kongo Demokratik Cumhuriyeti ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 13 Ağustos Cuma gününe kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Sayın Bakanımızın Irak Ziyareti
Sayın Üyemiz, Ticaret Bakanımız Sayın Mehmet MUŞ tarafından 18-19 Ağustos 2019 tarihlerinde Irak a bir ziyaret gerçekleştirilmesinin planlandığı bildirilmektedir. Bu kapsamda, bahse konu ziyaretin hazırlık çalışmalarında yararlanılmak üzere Irak ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin 12 Ağustos 2021 Perşembe günü (bugün) saat 15.00 e kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
Sayın Üyemiz, 17.08.2021 salı günü saat 14.00’de Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 2.600 ton mahsul yağlık ayçiçeğinin 9 (dokuz) parti halinde açık artırma usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Ukrayna Firma Sorunları
Sayın Üyemiz, Ticaret Bakanımız Mehmet Muş ile Ukrayna Ekonomi Bakanı Oleksiy Lyubçenko arasında Ağustos ayı içerisinde bir görüşmenin gerçekleştirilmesi planlandığı ve söz konusu görüşmede gündeme getirilmek üzere Ukrayna ile iş yapan (yatırım ve/veya ticaret) firmalarımızın karşılaştığı sorunlar ve varsa taleplere ilişkin bilgi notuna ihtiyaç duyulduğu bildirilmektedir. Bu itibarla, toplantının hazırlıklarında kullanılmak üzere,Ukrayna ile iş yaparken yaşanan sorunlar, çözüm önerileri ve varsa taleplerin en geç 11 Ağustos 2021 Çarşamba günü saat 15:00 e kadar Borsamıza (E-posta: egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederim. Genel Sekreter Gültekin Güler
Dolandırıcılık hk.
Sayın Üyemiz, Pekin Ticaret Müşavirliği nin yazısına atfen, son dönemde birçok Türk firmasının hammadde/ara mamulleri piyasa ortalamasının oldukça altında fiyat taahhüdü ile Çinli firmalara peşin ödeme veya büyük ölçekli avans ödemesi yoluyla dolandırıldığı, son olarak "Shen Yang Beılıxın Import and Export Co. Ltd" isimli Çinli firmanın bir Türk firmasını benzer şekilde dolandırdığı, Ticaret Müşavirliği ile irtibata geçmeden diğer Türk firmalarının da alım yapma ihtimali göz önünde bulundurulduğunda, hem adı geçen firma hem de genel olarak dolandırıcılık faaliyetleri konusunda firmalarımızın bilgilendirilmesinde yarar görüldüğü ifade edilmektedir. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
İkinci Afrika İçi Ticaret Fuarı
Sayın Üyemiz, 8-14 Aralık 2021 tarihleri arasında Kigali de düzenlenmesi öngörülen İkinci Afrika İçi Ticaret Fuarı nın (Intra-African Trade Fair-IATF2021) lojistik kısıtlamalar nedeniyle 15-21 Kasım 2021 tarihlerinde Durban da (GAC) düzenlenmesine karar verildiği bildirilmektedir. Yazıda devamla, IATF2021 in Afrika Kıtasal Serbest Ticaret Bölgesi Anlaşması (AfCFTA) kapsamında ticareti kolaylaştıracak bir platform sunarak; kıtasal ve küresel alıcı ve satıcıları bir araya getireceği belirtilmekte olup, Afrika ve başka coğrafyalardan 55 ten fazla ülkeden 10.000 ziyaretçinin katılımının öngörüldüğü,"IATF2021 Virtual" adı altında çevrimiçi olarak katılım imkanı da sağlanacağı ifade edilmektedir. İlgili Fuara ilişkin Afrika Birliği nden alınan Nota ekte sunulmakta olup, ayrıntılı bilgi ve kayıt için https://www.intrafricantradefair.com/en internet sitesinin kullanılması mümkünüdür. Bilgilerinize rica ederiz. Genel Sekreter Gültekin Güler
Kuşak ve Yol Zirvesi
Sayın Üyemiz, Hong Kong Ticaret Ataşeliğinin görev alanı Hong Kong da, resmi niteliği haiz çatıkuruluşu olan Hong Kong Ticareti Geliştirme Konseyi (HKTDC) organizasyonunda 2016 yılından beri Kuşak ve Yol Hong Kong Zirvesi düzenlendiği, anılan Zirve nin temel amacının, Kuşak ve Yol güzergah ülkelerinde yer alan yatırım projelerine, Hong Kong da yerleşik finansman kuruluşları aracılığı ile fon sağlanması ve Hong Kong un finans merkezi olduğu belirtilmektedir. Zirve nin Hong Kong hükümeti tarafından da desteklendiği ve 2021 yılında koronavirüs pandemisine bağlı olarak 01-02 Eylül 2021 tarihlerinde dijital platform üzerinden düzenlenmesi planlanan Zirve ye dair genel bilgiler paylaşılmaktadır: I. Fiziken en son 2019 yılında düzenlenen Zirve ye, o dönemde 67 ülkeden 5000 in üzerinden ziyaretçi katılım sağlamıştır. Yine son düzenlenen fiziki organizasyonlarında, Zirve kapsamında 200 ün üzerindeki yatırım projesine 700 den fazla ticari eşleştirme programı tertip edilmiştir. İlk defa 2020 yılında pandemi gerekçesi ile dijitalde düzenlenen Zirve de, yine 80 nin üzerinde ülkeden ülkenin katılım sağladığı ve 250 nin üzerinde ticari eşleştirme programı düzenlendiği ilan edilmiştir. II. Temel hedefi Kuşak ve Yol güzergah ülkelerindeki yatırım projelerine fon sağlamak olan Zirve ye katılım sağlayan finansman kuruluşları Anakara Çin ağırlıklıdır. Yatırım projeleri bağlamında ele alındığında ise, Avrupa başta olmak üzere finansman arayışı bulunan tüm dünyadan yatırımcıların Zirve de aktif olarak yer aldıkları görülmektedir. III. Ülkemizden katılımcıların seneler itibari ile Zirve ye iştirakinde artış olduğu görülmek ile birlikte, firmalarımızın ticari eşleştirme programında yer almadıkları bilinmektedir. Bu kapsamda, yatırım projeleri için finansman arayışı bulunan firmalarımızın Zirve kapsamında düzenlenen ticari eşleştirme programlarına katılımında büyük yarar görülmektedir. İlgilenen firmalarımızın https://www.beltandroadsummit.hk/en/ üzerinden kayıt olmaları, kayıt esnasında ise Ticaret Ataşeliğimze tahsis edilen "03P30SOCGTUR" kodu üzerinden sağlanan kod (indirimli fiyat uygulanacağı ana organizatör tarafından beyan edilmiştir.) ile giriş yapmaları önerilmektedir. Zirve nin dijital katılım ücreti her bir kayıt için 390 HKD ( yaklaşık 50 ABD Doları) olarak belirlenmiştir. IV. Ticari eşleştirme organizasyonlarının yanı sıra Bölgesel Kapsamlı Ekonomik Ortaklık (Regional Comprehensive Economic Partnership RCEP) başta olmak üzere uluslararası ticaret gündemine dair tematik forumların da düzenleneceği Zirve nin program akışına resmi web portalından erişim sağlanması mümkündür. V. Zirve ye katılımdan bağımsız olarak, proje finansmanı arayışında olan şirketlerin, HKTDC ye ait https://beltroad.hktdc.com/ web portalında "Türkiye" başlığı altında yatırım projelerine ait detayları ücretsiz yayımlatma imkanı bulunmaktadır. VI. Zirve ye dair katılımı değerlendiren firmalarımızın, daha detayda bilgileri, HKTDC de ilgili irtibat kişisi olarak belirtilen pamela.cn.wong@hktdc.org üzerinden edinmeleri mümkündür. Bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
IsDBG Özel Sektör Forumu
Sayın Üyemiz, İslam Kalkınma Bankası (IsDB) Grubu nun, 46. Yönetim Kurulu Toplantısı vesilesiyle 2 Eylül 2021 Perşembe günü 09:30-16:30 saatleri arasında "IsDBG Özel Sektör Forumu" düzenleneceği bildirilmektedir. Yazıda devamla, Taşkent te gerçekleştirilecek olan ilgili Forum un amaçlarının; üye ülkelerdeki yatırım, ticaret ve sigorta alanında IsDB Grubu faaliyetlerini, hizmetlerini, girişimlerini ve ortak çözümlerini vurgulamak, üye ülkelerin ilgili deneyimlerini, başarı öykülerini ve en iyi uygulamalarını paylaşmak ve iş dünyası temsilcileri arasında ortaklıklar kurulması için bir platform sağlamak olduğu belirtilmektedir. İlgili Forumun konuşmacı listesi ekte sunulmakta olup, ayrıntılı bilgiye aşağıdaki iletişim adresleri üzerinden ulaşmak mümkündür: İnternet sitesi: www.IsDBG-PSF.org Hassan Khalifa email: hkhalifa@isdb.org , telefon: +966569326822 Mohamed Al Saati email: mfs@isdb.org , telefon: +966554315181 Bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
TMO Arpa Satışlarına İlave Olarak Kanatlı Hayvan Yetiştiricilerine Yönelik Buğday Satışlarına da Başlamıştır
Sayın Üyemiz, TMO Genel Müdürlüğünden yapılan açıklamada: "Kuruluşumuz02 Ağustos 2021tarihi itibarı ile1.950 TL/Tonfiyatla peşin bedel mukabili olarak BESİCİ VE YETİŞTİRİCİLERİMİZ ile YEM FABRİKALARINA yönelik arpa satışlarına devam etmektedir. Buğday satışlarımız ise2.440TL/Tonfiyatla peşin bedel mukabili olarak KANATLI HAYVAN BESİCİ VE YETİŞTİRİCİLERİNE (beyaz et, yumurta vs.) yönelik olarak başlamıştır. Arpa ve buğday satışlarımız için başvurular02 Ağustos 2021 - 13 Ağustos 2021(dahil) tarihleri arasında; Liman işyerlerimizden besici ve yetiştiricilerimize yapılacak arpa satışları “ELEKTRONİK SATIŞ PLATFORMU” üzerinden, iç merkezlerdeki arpa satışlarımız için ise TMO ŞUBE MÜDÜRLÜKLERİ vasıtasıyla yapılacaktır. Yem fabrikalarına yapılacak arpa satışlarımız “YEM FABRİKALARI ELEKTRONİK SATIŞ PLATFORMU” üzerinden yapılacaktır. Liman işyerlerimizden yapılacak buğday satışlarımızda ise “ELEKTRONİK SATIŞ PLATFORMU” üzerinden başvuru alınacaktır. Tahsis sonuçlarının açıklanmasını müteakip satışı yapılan stoklar içinpara yatırma süresi26 Ağustos 2021,ürün teslimleri 15 Eylül 2021tarihi mesai bitiminde sona erecektir. Kuruluşumuzca piyasalar yakından takip edilmektedir. TMO iştigal alanına giren ürünlerde stoklarını takviye edecek, uygun fiyatla kullanıcılarına yönelik hammadde tedarikine devam edecek ve görev alanındaki ürünlerde ilgili kamu kurum ve kuruluşlarıyla işbirliği içerisinde piyasa istikrarı temin edilecektir." denilmektedir. Ayrıntılı bilgi için tıklayınız. Genel Sekreter Gültekin Güler
Yapılandırma Duyurusu
Sayın Üyemiz; 7326 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanunun 09.06.2021 tarihli Resmi gazetede yayımlanmış olup ve Kanun içeriğine ilişkin açıklamalar aşağıda yer almaktadır. 1.KAPSAM Kanun`un 10 uncu maddesinin 4 inci fıkrası uyarınca 30.04.2021 tarihi itibarıyla ödenmesi gerektiği hâlde bu Kanunun yayımı tarihine kadar ödenmemiş olan; - Üyelerimizin borsamıza olan aidat ve borsa tescil ücreti borç asılları, Kanun kapsamında yapılandırmaya tabi tutulabilecektir. Bu çerçevede üyelerimizin borsamıza olan 2021 yılı aidat ödemeleri yapılandırma kapsamında değildir. Bununla birlikte üyelerimizin borsamıza olan 2020 yılı ve öncesi dönemlere ait aidat ödemeleri yapılandırma kapsamında olacaktır. 2.VERGİ MÜKELLEFİYETİ SİLİNEN ÜYELER 17.11.2020 tarihinde yürürlüğe girmiş olan 7256 sayılı Kanun kapsamında yer alan, "vergi mükellefiyeti sona ermiş üyelerin, vergi mükellefiyetinin sona erdiği tarihten sonraki borç asıl ve faizlerinin re`sen silinmesi" uygulamasına, 7326 sayılı Kanunda yer verilmemiştir. Bu nedenle vergi mükellefiyeti sona ermiş üyeler bakımından, 7326 sayılı Kanun kapsamında tesis edilmesi gereken bir işlem bulunmamaktadır. 7256 sayılı Kanun gereği olarak vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetinin sona erme tarihi ile 17.11.2020 tarihi arasındaki borç asıl ve faizleri re`sen silinmiştir. Bu kapsamdaki üyelerin 17.11.2020 tarihinden sonra tahakkuk etmiş ancak vadesi gelmiş bir borçları da bulunmadığından, Yapılandırma kapsamında olmadıkları değerlendirilmektedir. Öte yandan vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetlerinin sona erme tarihinden önceki borçlarının asılları, 7326 sayılı kanun kapsamında yapılandırılabilmektedir. 3. BORÇ SİLİNMESİ ve ÖDEME Yapılandırma kapsamındaki borç asıllarının tamamının kanunda belirtilen şekilde ödenmesi halinde faiz, gecikme faizi, gecikme zammı gibi fer`i alacakların tahsilinden vazgeçilir. Bununla birlikte yapılandırma kapsamında olan ve Kanunun yayımı tarihinden önce kısmen veya tamamen ödenmiş olan borç asıllarına isabet eden faiz, gecikme faizi, gecikme zammı gibi fer`i alacakların da tahsilinden vazgeçilir. Kanun kapsamındaki borçlar için yapılandırmaya başvuranların, borç taksitlerinin birincisini Kanunun yayımlandığı tarihi takip eden dördüncü ayın sonuna kadar (31.10.2021), kalanını ise aylık dönemler hâlinde ve azami toplam altı eşit taksitte (son taksit tarihi 31.03.2022) ödemesi gerekmektedir. Azami altı taksite kadar olan yapılandırma hakkının ne şekilde kullanılacağını üye başvurusunda belli edecektir. Üye tarafından belirlenecek olan taksit adedi, ödenecek toplam borç tutarını değiştirmeyecektir. Üyeler, toplam anapara borç tutarını yukarıda belirtilen taksit sürelerini geçmemek üzere kredi kartına da taksitlendirebileceklerdir. Üyelerimiz, Kanunun yayımlandığı tarihi takip eden üçüncü ayın sonuna kadar (30/09/2021) başvuruda bulunabileceklerdir. Yapılandırmaya başvuru anında askıya alınmış olan üyeler, ilk taksit ödemeleri ile beraber askıdan indirilecektir. Ancak bu şekilde askıdan indirilen üye, herhangi bir taksiti ödemeyerek yapılandırmayı bozması halinde yeniden askıya alınacaktır. 4. MUHASEBE İŞLEMLERİ Bu fıkra kapsamında ödenmesi gereken tutarların fıkrada öngörülen süre ve şekilde kısmen veya tamamen ödenmemesi hâlinde, ödenmemiş alacak asılları ile bunlara ilişkin faiz, gecikme faizi, gecikme zammı gibi fer`i alacaklar ilgili mevzuat hükümlerine göre tahsil edilir. Bu ana kadar yapılan tahsilatlar Bütçe ve Muhasebe Yönetmeliğinin 58 inci maddesinde belirtilen sıralamaya göre borçtan düşülür ve kalan kısma 6183 sayılı Amme Alacaklarının Tahsil Usulü Hakkında Kanun uyarınca günlük gecikme zammı tahakkuk ettirilmeye devam edilir. 5. UYUŞMAZLIK KONUSU ALACAKLAR Yapılandırmadan faydalanacak kişilerin, yapılandırmaya konu borçlarına dava açmamaları, açılmış davalardan vazgeçmeleri şarttır. Bu Kanunun yayımı tarihinden önce dava konusu edilmiş ve/veya mahkemece hükme bağlanmış ve kesinleşmiş olanlar dâhil olmak üzere icra takibi başlatılmış alacaklar için, borçlunun bu fıkra hükümlerinden yararlanmak üzere başvuruda bulunması hâlinde davalar ve/veya icra takipleri sonlandırılır. Bu kapsamda, tamamı ödenen alacaklara ilişkin yargılama giderleri ile icra masrafları ve vekâlet ücretleri karşılıklı olarak talep edilmez. 6.7256 SAYILI KANUN KAPSAMINDA YAPILANDIRILAN ALACAKLAR Üyelerimizin 7256 sayılı Kanun kapsamında yapılandırmış olduğu alacaklar kural olarak 7326 sayılı Kanun kapsamında değildir. Bu bakımdan 7256 sayılı Kanun kapsamında yapılandırması devam eden ve taksitlerini vadesinde ödemeye devam eden üyelerin mevcut yapılandırmalarına uygun davranmaları gerekmektedir. 7256 sayılı Kanun kapsamında taksitlerden herhangi birisini ödemediği için yapılandırması bozulan ve ödenmemiş anapara, faiz ve fer`isi yeniden tahakkuk ettirilen üyelerin 7326 sayılı Kanun kapsamında yapılandırmaya başvurması mümkündür.” Aidat Yapılandırma Başvuru Dilekçesi ektedir. Üyelerimize önemle duyurulur. Saygılarımızla, GÜLTEKİN GÜLER GENEL SEKRETER
Sri Lanka tarafından turizm konusunda düzenlenen etkinlik - güncel link
Sayın Üyemiz, Asya da İşbirliği ve Güven Arttırıcı Önlemler Konferansı" (AİGK) (Conference on Interaction and Confidence Building Measures in Asia - CICA) Sekretaryasından alınan yazıya atfen, Sri Lanka Turizm Tanıtım Bürosu nun 17 Ağustos 2021 tarihinde "Turizm işbirliğini geliştirmek amacıyla AİGK Üye Devletleri ile sanal B2B oturumu" (Virtual business to business (B2B) interactive session with CICA Member States to enhance tourism cooperation) başlıklı etkinliğinin düzenlemeyi planladığı bildirilmişti. Dışişleri Bakanlığı ndan gelen ilgi (b) de kayıtlı yazı ile söz konusu etkinliğinin güncel kayıt linki iletilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden alınan hububat satışları ile ilgili yazı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Türkmenbaşı Limanı
Sayın Üyemiz, Türkmenistan ın Türkmenbaşı Liman İşletmesi yetkililerinden elde edinilen bilgiye göre; Limanın 27 Temmuz 2021 - 10 Ağustos 2021 tarihleri arasında, 5-6 Ağustos 2021 tarihlerinde yapılacak Orta Asya Devlet Başkanlarının İstişare Toplantısı, Orta Asya Kadınlarının Diyaloğu ve Orta Asya Ülkelerinin Milli Ürünlerinin Uluslararası Fuarı etkinlikleri dolayısıyla, gemi trafiğine ve gemi operasyonlarına kapalı olacağı ifade edilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Co-Matching İkili İş Görüşmeleri Etkinliği
Sayın Üyemiz, Kocaeli Ticaret Odası nın ilgide kayıtlı yazısı ile, Avrupa İşletmeler Ağı kapsamındaki Kocaeli Ticaret Odası ve Doğu Marmara ABİGEM işbirliğinde Co-Matching İkili İş Görüşmeleri etkinliğinin 25 Ağustos 2021 Çarşamba günü online olarak gerçekleştirileceği bildirilmektedir. Yazıda devamla, bu yıl dördüncüsü düzenlenecek olan Co-Matching ikili iş görüşmeleri kapsamında dünyanın çeşitli ülkelerinden firma temsilcilerinin, Türkiye pazarında stratejik ortaklar bulmak, yatırım ve ticaret ortamını değerlendirmek üzere sanal ortamda ülkemizden firmalarla bir araya geleceği ve yerli firmaların, ürün, proje ve hizmetlerini sunma, yurtdışı bağlantıları ile iş ağlarını geliştirme, yeni ticari ve teknolojik işbirlikleri ve proje ortaklıkları kurma imkanı bulacakları belirtilmektedir. Söz konusu etkinliğe başvurmak isteyen şirketlerimiz co-matching-2021.b2match.io/ adresinden detaylı bilgilere ulaşabilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Sayın Üyemiz, KTO Karatay Üniversitesi ile gerçekleştirdiğimiz protokol kapsamında Eskişehir Ticaret Borsası üyelerimizin, birinci derece yakınlarının ve eşlerinin KTO Karatay Üniversitesi Lisans veya Ön lisans programlarına Üniversitesine kayıt yaptırmaları halinde öğrenim ücretinden %15 oranında ahilik bursu sağlanacak ve 8 eşit taksitte ödeme imkanı sağlanacaktır. Protokol gereği; 2021-2022 akademik yılında Üniversiteye kayıt yaptıran öğrenciler için geçerli olup, Bu protokol kapsamında lisans ve ön lisans programlarına kayıt hakkı elde eden üyelerimiz, birinci derece yakınlarına ve eşlerine ahilik bursu, Üyelerimizin Borsamızdan güncel tarihli yetki belgesi aslını getirmesi ile bu yetki belgesini her akademik yılbaşında yenilemesi ve birinci derece yakınların ilgili Nüfus Müdürlüğünden alacakları vukuatlı nüfus kaydı belgesinin aslını ibraz etmeleri şartı ile sağlanmaktadır. İş dünyasının üniversitesi olan KTO Karatay Üniversitesi hakkında ayrıntılı bilgi almak içinhttp://tanitim.karatay.edu.tradresini ziyaret edebilirsiniz. Bilgilerinize rica ederiz. Saygılarımızla, Genel Sekreter Gültekin GÜLER
Küçük İşletmeler için Dijital Şampiyonlar: "ICC, WTO ve ITC Yarışması"
Sayın Üyemiz, Covid-19 pandemisi, dünyanın her yerindeki her büyüklükteki işletme için dijital ekonominin önemini bir kez daha göstermiştir. Daha fazla KOBİ’yi dijital ekonomiye dahil edilmesi; büyümelerine, ticaret yapmalarına ve dirençli olmalarına yardımcı olmak için çok önemlidir. Bu bağlamda,Milletlerarası Ticaret Odası (ICC), Uluslararası Ticaret Merkezi (ITC), Dünya Ticaret Örgütü nün Mikro KOBİ Grubu, yarışma sponsorlarıGoogle ve Zoomile birlikte, KOBİ’lerin dijitalleşmelerine yardımcı olarak uluslararası ticarete katılımlarını destekleyecek projeler için teklif çağrısında bulunmaktadırlar. Yarışmanın ev sahibi ve sponsor kuruluşlarının desteği ve netwörkü ile geliştirilebilecek ve/veya ölçeklenebilecek dijital merkezli teklifler aranmaktadır. Yarışma; Ticaret Odaları, Sanayici Dernekleri ve Sivil Toplum Kuruluşlarına açıktır. Kazananlar, 30 Kasım – 3 Aralık 2021 tarihlerinde Cenevre’de düzenlenecek olan 12. DTÖ Bakanlar Konferansı’nda açıklanacaktır. Google ve Zoom’un sponsorluğundaki ödüller, kazananların ihtiyaçlarına göre şekillendirilecektir. Proje çağrısındayer alan bazı bilgiler aşağıda sunulmaktadır. GİRİŞİMİN HEDEFLERİ: •Dijitalleşmelerine yardımcı olarak mikro KOBİ lerin uluslararası ticarete katılımının desteklenmesi •Dijital ticaretle ilgili -siber güvenlik tehditleri ve düzenleyici gerekliliklere uygunluk gibi-, KOBİ lerin karşılaştığı zorluklar konusunda İş dünyası ve politikacılar nezdinde farkındalık yaratılması •Küçük işletmelerin dijitalleşmesine yardımcı olan ve uluslararası ticarete katılımlarını teşvik eden en iyi uygulamaların vurgulanması NE TÜR PROJE TEKLİFLERİARANIYOR?: •Teklifler; farkındalık yaratma kampanyaları, yarışmalar, kapasite geliştirme, eğitim ve rehberlik programlarına odaklanabilir. •Teklifler; teklifi yapan kuruluş tarafından yapılacak şekilde tasarlanmalı ve DTÖ müzakerelerine veya DTÖ kurallarında önerilen değişikliklere odaklanmamalıdır. •Başarılı teklifler; ICC, ITC ve DTÖ Mikro KOBİ Grubu ile sponsorlar olan Google ve Zoom netwörkleri tarafından desteklenecektir. PROJE TEKLİFLERİ NASIL TESLİM EDİLECEK? Teklifler; mikro KOBİ ve dijitalleşme odaklı Ticaret Odaları, Sanayici Dernekleri ve Sivil Toplum Kuruluşlarının katılımına açıktır. •Teklif hazırlanırken kapsamı, amaçları, zaman çizelgeleri ve diğer bilgileri uygun şekilde detaylandırılması gerekmektedir. •Teklifler, üç sayfadan uzun olmamalıdır. •Word veya PDF formatındaDigitalchampions@wto.orge-posta adresine15 Eylül 2021tarihine kadar gönderilmelidir. PROJE TEKLİFİNDE YER ALMASI GEREKEN TEMEL BİLGİLER: • Kuruluşun adı • İrtibat kişisi (isim, telefon, e-posta) • Kuruluşun kısa açıklaması • Projeyi uygulayan kişilerin kısa özgeçmişleri • Önerilen projenin adı • Projenin zaman çizelgesi • Karşılaşılan sorun/ele alınması gereken konu • Organize edilecek faaliyetler de dahil olmak üzere projenin kısa açıklaması • Projenin amaç(lar)ı (Herhangibir özel sonuç/çıktı dahil) • ICC, ITC ve DTÖ Mikro KOBİ Grubunun projenin uygulanmasına nasıl katkıda bulunabileceğine dair öneriler SEÇİM SÜRECİ Proje tekliflerinin seçimi; DTÖ Mikro KOBİ Grubunun Üyeleri ve ICC, ITC ve DTÖ ile sponsor kuruluşlar olan Google ve Zoom temsilcileri tarafından yapılacaktır. Kazananlar, 30 Kasım – 3 Aralık 2021 tarihlerinde Cenevre’de düzenlenecek olan 12 DTÖ Bakanlar Konferansı’nda açıklanacaktır. ÖDÜL Google ve Zoom’un sponsorluğundaki ödüller, kazananların ihtiyaçlarına göre şekillendirilecektir. Ödül sayısı, başvuran proje tekliflerine göre belirlenecektir. Girişimin Açılış Videosunu izlemek için tıklayınız. Proje Çağrısına ulaşmak için tıklayınız. Saygılarımızla, Genel Sekreter Gültekin Güler
Nefes Kredisi Hk.
Sayın Üyemiz, Hazine ve Maliye Bakanlığı koordinasyonunda KGF ve bankalar ile imzalanan protokol çerçevesinde Nefes Kredisi projesi 30 Temmuz 2021 Cuma günü mesai bitimi itibarıyla yeni başvurulara kapatılacaktır. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
Zambiya da İş Ortamı ve Yatırımlara Yönelik Teşvikler
Sayın Üyemiz, Zambiya da iş ortamı ve yatırımlara yönelik teşvikler hakkında Zambiya Büyükelçiliğimiz tarafından hazırlanan bilgi notu iletilmektedir. Söz konusu bilgi notu ekte sunulmakta olup, sorular için Lusaka Ticaret Müşaviri Cem Emre Özköse (Email:lusaka@ticaret.gov.tr, Telefon: +260 211 259 012) ile irtibata geçilmesi mümkündür. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
Türkiye-Çin Kültür ve İş Geliştirme Forumu
Sayın Üyemiz, Çin Halk Cumhuriyeti Ankara Büyükelçiliği rehberliğinde Türkiye-Çin İş Geliştirme ve Destekleme Derneği ve Çin Sanayi ve İş Adamları Derneği işbirliğinde, 5-7 Ağustos 2021 tarihlerinde, Congresium Ankara da Türkiye-Çin Kültür ve İş Geliştirme Forumu nun düzenleneceği bildirilmekte ve 3 gün boyunca sürecek Fuarın yanı sıra maden, altyapı, teknoloji, bilişim, gıda, tarım turizm ve sağlık sektörlerinde paneller düzenleneceği ifade edilmektedir. Söz konusu Forum a ilişkin detaylı bilgilereturkiyecinisgelistirme.com/index adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
EgyMedica Medikal Fuarı
Sayın Üyemiz, Mısır da 19 -21 Mayıs 2022 tarihlerinde EgyMedica medikal fuarının düzenleneceği bildirilmektedir. Fuara ilişkin broşür ekte sunulmakta olup, ayrıntılı bilgi için Green Land Organizing International Exhibitions & Conferences Başkan Yardımcısı Adel Fahmy Fahmy ile aşağıda yer alan iletişim bilgileri üzerinden iletişime geçilmesi mümkündür: Telefon: (+2) (02) 20822108 - 20822109 - 20822137 Fax: (+2) (02) 208221008 E-mail: info@egymedica.com , egymedica@greenlandexpo.net Web sitesi: www.egymedica.com Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Rusya Federasyonu Pskov Bölgesi Yatırım Fırsatları Sunum
Sayın Üyemiz, Rusya Federasyonu Pskov Bölgesi ndeki Yatırım Fırsatları na ilişkin bir toplantının, 4 Ağustos 2021 tarihinde saat 11.00-12.30 arasında, online olarak gerçekleştirileceği bildirilmektedir. Toplantıya ilişkin gündem ve notlar ekte iletilmektedir. Toplantı linki, kayıt gerçekleştirildikten sonra iletilecektir. Kayıt için ankara@minprom.gov.ru adresine mail atılması veya +90 552 648 13 69 nolu telefondan Anna Sherstneva ile görüşülmesi gerekmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin GÜLER
Bangladeş ten İhale Teklifleri (Kırmızı Mercimek İthalatı)
Sayın Üyemiz, Bangladeş Ticaret Kurumu (Trading Corporation of Bangladesh) tarafından standart sentetik aylon file veya jüt file torbada, her biri 25/30/40 kg veya herhangi bir standart ağırlıkta paketlenecek şekilde 3.000 metrik ton (± %10) soğan ile 25/50 kg polipropilen torbalarda 3.000 metrik ton (±%5) kırmızı mercimek ithal edileceği belirtilmektedir. İhaleler ile ilgili detaylı bilgilere ve daha çok sayıda güncel ihale bilgisine www.tcb.gov.bd adresinden ulaşılabilir. Bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
Türk - Kırgız İş Forumu
Sayın Üyemiz, Türkiye-Kırgız Cumhuriyeti Hükümetlerarası Karma Ekonomik Komisyonu (KEK) Eş Başkanı T.C. Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay ın KEK 10. Dönem Toplantısı vesilesiyle yapacağı Kırgızistan ziyareti kapsamında 6 Ağustos 2021 tarihinde Kırgız Cumhuriyeti nin başkenti Bişkek te TürkiyeKırgızistan İş Forumu nun düzenlenmesi planlanmaktadır. Birliğimiz ve Dış Ekonomik İlişkiler Kurulu işbirliğinde, Sayın Cumhurbaşkanı Yardımcımız ve Kırgız Cumhuriyeti Bakanlar Kurulu Başkanı Sayın Ulukbek Maripov un teşrifleri ile gerçekleştirilmesi öngörülen İş Forumuna katılmayı düşünen üyelerinizin katılım teyitlerini en geç 3 Ağustos 2021, saat 12.00 ye kadar Birliğimize (Adem Kula, Tel: 0212 324 95 42, E-posta: adem.kula@tobb.org.tr ) bildirmeleri gerekmektedir. Bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
İş Dünyası İçin Erasmus+ Fırsatları Bilgilendirme Etkinliği
Sayın Üyemiz, 26 Temmuz2021 tarihinde, AB Başkanlığı Mali İşbirliği ve Proje Uygulama Genel Müdürü Sayın Bülent ÖZCAN’ınev sahipliğinde, Avrupa Birliği Eğitim ve Gençlik Programları Merkezi Başkanlığı (Ulusal Ajans) tarafındanErasmus+ Programı kapsamında iş dünyasına yönelik fırsatlarözelinde bir tanıtım etkinliği düzenlenecektir. 2021-2027 döneminde 26,2 milyar avroluk bir bütçeye sahip olan Erasmus+ Programı, faydalanıcıların faaliyet gösterdikleri sektörlerdeki yenilikçi ve iyi uygulamaları tecrübe etmelerini, uygulamalarını, yurt dışındaki muadilleri ile bir arada kurumsal kapasitelerini artırmalarına ve uluslararasılaşmalarına yardımcı olmaktadır. Etkinliğe ilişkin resmi yazı, gündem ve bilgi notu ekte dikkatinize sunulmuş olup çevrim içi olarak gerçekleştirilecek bu etkinlik bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
Fuar Başvuruları
Sayın Üyemiz, Yurt İçinde Fuarların Düzenlenmesine Dair Usul ve Esasların 14 üncü maddesinin birinci fıkrasına göre Ana fuar takviminde yer almak üzere yapılacak fuar düzenleme başvuruları, fuarın düzenleneceği yıldan bir önceki yılın Ağustos ayının 1 inci günü sonuna kadar yapılabilmektedir. Bu seneye mahsus olmak üzere, 2022 yılı Ana fuar takvimi başvurularının 2021 yılının Eylül ayının 1 inci günü sonuna kadar yapılması halinde başvurularının kabul edilmesine karar verilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Türkiye-Nijerya Karma Ekonomik Komisyonu 5. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Nijerya Karma Ekonomik Komisyonu (KEK) 5. Dönem Toplantısı nın 7-8 Eylül 2021 tarihlerinde Ankara da gerçekleştirileceği bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Nijerya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 27 Temmuz 2021 Salı günü mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederim. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Kurban Hizmetleri Toplantısı
Sayın Üyemiz, Tarım ve Orman Bakanlığı ndan alınan ilgi yazı ekte gönderilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, Geçit Kuşağı Tarımsal Araştırma Enstitüsü MüdürlüğüNe ait Sap Satış ihalesi ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
TEDEPORT - Teşvik ve Destek Portalı
Sayın Üyemiz, Alman Federal Ekonomik İşbirliği ve Kalkınma Bakanlığı tarafından finanse edilen Ekonomik Fırsatların Desteklenmesi Programı kapsamında; Alman Uluslararası İş Birliği Kurumu ve Gaziantep Sanayi Odası iş birliği ile yürütülen "Gaziantep te Kalıcı Gelir İçin İstihdam Projesi" bünyesinde TEDEPORT - Teşvik ve Destek Portalı oluşturulduğu belirtilmektedir. Ayrıntılı bilgi ektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
Türk Gıda Kodeksi Meyve Şarabı Tebliği Hakkında Görüş Talebi
Sayın Üyemiz, Türk Gıda Kodeksi Hazırlama Yönetmeliği çerçevesinde hazırlanmış olan "Türk Gıda Kodeksi Meyve Şarabı Tebliği"ne ait taslak metin ve görüş tablosunun Bakanlığın web sayfasında (www.tarimorman.gov.tr) görüşe açıldığı bildirilmektedir. Bilgilerinizi ve taslağa ilişkin görüşlerinizin, taslak metinle birlikte web sayfasında yer alan tablo formatına uygun olarak, en geç 28 Temmuz 2021 tarihine kadar eskisehirtb@tobb.org.tr mail adresine bildirilmesini rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
Fransa ya İhracatta Karşılaşılan Dolandırıcılık Teşebbüsleri
Sayın Üyemiz, Liyon Ticaret Ataşeliğimizden alınan bir yazıya atfen, son zamanlarda ihracatçılarımızla Fransa dan irtibata geçen bazı kişilerin, Fransa da yerleşik ünlü perakende zincirleri veya köklü ve tanınmış firmalar adına kendilerinden ürün alacaklarını, ancak ödemeyi sadece kendi belirledikleri şekilde yapacaklarını ifade ettikleri bildirilmektedir. Ayrıca, Fransa nın en büyük perakende zincirlerinin veya tanınmışfirmalarının adını kullanarak ve kendilerini söz konusu firmaların satış müdürü olarak gösteren kişilerin firmalarımızla irtibata geçerken, Fransa da kayıtlı telefon numaraları üzerinden arama yaptıkları, ancak Liyon Ticaret Ataşeliği tarafından yapılan araştırmalar neticesinde söz konusu numaraların başka ülkeler üzerinden alındığının tespit edilmiş olduğu belirtilmektedir. Bahsi geçen zincir marketlerden birinin satış müdürü ile yapılan telefon görüşmesinde birçok yerden bu tarz bilgilerin kendilerine iletildiği ve konuyu polise yansıttıkları ifade edilmektedir. Yazıda devamla, şimdiye kadar ayakkabı, sıvı yağ ve kırtasiye sektörlerimizde faaliyet gösteren firmalarımızdan alım yapmak isteyen söz konusu kişilere karşı firmalarımızın dikkatli olmasının, bu çerçevede firmalarımızın, Fransız firmalarının veya ünlü perakende zincirlerinin ismini kullanarak kendilerine ulaşan ve ürün almak isteyen kişilerin, belirtilen Fransız firmasının genel merkezini arayarak, çalışanları olup olmadığını ve siparişin ismi kullanılan kişi tarafından verilip verilmediğini kontrol etmelerinin büyük önem arz ettiği ifade edilmektedir. Firmalarımızla iletişime geçen kişilerce kullanılan eposta adresinin Fransız firmasının ismini taşıyan bir uzantısının olmasına, Fransız firmasının resmi evraklarının kendilerine iletilmesine (bilanço vb.), yapılan tekliflerde veya sözleşmelerde Fransız firmasının mührünün kullanılmasına dikkat edilmesinin bundan sonra firmalarımızın kayıplar yaşamaması açısından önemli olduğu bildirilmektedir. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
Deneyap Teknoloji Atölyesi
Sayın Üyemiz, Milli Teknoloji Hamlesi nde rol alacak gençlerin gelişimlerini sağlamak üzere; gençlerin ihtiyaç duyacakları fiziki imkanları, donanımları, eğitimleri ve atmosferi ülke genelinde yaygın bir şekilde sağlayabilmek amacıyla Sanayi ve Teknoloji Bakanlığı, Gençlik ve Spor Bakanlığı, TÜBİTAK ve T3 Vakfı arasında 7 Kasım 2018 tarihinde "81 ilde kurulacak 100 Deneyap Atölyesine ilişkin İşbirliği Protokolü" imzalanmıştır. Bu kapsamda 3. fazda açılacak olan 27 ildeki 36 Deneyap Teknoloji Atölyesi nde verilecek "Tasarım & Üretim", "Robotik & Kodlama" ve "Elektronik Programlama & Nesnelerin İnterneti" dersleri için eğitmenlik başvuru süreci başlamıştır. Söz konusu sürece ilişkin bilgi notu, şartname ve duyuru afişleri ekte dikkatinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Sayın Üyemiz, Et ve Süt Kurumu Genel Müdürlüğünden alınan yazı ektedir. Bilgilerinize sunulur.
2021 Üye Memnuniyet Anketi
Sayın Üyemiz, Borsamızın verdiği hizmetleri değerlendirip, hizmetlerimize istek ve talepleriniz doğrultusunda yön verebileceğiniz anketimize aşağıdaki linkten ulaşabilirsiniz. https://forms.gle/mcaojSUHJGTRJmnRA Saygılarımızla, Gültekin Güler Genel Sekreter
Türk-Rus 17. Dönem KEK Toplantısı, 28- 30 Temmuz 2021
Sayın Üyemiz, Türk-Rus 17. dönem KEK Toplantısı nın 28-30 Temmuz 2021 tarihlerinde Rusya da gerçekleştirilecektir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Rusya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 16 Temmuz 2021 Cuma günü saat 14.00 e kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
Sayın Üyemiz, Bilindiği gibi, SMA (Spinal Musküler Atrofi) hastası çocukların tedavisi önemli maddi olanaklar gerektirmektedir. Bu gereklilikleri sosyal dayanışmaya uygun şekilde karşılayabilmek amacıyla, camiamızın kapsayıcı bir şekilde destek vereceği muhakkaktır. Bu kapsamda, camiamızın değerli mensubu Ömer ÖZER in (Siirt TSO - Personel) kızı Eflin Lina ÖZER, SMA hastalığı nedeniyle değerli katkılarınıza ihtiyaç duymaktadır. Aşağıda yer alan IBAN numarasına (valilik onaylı) destek olmak isteyen üyelerimize destekleri için şükranlarımızı sunarız. Saygılarımızla, Gültekin Güler Genel Sekreter Türkiye İş Bankası - Siirt Şubesi IBAN: TR42 0006 4000 0018 7001 0849 75 Alıcı: Ömer ÖZER
Sayın Üyemiz, 07.07.2021 tarih ve 2021/02 karar no.lu Eskişehir İli Hayvan Sağlık Zabıtası Komisyon Kararı ekte bilgilerinize sunulmuştur. Gültekin Güler Genel Sekreter
Vergi usul kanunu tebliğiyle bildirim zorunluluğu düzenlemesi
Sayın Üyemiz, 13 Temmuz 2021 tarih ve 31540 sayılı Resmi Gazete de yayımlanan Vergi Usul Kanunu Genel Tebliği ile vergi kaçakçılığı ile mücadele kapsamında bildirim zorunluluğu getirilen mükelleflerin kapsamı ve bildirimlerin usul ve esasları belirlendi. Düzenlemeye göre şirketlerin "Gerçek Faydalanıcı Bilgisi Verme" yükümlülüğü 1 Ağustos ta başlayacaktır. Ayrıntılı bilgi ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Elektronik İhale Yöntemiyle Yapılan İhalelerde Elektronik Geçici Teminat Mektubunun Kullanılması
Sayın Üyemiz, 06/01/2021 tarihli ve 31376 sayılı Resmî Gazete’de yayımlanan mevzuat ile; Mal Alımı İhaleleri Uygulama Yönetmeliği, Hizmet Alımı İhaleleri Uygulama Yönetmeliği, Yapım İşleri İhaleleri Uygulama Yönetmeliği ve Elektronik İhale Uygulama Yönetmeliğinin “Uygulanmaya başlama süresi” başlıklı geçici maddelerinde değişiklik yapılarak, elektronik ihale yöntemiyle yapılan ihalelerde yalnızca Elektronik İhale Uygulama Yönetmeliğinin 21’nci maddesine göre düzenlenen elektronik geçici teminat mektuplarının sunulabileceğine ilişkin 30.09.2020 tarihli ve 31260 sayılı Resmi Gazete’de yayımlanmış olup değişikliklerin, gerekli teknik altyapının tamamlandığının tespitine yönelik Kurul tarafından alınacak kararın 15 gün sonrasına kadar uygulanmayacağı hükme bağlanmıştır. Bu çerçevede, 24.05.2021 tarih ve 2021/DK.D-116 Kurul kararı ile, ilan veya duyuru tarihi 08.06.2021 ve bu tarihten sonra olan ve elektronik ihale yöntemiyle yapılan ihalelerde geçici teminat mektubu olarak yalnızca Elektronik İhale Uygulama Yönetmeliğinin 21’nci maddesine göre düzenlenen elektronik geçici teminat mektuplarının sunulabileceğine karar verilmiştir. Bu bağlamda, ilan veya duyuru tarihi 08.06.2021 ve bu tarihten sonra olan ve elektronik ihale yöntemiyle yapılan ihalelerde geçici teminat mektubu olarak yalnızca elektronik geçici teminat mektupları sunulabilecektir. Bilgilerinize rica olunur. Gültekin Güler Genel Sekreter
TMO Satış Duyurusu
Sayın Üyemiz, Toprak Mahsulleri Ofisi Genel Müdürlüğünden Birliğimize intikal eden Elektronik Ürün Senetli (ELÜS) stokları ile ithal ve bazı yerli ürünlerin satış işleminin web tabanlı "TMO ELEKTRONİK SATIŞ PLATFORMU" üzerinden yapılmasına ilişkin yazı ektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
LEADS 2021 Etkinliği
Sayın Üyemiz, Hindistan Ticaret ve Sanayi Odaları Federasyonu (FICCI) tarafından, Hindistan Dışişleri Bakanlığı desteği ile 14-15 Eylül 2021 tarihlerinde Yeni Delhi de "LEADS 2021: Reimagine the World" adlı etkinliğinin düzenleneceği bildirilmektedir. Yazıda devamla, sanal ve yüz yüze katılım seçeneği sunan söz konusu etkinliğin ana teması "Future for Partnerships" olacağı ifade edilmektedir. LEADS, FICCI tarafından dünyadaki ekonomik büyüme hakkında küresel liderlerin görüş alışverişinde bulunabileceği bir platform olarak tasarlanmıştır. Geçen sene Ekim ayında düzenlenen LEADS 2020 etkinliğine 98 ülkeden 2600 den fazla dinleyici ve 27 ülkeden 78 konuşmacı katılım sağlamıştır. FICCI LEADS 2021 etkinliği ile ilgili detaylı bilgilere https://www.ficcileads.in adresinden ulaşılabilmektedir. Etkinliğe kayıt olmak için ise https://registrations.ficci.com/FICCILEADS2021/onlineregistration.asp adresini ziyaret etmeniz gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COVID-19 Pandemisiyle Mücadele Kapsamında Moskova da Alınan Tedbirler
Sayın Üyemiz, Rusya Federasyonu nda COVID-19 pandemisinde üçüncü dalga sürecinde 28 Haziran 2021 tarihinde günlük vaka sayısında 20.616 seviyesine ulaşıldığı, Moskova şehrinde ise özellikle Haziran ayının ortalarına doğru 9 bin seviyesinin aşılmasını müteakip muhtelif karantina tedbirlerinin tekrar uygulamaya geçirilmeye başlandığı bildirilmektedir. Yazıda devamla, Moskova da COVID-19 pandemisiyle mücadele kapsamında; 28 Haziran 2021 tarihinden itibaren kafe ve restoranlara sadece aşılanmış, son 6 ayda hastalığı geçirmiş veya son 3 günde yapılan PCR testi negatif çıkanların alınması yönünde bir düzenlemeye gidildiği, (Girişlerde QR kod talep edilmektedir) söz konusu uygulamanın, kafe ve restoranların veranda benzeri dış bölümleri için 12 Temmuz da yürürlüğe konulmasının öngörüldüğü, ayrıca, otelde ikamet edenlerin de, otel yerleşkesindeki mevcut restoran ve kafelerde (dışarıdan girişlere yönelik kısıtlama mevcut değilse) yine QR kod uygulamasına tabi tutulduğu, karantina tedbirinin Moskova da (turistler de dahil olmak üzere) titizlikle uygulanmakta olduğu ve QR kod teminine yönelik ilgili resmi internet sunucusunda ise üçüncü ülke vatandaşlarına (Rusya da çalışma iznine sahip olanlar hariç) matuf bir hizmet verilmediğinin müşahede edildiği ifade edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
AB nin Yeni KDV Sistemi
Sayın Üyemiz, Avrupa Birliği nin (AB) sınır ötesi e-ticaret işlemlerinde uyguladığı yeni Katma Değer Vergisi (KDV) kurallarının 1 Temmuz 2021 tarihinden itibaren yürürlüğe konacağı belirtilerek, AB ye yönelik gerçek değeri 150 Avro yu aşmayan sevkiyatlarda da geçerli olacak yeni sistem kapsamında, 22 Avro nun altındaki değerler için uygulanan KDV muafiyetinin tamamen kaldırılacağı açıklanmıştır. Yazıda devamla, ticari numunelerin gümrük işlemlerine ilişkin KDV ve Gümrük Vergisi istisnası veya sadece gümrük vergisi istisnasının uygulanacağı gümrük beyannamesi seçeneklerinin sunulacağı ifade edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Yerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, 7 Temmuz 2021 Çarşamba günü saat 14:00 te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kaliforniya Sanal Ticaret Heyeti - İptal Duyurusu
Sayın Üyemiz, 7 Temmuz 2021 tarihinde gerçekleştirilmesi planlanan Kaliforniya Sanal Ticaret Heyeti etkinliği iptal edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kadın Girişimciler için Yapay Zeka Webinarı ve Eğitimi
Sayın Üyemiz, TOBB, TOBB ETÜ ve Global Al Hub iş birliğinde yürütülen Yapay Zeka Eğitim ve Farkındalık Projesi kapsamında; 8 Temmuz 2021 Perşembe günü 15:30 - 17:30 saatleri arasında "Kadın Girişimciler için Yapay Zeka" etkinliğinin açılış webinarı gerçekleştirilecektir. Söz konusu webinar sonrasında tüm katılımcılar, Global AI Hub platformu üzerinden Yapay Zekaya İlk Adım ve Herkes için Hiperotomasyon eğitimlerine devam edebilecek olup eğitimleri başarıyla tamamlayanlara İsviçre standartlarında sertifikaları ücretsiz olarak verilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Almanya nın Yeni Tedarik Zinciri Yasasının Tanıtımı
Sayın Üyemiz, Alman Federal Meclisi tarafından yeni bir tedarik zinciri yasası ("Lieferkettensorgfaltsgesetz") kabul edildiği ve gelecek yılın başında yürürlüğe gireceğini belirtilerek, yeni yasanın yurtdışındaki Alman şirketleri ve dünyanın farklı bölgelerindeki iş ortakları için neler içerdiğinin detaylı inceleneceği bir bilgilendirme toplantısı düzenleneceği bildirilmektedir. 7 Temmuz 2021 tarihinde 15:00-16:30 saatleri arasında sanal ortamda düzenlenecek toplantıya https://www.dtr-ihk.de/tr/etkinlikler/etkinlik-bilgileri/bilgilendirme-toplantisi-almanyanin-yenitedarik-zinciri-yasasinin-tanitimi linkinden kayıt yaptırmak mümkündür. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Üretimde Yapısal Dönüşüm Çağrısı Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz organizasyonunda, 5 Temmuz 2021 Pazartesi günü saat 14:00 te internet üzerinden, "Üretimde Yapısal Dönüşüm Çağrısı Bilgilendirme Semineri" düzenlenecektir. Seminere ilişkin davet ekte sunulmaktadır. Sanayi ve Teknoloji Bakanlığı, Türkiye Odalar ve Borsalar Birliği ve Organize Sanayi Bölgeleri Üst Kuruluşu iş birliğinde gerçekleştirilecek olan webinarda Teknoloji Odaklı Sanayi Hamlesi Programı kapsamında ilan edilen, orta-yüksek ve yüksek teknolojili ilgili sektörlerdeki 149 ürün ve 4 yenilikçi teknoloji başlığı (Servo Teknolojileri, Robotik ve Otomasyon Sistem Bileşenleri, Eklemeli İmalat Makineleri, Otonom/Yarı Otonom Endüstriyel ve Hizmet Robotları) altında 29 yenilikçi teknoloji alanındaki projeleri destekleyen Üretim Yapısal Dönüşüm Çağrısı anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
Ürdün Sanal Yatırım Konferansı
Sayın Üyemiz, Ürdün Yatırım Komisyonu nun, Ürdün Başbakanı Dr. Bisher Al Khasawneh in himayesinde, 12-13 Temmuz 2021 tarihlerinde Ürdün Sanal Yatırım Konferansı nı gerçekleştireceği bildirilmektedir. Yazıda devamla, ilgili konferans kapsamında, Ürdün de ve küresel çapta yatırım ortamı ve gelecekteki eğilimlerin tartışılacağı belirtilmekte olup, etkinliğe yönelik detaylı bilgi için aşağıdaki iletişim bilgilerip paylaşılmaktadır. Telefon: +962 (6) 5608400 Fax: +962 (6) 5608416 Email: info@jic.gov.jo İnternet sitesi: https://events.jic.gov.jo/ Bahse konu etkinliğin programı ekte sunulmaktadır. Bilgilerinize rica ederiz. Gültein Güler Genel Sekreter
Sayın Üyemiz; 02.07.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlanan"KARAYOLU TAŞIMA YÖNETMELİĞİNDE DEĞİŞİKLİK YAPILMASINA DAİR YÖNETMELİK"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; 02.07.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlanan"BOZULABİLİR GIDA MADDELERİNİN TAŞIMACILIĞINDA KULLANILACAK ÖZEL EKİPMANLAR HAKKINDA YÖNETMELİK"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; 02.07.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlanan"PERAKENDE TİCARETTE UYGULANACAK İLKE VE KURALLAR HAKKINDAYÖNETMELİKTE DEĞİŞİKLİK YAPILMASINA DAİR YÖNETMELİK"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
Varlık Barışı
Sayın Üyemiz, Resmi Gazete de yayımlanan Cumhurbaşkanlığı kararıyla varlık barışı başvuruları 6 ay uzatıldı. Varlık barışı başvuruları 2021 sonuna uzatıldı. https://www.resmigazete.gov.tr/eskiler/2021/06/20210630-6.pdf Geçici Madde 93 – (Ek:11/11/2020-7256/21 md.) Yurt dışında bulunan para, altın, döviz, menkul kıymet ve diğer sermaye piyasası araçlarını, bu maddedeki hükümler çerçevesinde, 30/6/2021 tarihine kadar Türkiye’deki banka veya aracı kuruma bildiren gerçek ve tüzel kişiler, söz konusu varlıkları serbestçe tasarruf edebilirler. Birinci fıkra kapsamına giren varlıklar, yurt dışında bulunan banka veya finansal kurumlardan kullanılan ve bu maddenin yürürlük tarihi itibarıyla kanuni defterlerde kayıtlı olan kredilerin en geç 30/6/2021 tarihine kadar kapatılmasında kullanılabilir. Bu takdirde, defter kayıtlarından düşülmesi kaydıyla, borcun ödenmesinde kullanılan varlıklar için Türkiye’ye getirilme şartı aranmaksızın bu madde hükümlerinden yararlanılır. Bu maddenin yürürlük tarihi itibarıyla kanuni defterlerde kayıtlı olan sermaye avanslarının, yurt dışında bulunan para, altın, döviz, menkul kıymet ve diğer sermaye piyasası araçlarının bu maddenin yürürlüğe girmesinden önce Türkiye’ye getirilmek suretiyle karşılanmış olması hâlinde, söz konusu avansların defter kayıtlarından düşülmesi kaydıyla bu madde hükümlerinden yararlanılır. 213 sayılı Vergi Usul Kanunu uyarınca defter tutan mükellefler, bu madde kapsamında Türkiye’ye getirilen varlıklarını, dönem kazancının tespitinde dikkate almaksızın işletmelerine dâhil edebilecekleri gibi aynı varlıkları vergiye tabi kazancın ve kurumlar için dağıtılabilir kazancın tespitinde dikkate almaksızın işletmelerinden çekebilirler. Gelir veya kurumlar vergisi mükelleflerince sahip olunan ve Türkiye’de bulunan ancak kanuni defter kayıtlarında yer almayan para, altın, döviz, menkul kıymet ve diğer sermaye piyasası araçları ile taşınmazlar, 30/6/2021 tarihine kadar vergi dairelerine bildirilir. Bildirilen söz konusu varlıklar, 30/6/2021 tarihine kadar, dönem kazancının tespitinde dikkate alınmaksızın kanuni defterlere kaydedilebilir. Bu takdirde, söz konusu varlıklar vergiye tabi kazancın ve kurumlar için dağıtılabilir kazancın tespitinde dikkate alınmaksızın işletmeden çekilebilir. Bu fıkra kapsamında bildirilen taşınmazların ayni sermaye olarak konulmak suretiyle işletme kayıtlarına alınması hâlinde, sermaye artırım kararının bildirim tarihi itibarıyla alınmış olması ve söz konusu kararın bildirim tarihini izleyen onuncu ayın sonuna kadar ticaret siciline tescil edilmesi kaydıyla, bu madde hükümlerinden faydalanılabilir. Türkiye’ye getirilen veya kanuni defterlere kaydedilen varlıkların elden çıkarılmasından doğan zararlar, gelir veya kurumlar vergisi uygulaması bakımından gider veya indirim olarak kabul edilmez. Bu madde kapsamında bildirilen varlıklar nedeniyle hiçbir suretle vergi incelemesi ve vergi tarhiyatı yapılmaz. Bu hükümden faydalanılabilmesi için birinci fıkra uyarınca bildirilen varlıkların, bildirimin yapıldığı tarihten itibaren üç ay içinde Türkiye’ye getirilmesi veya Türkiye’deki banka ya da aracı kurumlarda açılacak bir hesaba transfer edilmesi şarttır. Cumhurbaşkanı, bu maddede yer alan süreleri, bitim tarihlerinden itibaren her defasında altı ayı geçmeyen süreler hâlinde bir yıla kadar uzatmaya; Hazine ve Maliye Bakanlığı, madde kapsamına giren varlıkların Türkiye’ye getirilmesi ve bildirimi ile işletmeye dâhil edilmelerine ilişkin hususları, bildirime esas değerlerin tespiti, bildirimin şekli, içeriği ve ekleri ile yapılacağı yeri, maddenin uygulanmasında kullanılacak bilgi ve belgeler ile uygulamaya ilişkin usul ve esasları belirlemeye yetkilidir Gültekin GÜLER Genel Sekreter
Gönderi Ön Bilgilendirme-Advanced Cargo Information (ACI-ACID)
Sayın Üyemiz, Kahire Ticaret Müşavirliği nden alınan bir yazıya atfen Mısır daki iş çevrelerinin ve çok uluslu şirketlerin talepleri doğrultusunda, Mısır Maliye Bakanlığı tarafından 23/06/2021 tarihli ve 2021/328 sayılı Karar ın yayımlandığı ifade edilerek, ACI-ACID uygulaması başlama tarihinin 3 ay ertelendiği belirtilmiştir. Yazıda, 1 Ekim 2021 tarihinden itibaren sadece sisteme dahil kargoların ilgili ülke gümrük limanlarında kabul edileceği ve başka bir erteleme yapılmayacağı da vurgulanmıştır. Bilgilerinize sunarız. Saygılarımızla, Gültekin Güler Genel Sekreter
Ar-Ge Süreçleri ve Ar-Ge Destekleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden "Ar-Ge Süreçleri ve Ar-Ge Destekleri Eğitimi" gerçekleştirilecektir. Günümüzde Türkiye ve dünyada Ar-Ge sonucunda oluşan ürünler en yüksek seviyesine ulaşmıştır. Ancak kurulan küçük şirketlerin %50 si ilk 5 yılda, kalanın %50 si de ikinci 5 yılda kapanmak durumundakalmaktadır. Şirketi ayakta tutabilecek, sürdürülebilir, doğru Ar-Ge ye nasıl başlanır ve nasıl finansman sağlanır, Ar-Ge süreçleri nelerdir, doğru ekip nasıl kurulur ve geliştirilir, ürünü ne zaman piyasaya sürmek gerekir, doğru finansman kaynakları nelerdir, bu kaynaklara nasıl erişilebilir. Bu eğitimde bu sorulara cevaplar bulunmaya çalışılacaktır. Eğitime ilişkin detaylı bilgi ektedir. Bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
Yatırımlarda devlet yardımları hakkında kararda değişiklik yapılmasına dair karar
Sayın Üyemiz; TUBİTAK destekli çevre yatırımları kapsamında en az %15 su tasarrufu veya emisyon/atık azalımı sağlayacak entegre damızlık hayvancılık, gıda ve içecek ürünleri imalatı ve 5 dekar ve üstü seracılık, kültür mantarı yetiştiriciliği yatırımlarının asgari yatırım tutarları ve devlet tarafından verilecek destek miktarlarında yapılan değişiklikler hakkında bilgi içeren "Yatırımlarda devlet yardımları hakkında kararda değişiklik yapılmasına dair karar"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz; 29.06.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlananSebze ve Meyvelerin ambalajlanmasında, taşınmasında, depolanmasında ve perakende satışa sunulmasında uyulması gerekenyeni standartlar hakkında bilgi içeren"SEBZE VE MEYVELERİN TOPTAN VE PERAKENDE TİCARETİNDEUYULMASI GEREKEN STANDARTLAR HAKKINDA TEBLİĞ"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
Almanya ve Romanya Sohbet Toplantısı
Sayın Üyemiz, 30 Haziran 2021 Çarşamba günü 14.00-16.00 saatleri arasında Almanya da görev yapmakta olan Ticaret Müşavir ve bu ülkelerde iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı "İş Dünyası Temsilcilerimizin Gözüyle Almanya" e-sohbet toplantısının, 2 Temmuz 2021 Cuma günü 14:00-15:30 saatleri arasında ise Romanya da görev yapmakta olan Ticaret Müşavirlerimiz ve Ataşemiz ile Romanya daki en büyük online pazar yeri olan eMAG Romanya temsilcilerinin konuşmacı olarak katılacağı İngilizce dilinde "eMAG Romanya ile Romanya Pazarında E-Ticaret Fırsatları" e-sohbet toplantısının gerçekleştirileceği bildirilmektedir. Toplantıların programı ve toplantıya katılmak için gerekli linkler ekte sunulmuştur. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Suriye Hibe Un Temin İhalesi
Sayın Üyemiz; Suriye de yaşayan ve bu ülkedeki olaylardan zarar gören sivil halka yardım amacıyla ekmeklik buğday karşılığı 17.500 ton (± %20 TMO opsiyonunda) çuvallı unun temin ihalesi, 02.07.2021tarihi saat 10.30 da TMO Genel Müdürlüğünde yapılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Endonezya Dışişleri Bakanlığında Düzenlenecek İş Forumu
Sayın Üyemiz; Endonezya Dışişleri Bakanlığı tarafından 14 Temmuz 2021 tarihinde 10.00-15.00 saatleri arasında (Türkiye saati) hibrit formatta "Endonezya-Merkezi ve Doğu Avrupa İş Forumu"nun (Indonesia-Central and Eastern Europe Business Forum, INA-CEE) düzenleneceği belirtilmektedir. Düzenlenecek İş Forumu ile karşılıklı ticaret ve yatırımın artırılması, dijital ekonomiden faydalanma, e-sağlık ve yeşil ekonomide işbirliği imkânlarını araştırma amaçları hedeflenmektedir. Katılımcıların iş dernekleri, KOBİ ler ve devlet yetkilileri olacağı ifade edilmekte olup, ilgili foruma ziyaretçi ya da katılımcı olarak iştirak etmek içinhttps://www.ina-lac.com/en/about-ina-ceeadresinden kayıt yaptırılabileceği ve bu platform aracılığıyla iş dünyasının iş ortaklıkları kurabileceği, iş ortaklarıyla iletişimlerini sağlayabileceği ve ürünlerinin tanıtımını yapabileceği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla,
Büyükbaş ve Küçükbaş Hayvancılık İşletmelerine Yönelik Yatırımların Desteklenmesine İlişkin Uygulama Esasları Tebliğ
Sayın Üyemiz; 25.06.2021 tarih ve 31522 sayılı Resmi Gazetede yayınlanan Büyükbaş ve Küçükbaş Hayvancılık İşletmelerine Yönelik Yatırımların Desteklenmesine İlişkin Uygulama Esasları Tebliğiektebilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hızlı Destek Programı Bilgilendirme Semineri
Sayın Üyemiz; 29 Haziran 2021 Salı günü saat 15:30 da internet üzerinden; COVID-19 dan Etkilenen Mikro ve Küçük İşletmelere Hızlı Destek Programı (Yeni Dönem) Bilgilendirme Semineri internet üzerinden düzenlenecektir. Program ekte sunulmaktadır. KOSGEB, TOBB ve OSBÜK iş birliğinde internet üzerinden gerçekleştirilecek olan seminerde COVID-19 salgınından etkilenen imalat, bilgisayar programlama ve bilimsel Ar-Ge sektörlerinde faaliyet gösteren mikro ve küçük ölçekli işletmelere yönelik olarak teminatsız ve faizsiz geri ödemeli destek olarak açıklanan ve son başvuru tarihi 9 Temmuz 2021 olan "Hızlı Destek Programı" anlatılacak, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize Sunarız. Saygılarımızla, Gültekin GÜLER
Çin Halk Cumhuriyeti Ticari Dolandırıcılık Vakaları
Sayın Üyemiz, Son zamanlarda, bazı Çinli firmaların, pek çok firmamızı, hammadde ve ara mamulleri piyasa ortalamasının oldukça altında bir fiyatla temini taahhüdü ve peşin ödeme veya büyük miktarlarda avans ödemesi yoluyla dolandırdıkları belirtilerek Çin ile ticaret yapacak firmalarımızın, kendilerine ulaşan emtia satış talepleri konusunda öncelikle bu ülkedeki temsilcilerimizle irtibata geçmelerinin önem arz ettiği belirtilmektedir. Bilgilerinize önemle rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
Türkiye-AB İş Dünyası Diyaloğu (TEBD) Projesi-Tarımsal Gıda Forumu
Sayın Üyemiz; Avrupa Birliği nin sağladığı mali destekle Birliğimiz ve "Avrupa Ticaret ve Sanayi Odaları Birliği" (EUROCHAMBRES) işbirliğinde yürütülmekte olan "Türkiye-AB İş Dünyası Diyaloğu (TEBD)" projesi kapsamında, 28-29 Temmuz 2021 tarihlerinde, çevrim içi olarak, "Tarımsal Gıda Forumu" etkinliği gerçekleştirilecektir. Söz konusu forum, 21-22 Nisan 2021 tarihlerinde düzenlenen "Tarımsal Gıda Forumu"nun devamı niteliğinde olup, endüstri liderlerini, politika yapıcıları, çiftçileri, tarımsal gıda tedarik zinciri aktörleri, kamu kurumları ve diğer ilgili paydaş kuruluşları; 6 farklı oturum, paneller ve interaktif yuvarlak masalar aracılığıyla, "tarımsal gıda" alanındaki temel konuları tartışmak ve firmalar arasında yeni ortaklıklar kurmalarına fırsat yaratmak için bir araya getirecektir. Birliğimiz ve EUROCHAMBRES işbirliğinde 28-29 Temmuz 2021 tarihlerinde düzenlenecek olan "Tarımsal Gıda Forumu" etkinliği, aşağıdaki konularda altı interaktif oturumdan oluşmaktadır: 1. Coğrafi İşaretli Ürünler 2. Kuruyemişler ve Meyve 3. Aromatik Bitkiler 4. Dondurulmuş Gıdalar (su ürünleri dahil olmak üzere) 5. Sağlıklı Yaşam için Besleyici Ürünler (vegan, glutensiz, diyabetik vb) 6. Etkinlik için düzenlenen ankete katılan firma ve paydaşların ilgi gösterdikleri konu başlıklarına göre oluşturulacaktır. Etkinliğe katılmak için gündemin de yer aldığıq.surveypal.com/TEBD-Agri-food-Network-Event-Registration/0anketi üzerinden 4 Temmuz 2021 tarihine kadar kayıt yaptırılması gerekmektedir. Etkinlik 28 Temmuz 2021 tarihinde başlayacak olup, etkinlik boyunca Türkçe ve İngilizce simültane çeviri sağlanacaktır. Bilgilerini ve "Türkiye-AB İş Dünyası Diyaloğu (TEBD)" projesi çerçevesinde düzenlenecek olan "Tarımsal Gıda Forumu" etkinliğine katılımınızı rica ederiz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Randevulu Alım Hk.
Sayın Üyemiz, TMO dan gönderilen yazıda, Kurumumuz 2021 dönemi hububat (buğday, arpa, çavdar, tritikale ve yulaf) ve bakliyat alımlarınıgeçtiğimiz yıllarda olduğu gibi randevulu olarak yapacaktır. Lisanslı Depolarda yapılacak alımlardarandevu şartı aranmayacak olup, randevulu alım ile ilgili usul ve esasları içerir duyuru metni yazımızekinde sunulmuştur, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
ICDT - Tarım ve gıda ürünleri konulu ArapAfrika İş Forumu
Sayın Üyemiz, 6-8 Temmuz 2021 tarihlerinde ICDT ve Afrika da Ekonomik Kalkınma için Arap Bankası (BADEA) iş birliğinde tarım ve gıda ürünleri konulu çevrimiçi Arap-Afrika İş Forumu düzenleneceği bildirilmektedir. Anılan etkinliğin programı ekte sunulmakta olup, kayıt ve ayrıntılı bilgi için https://icdtbadeabf2021.floor.bz/ adresinin kullanılması mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Virtual Reverse Trade Mission to California
Sayın Üyemiz, 7 Temmuz 2021 tarihinde Türkiye saatiyle 16:30-17:30 saatleri arasında ABD Ticaret Odası, Birliğimiz, ABD-Türkiye İş Konseyi ve Kaliforniya Valiliği İş ve Ekonomik Kalkınma Ofisi işbirliğinde ABD ve Türk özel sektörlerinden üst düzey temsilciler ve devlet yetkililerinin katılımıyla ABD sanal ticaret misyonu düzenleneceği bildirilmektedir. Yazıda devamla, anılan ticaret heyeti kapsamında Kaliforniya ile iş yapan Türk şirketlerine yönelik fırsatlara odaklanılacağı ve devlet yetkilerinin yatırım teşvikleri konusunda bilgi vereceği belirtilmektedir. Etkinliğe ilişkin broşür ekte sunulmakta olup, ayrıntılı bilgi ve kayıt için https://events.uschamber.com/California adresini kullanmak mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Kamuoyu Açıklaması
Sayın Üyemiz, TMO Genel Müdürlüğünde yapılan açıklamada; Hububat ve yem piyasalarında istikrarı sağlamak ve ürün arzında oluşan açığı kapatmak üzere ihtiyacımız olan hammaddenin bir kısmı dış alımla tedarik edilerek uygun fiyatla piyasaya arz edilmesi ve gıda enflasyonu riskinin önüne geçilmesi planlanmaktadır. Bu doğrultuda ilk etapta 320 bin ton arpa ve yaklaşık 400 bin ton buğday ithalat ihaleleri için iş ve işlemler başlatılmıştır. TMO, her koşulda üreticilerimizin yanında olmaya devam etmektedir. Yem hammaddelerine yönelik gerçekleştirdiğimiz son hamlelerimizin temelinde hayvansal üretimin bel kemiği olan besici ve yetiştiricilerimizin ihtiyacını gidermek ve hayvancılıkla uğraşan çiftçilerimizin yem maliyetlerinin azaltılmasına katkı sağlamak yer almaktadır, bilgisi yer almaktadır. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Devlet Destekli Ticari Alacak Sigortası Hk.
Sayın Üyemiz, Devlet Destekli Ticari Alacak Sigortası Sistemine devlet tarafından taahhüt edilecek reasürans değerine dair karar ın yürürlüğe konulmasına dair karar Resmi Gazetede yayınlandı. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB İkili Odalar a Üyelik
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nin yurtdışında muadili olan özel sektör kuruluşları (Oda/Birlik/Federasyon) ile kurumsal işbirliğini geliştirme çabaları kapsamında, bir dizi ülke ile "Ticaret ve Sanayi Odası Forumu" adı altında yapılanmaya gittiğine ilişkin tarafınıza bilgi verilmiştir. Şu ana kadar, ülkemiz önceliklerine uygun olarak 19 ülkeyle "Ticaret ve Sanayi Odası Forumu" kurulmuş olup, bahse konu çalışmalar sürdürülmektedir. Birliğimizce kurulumuş olan Ticaret ve Sanayi Odası Forumu listesi aşağıda sunulmuştur: · Afganistan: Türkiye-Afganistan Ticaret ve Sanayi Odası Forumu · Arnavutluk: Türkiye-Arnavutluk Ticaret ve Sanayi Odası Forumu · Azerbaycan: Türkiye-Azerbaycan Ticaret ve Sanayi Odası Forumu · Başkurdistan: Türkiye-Başkurdistan Ticaret ve Sanayi Odası Forumu · Bosna Hersek: Türkiye-Bosna Hersek Ticaret ve Sanayi Odası Forumu · Bulgaristan: Türkiye-Bulgaristan Ticaret ve Sanayi Odası Forumu · Endonezya: Türkiye-Endonezya Ticaret ve Sanayi Odası Forumu · Kazakistan: Türk-Kazak Ticaret ve Sanayi Odası Forumu · Kosova: Türkiye-Kosova Ticaret ve Sanayi Odası Forumu · KKTC: Türkiye-KKTC Ticaret Odası Forumu · Kuzey Makedonya: Türkiye-Kuzey Makedonya Ticaret ve Sanayi Odası Forumu · Kırgızistan: Türk-Kırgız Ticaret ve Sanayi Odası Forumu · Moğolistan: Türk-Moğol Ticaret ve Sanayi Odası Forumu · Moldova: Türkiye-Moldova Ticaret ve Sanayi Odası Forumu · Özbekistan: Türk-Özbek Ticaret ve Sanayi Odası Forumu · Pakistan: Türkiye-Pakistan Ticaret ve Sanayi Odası Forumu · Sırbistan: Türkiye-Sırbistan Ticaret ve Sanayi Odası Forumu · Tataristan: Türkiye-Tataristan Ticaret ve Sanayi Odası Forumu · Ukrayna: Türkiye-Ukrayna Ticaret ve Sanayi Odası Forumu İkili "Oda Forumları" kapsamında, hem Türkiye de hem de muhatap ülkede olmak üzere, mevcut koşullar da dikkate alınarak, geniş katılımlı etkinlikler düzenlenmekte olup, bu etkinlikler ile Türk tarafı üyelerinin kendi aralarında, hem de karşı kanat üyeleri ile bir araya gelmesine olanak sağlanmaktadır. Ayrıca düzenlenen geniş katılımlı etkinliklerde, yine muhatap ülkelerin resmi yetkilileri ve çeşitli sektörlerdeki firma temsilcileri ile ikili görüşme fırsatları sunulmaktadır. Ticaret ve Sanayi Odası Forumlarına ilişkin, üyelik dâhil tüm bilgilere, https://tobb.org.tr/IkiliOdalar/Sayfalar/AnaSayfa.php linkinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Automechanika Dubai 2021 Fuarı
Sayın Üyemiz, Birleşik Arap Emirlikleri nin Dubai Emirliği nde her yıl düzenlenen Automechanika Dubai Fuarı Türkiye milli iştirak organizasyonunun 14-16 Aralık 2021 tarihleri arasında İstanbul Ticaret Odasınca gerçekleştirileceği bildirilmektedir. Fuara ilişkin broşür ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Küçük İşletmeler İçin Google Eğitim Programı
Sayın Üyemiz, KOBİ lerin dijitalleşmesine yönelik olarak, internetteki görünürlüğünü sağlaması, müşterilerine farklı dijital kanallar üzerinden satış yapmasının desteklenmesi ve geliştirilmesine yardımcı olmak amacıyla Birliğimiz ve Google iş birliğinde "Küçük İşletmeler İçin Google" projesi başlatılmıştır. https://smallbusiness.withgoogle.com/intl/tr_tr adresinden erişim sağlanabilen platformda KOBİ lerin dijital ekonomiye uyum sağlaması ve bu alanda güçlendirilmesi için gerekli ürünler ile çözüm önerileri adım adım açıklanmaktadır. Platform çerçevesinde ayrıca Küçük İşletmeler için Google Eğitim Programı gerçekleştirilecektir. Ekte görseli bulunan eğitim programı kapsamında; - 22 Haziran 2021 Salı günü saat 14:00 te Küçük İşletmeler için Google Oturumu - 29 Haziran 2021 Salı günü saat 14:00 te Google My Business (GMB) ve Benim İşletmem Dijital Oturumu, - 6 Temmuz 2021 Salı günü saat 14:00 te Google Ads 101 Oturumu ve - 8 Temmuz 2021 Perşembe günü saat 14:00 te Perakende İçgörüleri Oturumu olmak üzere 4 online etkinlik düzenlenecektir. Etkinlikler Youtube üzerinden gerçekleştirilecek olup, katılım ve kayıt adresleri http://webinar.tobb.org.tr adresinde yayınlanacaktır. Etkinlik sonlarında katılımcılara soru-cevap imkanı verilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Dünya Sektörler arası İşbirliği Forumu
Sayın Üyemiz, İnşaat, gıda, tarım, hayvancılık, mobilya, makine, madencilik, enerji, elektrik, tekstil, medikal, hızlı tüketim, genel ticaret ürünleri, sağlık, hizmet sektörü ve dış ticaret sektörlerinden firmaların katılım sağlayacağı Dünya Sektörlerarası İşbirliği Forumu nun 15-16 Eylül 2021 tarihleri arasında İstanbul Pullman Hotel de düzenleneceği bildirilmektedir. Etkinliğe ilişkin tanıtıcı broşür ekte sunulmakta olup, ayrıntılı bilgiye https://www.wciforum.com sitesinden ulaşılması mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Yerleri için Animasyonlu Afet Farkındalık Eğitimi
Sayın Üyemiz, Bildiğiniz üzere, herhangi bir afet durumunda üretimin ve ticaretin en az seviyede etkilenmesinin sağlanabilmesi için işletmelerin de doğal afetlere karşı hazır olması gerekmektedir. İş dünyası afetlere karşı ne kadar hazır olursa Türkiye ekonomisinin de sürdürülebilirliği o denli kuvvetli olacaktır. Bu kapsamda düzenlediğimiz farkındalık eğitimlerinin yanı sıra yapılması gereken yükümlülüklerinizle ilgili bilgi paylaşımlarında bulunmuştuk. Birliğimiz faaliyetleri devam ederken İçişleri Bakanlığımız ile de "2021 Afet Yılı" çalışmaları kapsamında "TOBB-AFAD Eğitim İşbirliği Protokolü" imzaladık. Söz konusu Protokol kapsamında AFAD tarafından iş yerleri için yeni hazırlanan animasyonlu afet farkındalık eğitimi videosuna https://www.youtube.com/watch?v=a6_O_aXy5zo linki üzerinden erişebilirsiniz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
27. Tiran Uluslararası Fuarı Hk.
Sayın Üyemiz, Arnavutluk un başkenti Tiran da 23-26 Kasım 2021 tarihlerinde sanayi, ticaret, yatırım ve hizmet sektöründe faaliyet gösteren firmaların katılacağı 27. Tiran Uluslararası Fuarı nın düzenleneceği bildirilmektedir. Söz konusu Fuar a ilişkin belgeler ekte sunulmakta olup, ayrıntılı bilgi için İstanbul Ticaret Odası ile iletişime geçilmesi mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Karadağ İş Hizmet Sektörü Broşürü
Sayın Üyemiz, Karadağ da yapılabilecek yatırımlara ilişkin bilgiler içeren "Karadağ İş Hizmet Sektörü" isimli broşürün bir örneği ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirleri ile Elektronik Sohbetler - Japonya
Sayın Üyemiz, 23 Haziran 2021 Çarşamba günü saat 10:00 da Japonya da görev yapmakta olan Ticaret Bakanlığı temsilcileri ile Japonya İthalat ve Yatırım Ajansı Danışmanı Makoto Nakamura ve Global Media Corporation CEO su Masanori Tonegawa nın konuşmacı olarak katılarak iş insanlarımızı bilgilendireceği "Japonya Gıda Pazarında Başarılı Olmak" isimli e-sohbet toplantısının gerçekleştirileceği bildirilmektedir. Toplantıya katılmak için gerekli link bilginize sunulmuştur. https://bit.ly/3wqnCly Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB - Türkiye-Kırgızistan Karma Ekonomik Komisyonu
Sayın Üyemiz, Eşbaşkanlığı Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay tarafından deruhte edilen Türkiye-Kırgızistan Karma Ekonomik Komisyonu (KEK) 10. Dönem toplantısının ileri bir tarihe ertelendiği ifade edilerek, firmalarımızın yaşadıkları sorunlar ve bu sorunların aşılmasına yönelik olası çözüm önerilerine dair görüşler talep edildiği bildirilmektedir. Bilgilerinizi, konunun ilgili üyelerinize duyurulmasını ve iki ülke arasında yaşanan sorunlara dair ilişkin görüşlerin derlenerek 24 Haziran 2021 tarihi mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) adresine iletilmesini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB Nefes Kredisi 2021
Sayın Üyemiz, Nefes Kredisi uygulamasının tekrar başlatılacağı ve krediden 2020 yılı cirosu 2019 yılı cirosuna göre %25 düşük olan üyelerin faydalanabileceği belirtilmiştir. Oda ve borsalarımız ile üyelerden gelen talep doğrultusunda %25 ciro kaybı kriteri kaldırılmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tarım Ürünleri İthalatında Tarife Kontenjanlarında Yapılan Değişiklik
Sayın Üyemiz, Bazı Tarım ve İşlenmiş Tarım Ürünleri ithalatında tarife kontenjanı uygulamasına ilişkin kararda yapılan değişiklik Resmi Gazetede yayınlandı. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Katma Değer Vergisi Oranlarında Değişiklik
Sayın Üyemiz, Mal ve Hizmetlere uygulanacak Katma Değer Vergisi Oranlarının Tespitine ilişkin kararda yapılan değişiklik Resmi Gazetede yayınlandı. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Destekleme Ödemesi Hk.
Sayın Üyemiz, Tarım Ürünleri Lisanslı Depoculuk Kanunu kapsamında faaliyet gösteren Lisanslı Depolarda Muhafaza edilmesi halinde destekleme ödemesi yapılmasına ilişkin karar Resmi Gazetede yayınlandı. İlgili karar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bakliyat Peşin Satışlar
Sayın Üyemiz, TMO Mersin Şube Müdürlüğü stoklarına bulunan ve ekli listede (Ek-1) yer alan Pirinçler (Ek-2) yeralan fiyatlarla tarihlerinde 21-30 Haziran 2021 para yatırmak ve 16 Temmuz 2021 tarihine kadar teslimat yapılmak kaydıyla kişi ve kuruluş ayrımı yapılmaksızın serbest olarak peşin bedel mukabilindesatılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Çeltik Satışı
Sayın Üyemiz, TMO Bandırma Şube Müdürlüğünün stoklarında bulunan 3579 kodlu 3.150 ton 2020 mahsulüYunanistan Ronaldo çeltik fiyatla (KDV ve maniplasyon hariç, nakliye 3.600 TL/Ton ilave ücretidâhildir.) Bandırma Şube Müdürlüğünce kişi ve kuruluş ayrımı yapılmaksızın serbest olarak peşinbedel mukabili satılacaktır. Randımana göre uygulanacak satış fiyatları ekteki (Ek-1) tabloda belirtilenşekilde uygulanacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Lojistik Sektöründe Gıda KaybınıAzaltmaya Yönelik Rehber Doküman-Görüş Talebi
Sayın Üyemiz, Lojistik Sektöründe Gıda Kaybını Azaltmaya YönelikRehber Doküman hazırlandığı bildirilerek, söz konusu Rehber hakkında görüş talebinde bulunulmaktadır. Lojistik Sektöründe Gıda Kaybını Azaltmaya Yönelik Rehber Doküman ekte gönderilmekte olup, konuyailişkin varsa görüşünüzü Borsamıza (eskisehirtb@tobb.org.tr) 21.06.2021 saat 14.00 a kadar iletilmesini ricaederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-Afganistan Ekonomik ve Teknik İşbirliği Ortak Komitesi III. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Afganistan Ekonomik ve Teknik İşbirliği Ortak Komitesi III. Dönem Toplantısı nın 10-11 Temmuz 2021 tarihlerinde Kabil de gerçekleştirilmesinin planlandığı bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Afganistan ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 24 Haziran 2021 Perşembe günü mesai bitimine kadar Borsamıza (eskisehirtb@gmail.com) iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
5. Antalya Devlet Destekleri Zirvesi
Sayın Üyemiz, Antalya Ticaret ve Sanayi Odası ndan alınan yazıda; ATSO tarafından girişimcilerimizin mevcut desteklerden haberdar olabilmesi için 24 Haziran 2021 Perşembe günü çevrimiçi olarak 5. Antalya Devlet Destekleri Zirvesi düzenlenmesi planlandığı belirtilmektedir. Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yapılandırma Hakkında
Sayın Üyemiz, 7326 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun 09.06.2021 tarihli Resmi gazetede yayımlanmıştır. Kanun içeriğine ilişkin açıklamalar aşağıda yer almaktadır: 1. KAPSAM Kanun un 10 uncu maddesinin 4 inci fıkrası uyarınca 30/4/2021 tarihi itibarıyla ödenmesi gerektiği hâlde bu Kanunun yayımı tarihine kadar ödenmemiş olan; a) Üyelerin oda ve borsalara olan aidat, navlun hasılatından alınacak oda payları ve borsa tescil ücreti borç asılları, b) Oda ve borsaların Birliğimize olan aidat borçları asılları, Kanun kapsamında yapılandırmaya tabi tutulabilecektir. Bu çerçevede üyelerin oda ve borsalara olan 2021 yılı aidat ödemeleri ile oda ve borsaların Birliğimize olan 2021 yılı aidat ödemeleri yapılandırma kapsamında değildir. Bununla birlikte üyelerin oda ve borsalara olan 2020 yılı ve öncesi dönemlere ait aidat ödemeleri ile oda ve borsaların Birliğimize olan 2020 yılı ve öncesi dönemlere ait aidat ödemeleri yapılandırma kapsamında olacaktır. 2. VERGİ MÜKELLEFİYETİ SİLİNEN ÜYELER 17/11/2020 tarihinde yürürlüğe girmiş olan 7256 sayılı Kanun kapsamında yer alan, "vergi mükellefiyeti sona ermiş üyelerin, vergi mükellefiyetinin sona erdiği tarihten sonraki borç asıl ve faizlerinin re sen silinmesi" uygulamasına, 7326 sayılı Kanunda yer verilmemiştir. Bu nedenle vergi mükellefiyeti sona ermiş üyeler bakımından, 7326 sayılı Kanun kapsamında tesis edilmesi gereken bir işlem bulunmamaktadır. 7256 sayılı Kanun gereği olarak vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetinin sona erme tarihi ile 17/11/2020 tarihi arasındaki borç asıl ve faizleri re sen silinmiştir. Bu kapsamdaki üyelerin 17/11/2020 tarihinden sonra tahakkuk etmiş ancak vadesi gelmiş bir borçları da bulunmadığından, Yapılandırma kapsamında olmadıkları değerlendirilmektedir. Öte yandan vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetlerinin sona erme tarihinden önceki borçlarının asılları, 7326 sayılı kanun kapsamında yapılandırılabilmektedir. 3. BORÇ SİLİNMESİ ve ÖDEME Yapılandırma kapsamındaki borç asıllarının tamamının kanunda belirtilen ve şekilde ödenmesi halinde faiz, gecikme faizi, gecikme zammı gibi fer i alacakların tahsilinden vazgeçilir. Bununla birlikte yapılandırma kapsamında olan ve Kanunun yayımı tarihinden önce kısmen veya tamamen ödenmiş olan borç asıllarına isabet eden faiz, gecikme faizi, gecikme zammı gibi fer i alacakların da tahsilinden vazgeçilir. Kanun kapsamındaki borçlar için yapılandırmaya başvuranların, borç taksitlerinin birincisini Kanunun yayımlandığı tarihi takip eden dördüncü ayın sonuna kadar (31/10/2021), kalanını ise aylık dönemler hâlinde ve azami toplam altı eşit taksitte (son taksit tarihi 31.03.2022) ödemesi gerekmektedir. Azami altı taksitekadar olan yapılandırma hakkının ne şekilde kullanılacağını üye başvurusunda belli edecektir. Üye tarafından belirlenecek olan taksit adedi, ödenecek toplam borç tutarını değiştirmeyecektir. Üyeler, toplam anapara borç tutarını yukarıda belirtilen taksit sürelerini geçmemek üzere kredi kartına da taksitlendirebileceklerdir. Üyeler, Kanunun yayımlandığı tarihi takip eden üçüncü ayın sonuna kadar (30/09/2021) başvuruda bulunabileceklerdir. Başvuru fiziksel olarak yapılabileceği gibi ebelge.tobb.org.tr veya e-devlet üzerinden de yapılabilecektir. Başvurularda, yapılandırma kapsamında kaç taksit talep edildiğinin belirtilmesi gerekmektedir. Yapılandırmaya başvuru anında askıya alınmış olan üyelerin, ilk taksit ödemeleri ile beraber askıdan indirilmesi gerekmektedir. Ancak bu şekilde askıdan indirilen üyenin, herhangi bir taksiti ödemeyerek yapılandırmayı bozması halinde yeniden askıya alınması gerekmektedir. 4. MUHASEBE İŞLEMLERİ Bu fıkra kapsamında ödenmesi gereken tutarların fıkrada öngörülen süre ve şekilde kısmen veya tamamen ödenmemesi hâlinde, ödenmemiş alacak asılları ile bunlara ilişkin faiz, gecikme faizi, gecikme zammı gibi fer i alacaklar ilgili mevzuat hükümlerine göre tahsil edilir. Bu ana kadar yapılan tahsilatlar Bütçe ve Muhasebe Yönetmeliğinin 58 inci maddesinde belirtilen sıralamaya göre borçtan düşülür ve kalan kısma 6183 sayılı Amme Alacaklarının Tahsil Usulü Hakkında Kanun uyarınca günlük gecikme zammı tahakkuk ettirilmeye devam edilir. 5. UYUŞMAZLIK KONUSU ALACAKLAR Yapılandırmadan faydalanacak kişilerin, yapılandırmaya konu borçlarına dava açmamaları, açılmış davalardan vazgeçmeleri şarttır. Bu Kanunun yayımı tarihinden önce dava konusu edilmiş ve/veya mahkemece hükme bağlanmış ve kesinleşmiş olanlar dâhil olmak üzere icra takibi başlatılmış alacaklar için, borçlunun bu fıkra hükümlerinden yararlanmak üzere başvuruda bulunması hâlinde davalar ve/veya icra takipleri sonlandırılır. Bu kapsamda, tamamı ödenen alacaklara ilişkin yargılama giderleri ile icra masrafları ve vekâlet ücretleri karşılıklı olarak talep edilmez. 6. 7256 SAYILI KANUN KAPSAMINDA YAPILANDIRILAN ALACAKLAR Üyelerin 7256 sayılı Kanun kapsamında yapılandırmış olduğu alacaklar kural olarak 7326 sayılı Kanun kapsamında değildir. Bu bakımdan 7256 sayılı Kanun kapsamında yapılandırması devam eden ve taksitlerini vadesinde ödemeye devam eden üyelerin mevcut yapılandırmalarına uygun davranmaları gerekmektedir. 7256 sayılı Kanun kapsamında taksitlerden herhangi birisini ödemediği için yapılandırması bozulan ve ödenmemiş anapara, faiz ve fer isi yeniden tahakkuk ettirilen üyelerin 7326 sayılı Kanun kapsamında yapılandırmaya başvurması mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
SMA Tip2 Hastası Toprak Bebek İçin Yardım Kampanyası
Sayın Üyemiz, Eskişehir de yaşayan3,5 yaşındakiToprakYavaş,SMATip2 hastalığıyla mücadele etmektedir. Yurt dışında gerekli tedaviyi alması halinde Toprak bebek sağlığına kavuşabilecektir. Bu sebeple Toprak bebeğin tedavisi için Eskişehir Valiliği’nin izniyle kampanya başlatılmıştır. Kampanyaya katılım ve destek için banka hesap numarası: Banka:Denizbank (Türk Lirası Hesabı) IBAN No:TR 55 0013 4000 0110 4110 8000 01 Hesap Sahibi:Reyhan YAVAŞ Eskişehir Ticaret Borsası
ACID Numarası Uygulaması, NAFEZA ve Cargo-x Platformları Webinarı
Sayın Üyemiz, ACID (Advanced Cargo Information System-GönderiÖn Bilgilendirme) uygulaması ile ilgili mevcut soru/sorunların değerlendirilerek meselelerinaydınlatılabilmesi amacıyla, 16 Haziran 2021 Çarşamba günü Kahire saati ile 12.00 da (TSİ 13.00) herkeseaçık olacak şekilde İngilizce dilinde bir webinar düzenleneceği belirtilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
MASAK Bilgilendirme Semineri Hk.
Sayın Üyemiz, 01 Temmuz 2021 Perşembe günü saat 14:00 da internet üzerinden; Kuyumcular, Emlak Danışmanları, İkinci El Araç Ticareti Yapanlar ile Bağımsız Denetim Kuruluşları ve Muhasebeciler için MASAK Bilgilendirme Semineri düzenlenecektir. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; mezkur sektörlerde faaliyet gösterenlere yönelik olarak, Mali Suçları Araştırma Kurulu (MASAK) tarafından kara para aklama, terörizmin finansmanı ile mücadele ve kitle imha silahlarının finansmanının yayılmasının önlenmesi hususları anlatılacaktır. Seminere ilişkin davet ekte sunulmaktadır. Seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Turquality Destekleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden "Turquality Destekleri Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TURQUALITY; uluslararası gelişme potansiyeli olan mal ve hizmet ihracatçısışirketlerin faydalandığı devlet destekli bir markalaşma programıdır. Yararlanıcı şirketleri, yüksek katma değer oluşturan, küresel pazarlarda pazar payını artıran, güçlü markalaşma stratejisine sahip, üretimden satış ve satış sonrası hizmetlere kadar tüm süreçleri kapsayacak şekilde yönetsel bilgi birikimine sahip kurumsal yapılar hâline dönüştürmeyi ve uluslararası pazarda küresel marka haline gelmelerini hedefler. Ayrıca, bu markalar kanalıyla Türk malı imajının oluşturulmasını destekler. Eğitimde; mal ve hizmet ihracatında Turquality ve marka destek programları, bunların öngördüğü süreçler, şirketlere sağlanan faydalar, başvuru süreçleri, detaylı şekilde ele alınacaktır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Turquality Destekleri Eğitimi" sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin %70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB ile AB-Çin KOBİ Merkezi Mutabakat Zaptı Lansmanı ve Bilgilendirme Semineri
Sayın Üyemiz, 17 Haziran 2021 Perşembe günü saat 11:00 da internet üzerinden; TOBB ile AB-Çin KOBİ Merkezi Mutabakat Zaptı Lansmanı ve Bilgilendirme Semineri düzenlenecektir. Seminer programı ekte sunulmaktadır. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; TOBB, Eurochambres ve AB Çin KOBİ Merkezi işbirliğinde KOBİ leri Çin ile iş yapmaya hazırlamak ve halihazırda Çin ile iş yapan KOBİ lere destek olmak amacıyla kurulan AB Çin KOBİ Merkezi ile Birliğimiz arasında imzalanan Mutabakat Zaptı nın lansmanı gerçekleştirilecek, Merkez in KOBİ lere yönelik ürün ve hizmetleri anlatılacak ve seminer sonunda katılımcıların soruları cevaplanacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Global Business Executive Retreat 2021
Sayın Üyemiz, Bosna Hersek Dış Ticaret ve Ekonomik İlişkiler Bakanlığı, Yabancı Yatırımcılar Konseyi ve BH Yatırım Teşvik Ajansı (FİPA) ortaklığında 1-4 Temmuz 2021 tarihleri arasında Jahorina Kayak Merkezi nde Global Business Executive Retreat 2021 konferansının düzenleneceği bildirilmektedir. Bahse konu etkinliğe ilişkin bilgi ve kayıt linki ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Angola Bilgi Notu
Sayın Üyemiz, Angola Cumhurbaşkanı Joao Manuel Gonçalves Lourenço nun 27 Temmuz 2021 tarihinde ülkemize resmi bir ziyaret gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bu itibarla, ilgili ziyaretin hazırlıkları için Dışişleri Bakanlığı na iletilmek üzere, Angola ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin görüşlerinizin en geç 18 Haziran Cuma gününe kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Moğolistan Madencilik 2021 Fuarı Hk.
Sayın Üyemiz, Moğolistan Madencilik ve Ağır Sanayi Bakanlığı koordinasyonunda ve Minex Mongolia LLC firması organizatörlüğünde, 1-3 Eylül 2021 tarihlerinde Moğolistan ın başkenti Ulan Bator da madencilik alanında Uluslararası 10. Mongolia Mining Fuarı nın düzenleneceği belirtilmektedir. Fuar için davet mektubunun bir örneği ekte yer almakta olup, detaylı bilgiye http://mongolia-mining.com bağlantısından ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fransa Ambalaj Tasarısı
Sayın Üyemiz, Fransa nın israfın önlenmesi ve döngüsel iktisat ile ilgili kanun tasarısının, 1 Ocak 2022 tarihinde yürürlüğe girmesinin öngörüldüğü bildirilmektedir. Yazıda, ilgili kanun tasarısı ile Fransa nın meyve ve sebze ithalatının aşağıda açıklandığı şekilde etkilenmesinin beklendiği belirtilmiştir: 1) Plastik ambalajın yasaklanması hususunda: 1.1. Kanunun 77. maddesi çerçevesinde, işlenmemiş sebze ve meyvelerin satışında ürünlerin kısmen veya tamamen plastik ambalaj olmaksızın teşhir edilmesi gerektiği açıklanmıştır. 1.2. Her ne kadar plastik ambalaj kullanımının yasaklanması Fransa da faaliyet gösteren toptancı ve perakendecileri hedef alsa da, ürünlerin ihraç edilmeden önce paketleniyor olduğu göz önünde bulundurulduğunda, alınan kararların ithalatçılarımızı doğrudan etkileyebileceğinin düşünülmekte olduğu ifade edilmiştir. 1.3. Fransız Hükümeti tarafından plastik ambalaj olmaksızın pazarlanması halinde zarar göreceği için bu hükümden muaf olan ürünlere ait taslak listenin yayınlandığı ifade edilerek; 1.3.1.Söz konusu hükümden, yıkanmış ve hazırlanmış (doğranmış yeşil fasulye vb.) ürünlerin muaf olduğu, 1.3.2. Olgunlaşmadan koparılan ve olgunlaşma merkezlerinde satış öncesi olgunlaştırılan meyvelerin (mango, muz ve avokado gibi) plastik ambalaj yasağına dâhil edildiği, bilgileri verilmiştir. Ayrıca, Fransız Meyve ve Sebze İthalatçıları Derneği CSIF yetkililerinin, yıkanmış ve ön hazırlık yapılmış sebzeler ve olgunken koparılmış meyvelerin de bu muafiyetten yararlanabilmesi için Fransız yetkilileri ile görüşmelerine devam ettikleri ifade edilmiştir. 2)Yapışkanlı etiket yasağı hususunda: 2.1. Kanunun 80. Maddesi uyarınca, 1 Ocak 2022 tarihinden itibaren kompost yapılması (doğal gübreye dönüştürülmesi) mümkün olmayan etiket kullanımının yasaklanmasının öngörüldüğü belirtilmiştir. Kanunmetninden, ürünlerin doğrudan üzerine uygulanan etiketlerin yasaklamasının öngörüldüğünün anlaşılmakta olduğu; ancak Fransa ya gönderiminden önce üzerine kompost yapılamayan etiket yapıştırılmış olan ürünlerin perakendecilerde satılmasının mümkün olup olmadığı konusunun henüz belirsiz olduğunun anlaşıldığı açıklanmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Estonya Hak.
Sayın Üyemiz, Ticaret Bakanımız Sayın Mehmet MUŞ un, 12-13 Temmuz 2021 tarihlerinde Estonya yı ziyaret edeceği, söz konusu ziyaret sırasında Türkiye-Estonya Ekonomik ve Ticaret Ortak Komite (JETCO) Kurucu Bildirinin imzalanmasının planlandığı bildirilmektedir. Bu kapsamda, Ticaret Bakanlığı tarafından hazırlık çalışmalarında yararlanmak üzere, Türkiye - Estonya ticari ve ekonomik ilişkilerinde yaşanan sorunlar ve çözüm önerilerine dair görüşlerinizin 18 Haziran 2021 Cuma günü mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çin Halk Cumhuriyeti Sohbet Toplantısı
Sayın Üyemiz, 16 Haziran 2021 Çarşamba günü saat 10.30 da Guanco Ticaret Ataşemizin moderatörlüğünde, Çin in en büyük sınır-ötesi e-ticaret platformu olan, Alibaba Group bünyesindeki TMALL Global yetkililerinin konuşmacı olarak katılarak, moda ve bebek / anne ürünleri kategorilerinde TMALL Global platformu aracılığıyla Çin e-ticaret pazarına giriş imkanlarını, bilgi ve tecrübelerini Türk iş insanlarıyla paylaşacağı e-sohbet toplantısının İngilizce olarak gerçekleştirileceği belirtilmektedir. TMALL Global bünyesinde moda ile bebek / anne kategorilerinde yer alan ürünlere ilişkin liste ile toplantı detayları ve katılım linkini içeren program ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
ABD - Türkiye Hidrojen Enerjisi ve Yakıt Deposu Teknolojileri Forumu
Sayın Üyemiz, 15-16 Haziran 2021 tarihlerinde Cisco Webex platformu üzerinden T.C. Enerji ve Tabii Kaynaklar Bakanlığı, ABD Enerji Bakanlığı, ABD Ticaret Bakanlığı ve ABD Dışişleri Bakanlığı tarafından desteklenen "ABD - Türkiye Hidrojen Enerjisi ve Yakıt Deposu Teknolojileri Forumu" düzenleneceği bildirilmektedir. Yazıda devamla, ilgili etkinlik dilinin İngilizce olacağı ve tercüme hizmeti sağlanmayacağı ve yalnızca ABD ve Türk firmaları ile her iki ülkeden devlet yetkililerine açık olacağı belirtilmektedir. Anılan etkinliğin broşürü ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Rusya Federasyonu Tarafından Alınan Tedbirler
Sayın Üyemiz, 15 Nisan - 1 Haziran 2021 tarihleri arasında Rusya Federasyonu ve Türkiye arasındaki tarifeli ve "charter" uçuşlara getirilen geçici kısıtlama kararı hakkında,31 Mayıs 2021 tarihinde yapılan açıklamada; söz konusu geçici kısıtlama uygulamasının 21 Haziran 2021 tarihine kadar (anılan tarih dahil) uzatıldığı belirtilmektedir. Bu aşamada, Rusya Federasyonu na yönelik olarak gerek fuar katılımı gerekse iş ziyareti kapsamında seyahat öngören ihracatçı ve iş insanlarımızın THY yetkililerince yapılacak bilgilendirme ve uyarılara azami dikkat göstermesinde fayda mülahaza edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Genç Girişimci Online Network Programı
Sayın Üyemiz, Ticaret Bakanlığı İhracat Genel Müdürlüğü Kadın ve Genç Girişimciler İhracat Dairesi Başkanlığı tarafından, ülkemiz ihracatının arttırılması vizyonuna ve genç girişimcilerin ihracata yönelmelerine katkı sağlayacak şekilde, genç girişimcilerimize yönelik bir network ağı oluşturmak amacıyla Genç Girişimci Online Networkü Projesi hayata geçirilmiştir. Proje kapsamında yapılacak network toplantıları ihtiyaç duyuldukça yapılacak olup, Projeyle ulusal düzeyde tüm genç girişimcilerimize ulaşılması ve gerekli bilgilendirmelerin yapılabilmesi amaçlanmaktadır. Bu doğrultuda, Genç Girişimci Online Network Projesi kapsamında İlimizde 1 Temmuz 2021 saat 10.30 da düzenlenecek toplantı elektronik ortamda Zoom uygulaması üzerinden gerçekleştirilecek olup katılım sağlamak isteyen tüm genç girişimcilerimizin Borsamıza (eskisehirtb@tobb.org.tr) bilgilerini iletmeleri gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Filistinli Firma Talepleri
Sayın Üyemiz, Filistinli firmaların Türk ihracatçı firmalardan çeşitli ürünleri ithal etmek istedikleri belirtilmekte olup, ilgili firmaların iletişim bilgileri ve konuya ilişkin talepleri ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ulaştırma Elektronik Takip ve Denetim Sistemi (U-ETDS) Bölgesel Seminerleri
Sayın Üyemiz, Karayolu Taşıma Yönetmeliği çerçevesinde adlarına C2, C3, K1, K3, L1, L2, N1, N2, R1, R2, M1, M2, P1, P2, T1 ve/veya T2 yetki belgesi düzenlenmiş firmaların, faaliyetlerine ilişkin bilgilerini Ulaştırma Elektronik Takip ve Denetim Sistemine (U-ETDS), elektronik olarak eklemeleri/iletmeleri zorunlulukları kapsamında Birliğimiz üyesi gerçek ve tüzel kişilerin bilgilendirilmesi amacıyla Ulaştırma ve Altyapı Bakanlığı himayesinde ve Birliğimiz ev sahipliğinde bölgesel elektronik toplantılar düzenlenmesi planlanmıştır. Planlanan toplantılar webinar şeklinde gerçekleştirilecek olup, katılımcılar soruları ile görüş ve önerilerini hem sistem üzerinden mesaj yazmak suretiyle iletebilecek, hem de sistem üzerinden söz isteyip sözlü olarak iletebileceklerdir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Connecting European Chambers" Davet Yazısı
Sayın Üyemiz, Birliğimizin üyesi olduğu ve Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu nun Başkan Yardımcılığını yürüttüğü Avrupa Ticaret ve Sanayi Odaları Birliği (EUROCHAMBRES) tarafından 29 Haziran-1 Temmuz 2021 tarihleri arasında Avrupa daki bütün yerel/bölgesel odaların davetli olduğu "Connecting European Chambres" adlı etkinlik düzenlenecektir. EUROCHAMBERS tarafından 6. kez düzenlenen "Avrupa Odalarını Buluşturma" etkinliğinin amacı; - Avrupa Birliği nin önümüzdeki dönem sağlayacağı farklı hibe imkânları hakkında yerel ve bölgesel odaları bilgilendirmek, - Avrupa daki yerel ve bölgesel odalar arasında işbirliği ve iletişim ağını geliştirip güçlendirmek, - Odalar arası iyi uygulama örneklerinin ortaya konulmasını sağlamaktır. Etkinlik sadece yerel, bölgesel ve ulusal odalarda AB projeleri ile ilgilenen personele yönelik olarak tasarlanmıştır. Etkinliğin ve 3 gün boyunca yapılacak bütün çalıştayların dili İngilizce olup çeviri imkânı bulunmamaktadır. Etkinlik pandemi nedeniyle bu yıl online olarak gerçekleştirilecektir. Etkinliğe https://www.eventbrite.com/e/connecting-europeanchambers-2021-registration-153434515767 adresinden kayıt yapılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yazılım Dünyasında Fikri ve Sınai Mülkiyet Hakları Webinarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği Türkiye Patent ve Marka Vekilleri Meclisi ve Türkiye Yazılım Meclisi tarafından 16 Haziran 2021 tarihinde saat 14.30 da "Yazılım Dünyasında Fikri ve Sınai Mülkiyet Hakları" isimli bir seminer gerçekleştirilecektir. Toplantıya http://webinar.tobb.org.tr adresinde yer alan linkten erişim sağlanabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ayçiçek Tohumu İthalatında Sıfır Gümrük Vergisi Uygulaması Devam Edecek
Sayın Üyemiz, Ayçiçek tohumu ithalatında 31 Aralık 2020 tarihli Cumhurbaşkanı kararıyla 30 Haziran a kadar sürmesi öngörülen sıfır gümrük vergisi uygulaması sürecek. Resmi Gazete nin 13 Haziran tarihli sayısında yayımlanan ithalat rejimi kararında değişiklik yapılmasına ilişkin kararla, söz konusu Cumhurbaşkanı kararıyla ayçiçek tohumu ithalatının sıfır olarak belirlenen gümrük vergisinin 30 Haziran a uygulanmasına dair sınırlamayı içeren dipnot yürürlükten kaldırıldı. Kararlar ayrıca, 31 Aralık 2020 tarihli Cumhurbaşkanı kararıyla ayçiçek tohumu yağı için kapsam dahilindeki tüm ülkelerden yapılan ithalata uygulanması ve dipnotta 30 Haziran da sona ermesi öngörülen yüzde 36 oranındaki gümrük vergisi, 13 Haziran dan 30 Haziran a kadar yüzde 10 a düşürüldü. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hayvan Hastalıklarında Tazminat Yönetmeliğinde Değişiklik Yapılması Hakkında Yönetmelik
Sayın Üyemiz, Resmî Gazete’de yayımlanan Hayvan Hastalıklarında Tazminat Yönetmeliğinde yapılan değişiklik ve ayrıntıları için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Borç yapılandırması Resmi Gazete`de yayımlandı
Sayın Üyemiz, Gelir ve kurumlar vergisi, karşılıksız çek, protesto edilmiş senet, kredi kartı ve diğer kredi borçlarına ilişkin kayıtlar, vergi tahriyatları, gümrük vergileri, sigorta primleri, KYK borçlarının yapılandırılmasıyla ilgili kanun Resmi Gazete de yayımlanarak yürürlüğe girdi. Milyonlarca kişiyi ilgilendiren borç yapılandırmasına ilişkin yasa TBMM de kabul edilmesinin ardından Resmi Gazete de yayımlanarak yürürlüğe girdi. Yasaya göre, Hazine ve Maliye Bakanlığı, Ticaret Bakanlığı, Sosyal Güvenlik Kurumu, il özel idareleri, belediyeler ile Yatırım İzleme ve Koordinasyon Başkanlığına 30 Nisan 2021 e kadar olan bazı borçlar yapılandırılacak. Hangi borçlar yapılandırma kapsamına alındı - Belediyelerin su, atık su ve katı atık ile sunduğu bazı hizmetlerden kaynaklanan ücret alacakları, aldığı bazı paylar, büyükşehir belediyelerinin katı atık ücretleri ile su ve kanalizasyon idarelerinin su ve atık su bedeli alacakları, - Türkiye Esnaf ve Sanatkarları Konfederasyonu, Türkiye Barolar Birliği, Türk Mühendis ve Mimar Odaları Birliği, Türk Tabipleri Birliği, Türk Diş Hekimleri Birliği ile Türk Veteriner Hekimleri Birliğinin bazı alacakları yapılandırılacak, - Her bir taşıt için motorlu taşıtlar vergisi, taşıta ilişkin idari para cezaları ile geçiş ücretinin en az yüzde 10 unun ödenmesi şartıyla taksit ödeme süresince fenni muayene izni verilecek, - Yabancı Memleketlere Gönderilecek Talebe Hakkında Kanun kapsamında yurt dışında öğrenim görenlerin borçlarının da yeniden yapılandırılmasına imkan sağlanacak, - Kesinleşmemiş ya da yargı aşamasında olan resen veya idarece yapılmış vergi tarhiyatları ile gümrük vergileri, çeşitli oranlarda yapılandırılacak. Hesaplanan borç, ilgilinin durumu ve ödenmesi gereken meblağ dikkate alınarak azami 5 yıla kadar taksitlendirilebilecek. Yapılandırılacak tutarların, kanunda öngörülen süre ve şekilde ödenmemesi halinde vade tarihinde değişiklik yapılmayacak. COVID-19 cezaları kapsam dışı Yasaya göre, SGK prim borçları, gümrük cezaları da yeniden yapılandırılabilecek. Otoyol ve köprü cezaları da bu kapsam içinde yer aldı. Koronavirüsle mücadele kapsamında kesilen idari para cezaları ise yapılandırma dışında tutulacak. İlk taksit ödemeleri için son tarih eylül sonu 30 Nisan tarihinden önceki kesinleşmiş borçlar yapılandırmadan yararlanacak. Bunun için 31 Ağustos a kadar başvuru yapılması gerekecek. İlk taksit ödemeleri eylül sonuna kadar yapılacak. İlgili Kanun içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Helal Teknik Eğitimi
Sayın Üyemiz, Helal Akreditasyon Kurumu tarafından 21-24 Haziran 2021 tarihlerinde helal uygunluk değerlendirme kuruluşlarında çalışan/çalışacak kişilere yönelik teknik mahiyette çevrimiçi eğitim verileceği bildirilmektedir. Yazıda devamla, eğitim kontenjanının 20 kişiyle sınırlandırıldığı ve katılım ücretinin 1.000 TL/kişi olduğu belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler - Angola
Sayın Üyemiz, 10 Haziran 2021 Perşembe günü 14.00-15.30 saatleri arasında Angola da görev yapmakta olan Ticaret Müşavirimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Toplantının programı ve katılım linki ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler-Moldova
Sayın Üyemiz, 8 Haziran 2021 Salı günü günü 14:00-15:30 saatleri arasında Moldova da görev yapmakta olan Ticaret Müşavirlerimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu etkinliğin programı ve kayıt linki ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
60.000 Kg Mezbuh Taze Soğutulmuş Gövde (Karkas) Tosun Eti Alımı İçin Piyasa Araştırması
Sayın Üyemiz, Et ve Süt Kurumu Kombina Müdürlüğünce Ek (1) de teknik şartname esaslarına uygun 60.000 kg Mezbuh Taze Soğutulmuş Gövde (Karkas) Tosun Eti alımı planlanmaktadır. Söz konusu alım için yaklaşık maliyet hesaplamasında kullanılacak serbest piyasa birim fiyatlarınızı 09.06.2021 Çarşambasaat 12:00 e kadar 0 (312) 270 42 14 numarasına fax olarak veya mgultekin.gulhan@esk.gov.tr mail adresine, Ek (2) de bulunan birim fiyat cetveline bedel, rakam ve yazı birbirine uygun olarak açıkça yazılarak, üzerinde kazıntı, silinti ve düzeltme yapılmadan, kaşe ve imzalı bir şekilde gönderilmesi talep edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Organize sanayi bölgelerinde (OSB) yer alan parsellerin tamamen veya kısmen bedelsiz olarak tahsis edilmesi Hk.
Sayın Üyemiz, Organize sanayi bölgelerinde (OSB) yer alan parsellerin tamamen veya kısmen bedelsiz olarak tahsis edilmesi uygulaması 31 Aralık 2024 e kadar uzatılmıştır. Konuya ilişkin Cumhurbaşkanı Kararı, Resmi Gazete de yayımlanarak yürürlüğe girmiş olup ekte sunulmaktadır. Buna göre, OSB lerdeki yatırımların, üretim ve istihdamın artırılmasının sağlanması amacıyla buralarda yer alan parsellerin tamamen veya kısmen bedelsiz olarak tahsis edilmesine imkan veren uygulama, 31 Aralık 2024 e kadar sürecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
AB Çin KOBİ Merkezi
Sayın Üyemiz, KOBİ leri Çin ile iş yapmaya hazırlamak ve halihazırda Çin ile iş yapan KOBİ lere destek olmak amacıyla 2010 yılında Pekin de AB KOBİ Merkezi kurulmuştur. Söz konusu Merkez ile Birliğimiz arasında Mayıs 2021 de imzalanan mutabakat zaptı çerçevesinde, Merkez in hizmetlerinden ülkemiz KOBİ leri de faydalanabilmektedir. AB Çin KOBİ Merkezi tarafından ülkemiz KOBİ lerine yönelik olarak; - Çin pazarı ve Çin pazarına hazırlık konularında kılavuzlar, eğitimler - İşletmelerin Çin pazarına hazırlıklarını ölçmek için testler, - Ülkemiz KOBİ lerinin Çin pazarı hakkında sorularını cevaplamak üzere Danışma/Tavsiye Merkezi, - Piyasa araştırma raporları, hukuki konuların yer aldığı veri tabanları, - Çin e yönelik B2B ve Ticaret Heyeti organizasyonu hizmetleri sunulmaktadır. Merkezin hizmetlerinden faydalanabilmek için https://www.eusmecentre.org.cn/user/register adresinden Merkez in web sitesine kayıt olunması gerekmektedir. AB Çin KOBİ Merkezi ve hizmetleri hakkında detaylı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hiper Otomasyon ve Robotik Süreç Otomasyonuna Giriş Eğitimi
Sayın Üyemiz, TOBB, TOBB ETÜ ve Global Al Hub iş birliğinde yürütülen Yapay Zeka Eğitim ve Farkındalık Projesi kapsamında "Hiper Otomasyon ve Robotik Süreç Otomasyonuna Giriş Eğitimi" gerçekleştirilecek olup 7 Haziran 2021 Pazartesi günü bu eğitime yönelik webinar gerçekleştirilecektir. Webinara katılım sağlayanların ücretsiz olarak devam edecekleri online eğitimde; gerçek dünya problemlerinden başlayarak RPA nın temelleri ve bunun RPA olmayan bir ortamda nasıl çözüldüğü, çözümü otomatikleştirmek için yazılım robotu oluşturma konuları anlatılacak olup eğitim sonrasında katılımcılara sertifika verilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Şeker Piyasasına Denetim
Sayın Üyemiz, Şeker piyasasında faaliyette bulunan gerçek veya tüzel kişilerin izleme, inceleme ve denetimine ilişkin usul ve esasların belirlendiğiŞeker Piyasası İzleme ve Denetim Yönetmeliği(Karar Sayısı: 4079), şeker piyasasında faaliyette bulunan her türlü gerçek ve tüzel kişiler ile bunların izleme, inceleme ve denetlenmesine yönelik çalışmaları ve bu çalışmalar sonucunda yapılacak iş ve işlemleri kapsıyor. 4634 sayılı Şeker Kanununa dayanılarak hazırlanan Yönetmeliğe göre, Şirketler, Kanun kapsamındaki her şeker cinsi ve hammaddesi için ürün özellikleri, kampanya süresi, üretim, satış ve stok faaliyetlerine ait her türlü bilgiler ile ekim alanları ve sözleşme bilgilerini doğru olarak derlemek, kayıtlarını tutmak, muhafaza etmek ve mevzuat çerçevesinde talep edilen usul ve şekilde doğru ve tam olarak Bakanlığa bildirmekle yükümlü olacaklar. Şeker miktarında %3’ün üzerindeki sapmalar, para cezası ile cezalandırılacak Fabrikalarda ölçülen miktarlar ile satışa esas kayıtlar ve stok miktarları arasındaki %3’ün üzerindeki miktarda gerekçesiyle açıklanamayan şekerin, A kotası dışı satıldığı kabul edilerek, şirkete idari para cezası uygulanacak. Şirketler tarafından bildirilmeyen depo ve tesisler ile buralarda tespit edilen ürünler hakkında bildirilmeyen veya eksik ya da yanlış bildirilen miktar için de para cezası uygulanacak. Bakanlık şirketlere, pazarladıkları ürünlerin imalatçılar ve perakendeciye ulaşana kadar olan süreci izlemeye elverişli bir takip sistemi kurdurabilecek. İki yılda bir en az bir kez denetim yapılacak Denetimler, risk esasına göre planlanarak Bakanlık tarafından yürütülecek. Şirket ve bünyesindeki fabrikalar, iki yılda en az bir defa denetlenecek. Bakanlık ihtiyaç halinde izleme ve denetlemeye ilişkin olarak adli ve mülki makamlar ile diğer kurum ve kuruluşlardan talepte bulunabilecek. Yapılan denetimlerde, ilgili mevzuat hükümlerine aykırılık tespit edilmesi halinde, fiilin niteliğine göre Kanunda öngörülen yaptırımlar uygulanacak. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Şeker Kotalarının Düzenlenmesi ve Uygulanmasına İlişkin Yönetmelik Yürürlüğe Konuldu
Sayın Üyemiz, Şeker Kotalarının Düzenlenmesi ve Uygulanmasına ilişkin yönetmelik Resmi Gazete de yayımlandı. Öte yandan 2002 yılında uygulamaya konulan, şeker kotalarının düzenlenmesine ilişkin yönetmelikte yürürlükten kaldırıldı. Ayrıntlar için tklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Makarna ve Bulgur İhracatına Kısıtlama Getirildi
Sayın Üyemiz, Şehriye, kuskus, mantı, erişte ve hazır/anında noodle da dahil olmak üzere makarna, bulgur ve buğday irmiği ihracı kayda bağlı mallar listesine eklendi. İhracı kayda bağlı ürünler listesine makarna, bulgur ve buğday irmiği dahil edildi. Söz konusu ürünlerin ihracından önce gümrük beyannamelerinin İhracatçıBirlikleri Genel Sekreterliğince kayda alınması gerekiyor. Resmi Gazete de yayımlanarak yürürlüğe girenTicaret Bakanlığının İhracı Kayda Bağlı Mallara İlişkin Tebliğde Değişiklik Yapılmasına Dair Tebliğine göre;ihracı kayda bağlı mallar listesine, makarna (söz konusu GTİP in alt açılımlarında yer alan şehriye, kuskus, mantı, erişte ve hazır/anında noodle gibi tüm ürünler dahil), bulgur ve buğday irmiği (buğdayın kabaca öğütülmesinden elde edilen küçük parçalar ve buğday kaba unları) eklendi. İlgili tebliğ içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Uzman Eller Projesi` Kapsamındaki Üreticilerin Projelerine 100 Bin Liralık Hibe Desteği
Sayın Üyemiz, Tarım ve Orman Bakanlığı, üniversitelerin tarım, hayvancılık, ormancılık, gıda ve su ürünleri bölümlerinden mezun olan "Uzman Eller Projesi" kapsamındaki üreticilerin projelerine 100 bin liraya kadar hibe desteği verecek. Kırsal Kalkınma Destekleri Kapsamında Kırsal Kalkınmada Uzman Ellerin Desteklenmesine İlişkin Cumhurbaşkanı Kararı, Resmi Gazete de yayımlanarak yürürlüğe girdi. Buna göre, 2022-2024 yıllarında kırsal alanda yaşayan/yaşamayı taahhüt eden ve meslek yüksekokulları ile üniversitelerin tarım, hayvancılık, ormancılık, gıda ve su ürünleri eğitimi veren bölümlerinden mezun olanların mahallinde uygulayacağı projeler hibe ödemesinden yararlanabilecek. Kararla, ilgili bölümlerden mezun genç nüfusun istihdamına katkı sağlamak, bu sektörlerde girişimciliği destekleyerek söz konusu faaliyetlerin uzman kişiler tarafından yapılmasını teşvik etmek, tarımsal üretimin miktarını, kalitesini ve verimliliğini artırmak ve sürdürülebilir yatırımları desteklemek amaçlanıyor. 100 bin liraya kadar hibe ödemesi Hayvansal ve bitkisel üretim, su ürünleri ve yöresel ürünler ile tıbbi aromatik bitki üretimine yönelik projeler ve bu ürünlerin işlenmesi, depolanması ve paketlenmesine yönelik projeler destekten yararlanabilecek. Uygulanacak projelere 100 bin liraya kadar hibe ödemesi yapılacak. Proje bütçesi katma değer vergisi hariç hazırlanacak. Hibe ödemesi yapılabilmesi için hibe sözleşmesi imzalanması ve proje yatırımının tamamlanması şartı aranacak. Karar kapsamında uygulanacak projelere yapılacak ödemeler için gerekli kaynak Kırsal Kalkınma Yatırımlarının Desteklenmesi Programı ndan karşılanacak ve Ziraat Bankası aracılığıyla ödenecek. Desteklemeden yararlanamayacaklar Üniversitelerin ilgili bölümlerinden mezun olmayan kişiler desteklerden yararlanamayacak. Hak sahipleri, verilen hibe desteklemesinden sadece bir kez faydalanabilecek. Aynı proje konusunda Tarım ve Orman Bakanlığının diğer hibe programlarından yararlanan kişiler de bu desteklemeden yararlanamayacak. Kara esasların uygulanmasına ilişkin usul ve esaslar Tarım ve Orman Bakanlığınca çıkarılacak tebliğle belirlenecek. Bakanlık, destek ödemeleriyle ilgili hususların denetimini sağlayacak tedbirleri almaya da yetkili olacak. İlgili Cumhurbaşkanı Kararı içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KDV desteği 2 ay daha sürecek
Sayın Üyemiz, COVID-19 destekleri kapsamında geçen yıl başlatılan ve Aralık ayında süresi 31 Mayıs’a kadar uzatılan KDV indirimi, 2 ay daha uzatıldı. Resmi Gazete’de yayınlanan Hazine ve Maliye Bakanlığı Tebliğine göre, KDV indirimleri 1 Haziran’dan itibaren geçerli olmak üzere Temmuz sonuna kadar uzatıldı. İndirimli KDV’ye tabi sektörler şunlar: Yolcu taşımacılığı, yeme-içme hizmetleri, kültürel faaliyetler, sinema tiyatro, opera, operet, bale, müze giriş ücretleri, kongre, konferans, seminer, konser, fuar ve lunapark giriş ücretleri, düğün, nikah, balo ve kokteyl salonlarında verilen organizasyon hizmetleri, berberlik ve kuaförlük hizmetleri, kuru temizleme, çamaşırhane ve ütüleme hizmetleri, halı ve kilim yıkama hizmetleri ile küçük esnafın faaliyet alanıyla ilgili bir kısım bakım onarım faaliyetleri Öte yandan, işyeri kiralama hizmetlerinde KDV oranının yüzde 8 olması ve işyeri kiralamaları karşılığında ödemeler üzerinden yapılan tevkifat oranının da yüzde 20 yerine yüzde 10 olarak uygulanmasına devam edilecek. Temmuz ayında açılacak sinemalarda, biletler üzerinden alınan yüzde 10 oranındaki eğlence vergisi de Temmuz sonuna kadar yüzde 0 olacak. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO stoklarında bulunan ve ekli listede yer alan mısır, çeltik (Ek-1) ve pirinç aşağıdabelirtilen esaslar ve ekte (Ek-2) yer alan fiyatlarla 01 Haziran 2021 tarihinden itibaren peşin bedelmukabilinde satılacaktır. TMO Elektronik Satış Platformu (ESP) vasıtasıyla veya Şube müdürlüklerimizce satılacak stoklarEk-1 listede belirtilmiştir. ESP vasıtasıyla satılacak ürünlere ilişkin talep başvuruları şube müdürlüklerine elden değilwww.tmo.gov.tr adresindeki TMO ELEKTRONİK SATIŞ PLATFORMU sistemi üzerindenyapılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye de Tarım ve Kırsal Kalkınma Destekleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden Türkiye de Tarım ve Kırsal Kalkınma Destekleri Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Türkiye de Tarım ve Kırsal Kalkınma Destekleri Eğitimi" başlıklı eğitimde; IPARD programı kapsamında, TKDK tarafından Avrupa Birliği ve Türkiye Cumhuriyeti eş finansmanı ile 42 ilde yürütülen yatırım destekleri ile Tarım ve Orman İl Müdürlükleri tarafından yürütülen ulusal fonlar ile desteklenen yatırımlar, destek miktarları ve oranları, başvuru koşulları ve uygulama esasları hakkında bilgi verilecek, eğitim sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin % 70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yapay Zeka: İş Dünyası Stratejileri ve Uygulamaları Bilgilendirme Webinarı
Sayın Üyemiz, TOBB ve TOBB ETÜ organizasyonuyla 24 Haziran 2021 Perşembe günü saat 14:00 te "Yapay Zeka: İş Dünyası Stratejileri ve Uygulamaları Bilgilendirme Webinarı" gerçekleştirilecektir. Söz konusu webinarda; yapay zekanın temelleri ve iş dünyası uygulamaları, makine öğrenmesi temelleri, yapay sinir ağları ve derin öğrenme temelleri, yapay zekaya entegrasyon yol haritası, beşeri sermayenin yapay zekaya adaptasyonu konuları anlatılacak olup seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. "Yapay Zeka: İş Dünyası Stratejileri ve Uygulamaları Bilgilendirme Webinarı" programı ve ayrıntılar ekte dikkatinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Anonim Şirketlerin Genel Kurul Toplantılarının Usul Ve Esasları İle Bu Toplantılarda Bulunacak Bakanlık Temsilcileri Hakkında Yönetmelikte Değişiklik Yapılmasına Dair Yönetmelik
Sayın Üyemiz, Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Haziran Ayı Normalleşme Tedbirleri Genelgesi
Sayın Üyemiz, İçişleri Bakanlığı nca "Haziran Ayı Normalleşme Tedbirleri Genelgesi" yayınlandı. Genelgede, Koronavirüs (Covid-19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme ve hastalığın yayılım hızını kontrol altında tutma amacıyla, salgınla mücadele sürecinin temelprensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulmasıgereken kurallar ve önlemler; salgının genel seyrinin ve Sağlık Bakanlığı ile Koronavirüs BilimKurulu nun önerilerinin değerlendirilmesi sonucunda Cumhurbaşkanlığı Kabinesinde alınan kararlardoğrultusunda belirlenmektedir. Bu çerçevede gerek 14 Nisan 2021 tarihinden bu yana sırasıyla uygulan kısmi kapanma, tamkapanma ve kademeli normalleşme tedbirleri ile birlikte sosyal izolasyonun artırılması; gerekse azizmilletimizin tedbirlere uyum noktasındaki sağduyulu ve fedakârca yaklaşımı sonucunda günlük vaka,hasta ve ağır hasta sayılarında ciddi bir düşüş yaşandığı kamuoyunun malumudur. Öte yandan hep birlikte elde edilen bu başarının sürdürülmesi, salgının yayılımının kontrol altındatutulması ve ivmelenen aşılama faaliyetleri ile birlikte kalıcı normalleşmenin sağlanması için salgınlamücadele tedbirlerine riayet etmek önümüzdeki dönemde de önemini korumaktadır. Bu doğrultuda salgının seyrinde yaşanan gelişmeler ile Sağlık Bakanlığı ve Koronavirüs BilimKurulu nun tavsiyeleri, Sayın Cumhurbaşkanımızın başkanlığında toplanan 31 Mayıs 2021 tarihliCumhurbaşkanlığı Kabinesinde ele alınarak; Haziran ayı boyunca uygulanacak olan kademelinormalleşme sürecinin ikinci etabı kapsamında aşağıdaki tedbirlerin1 Haziran 2021 Salı günü saat05.00’ten itibarenhayata geçirilmesi gerektiği değerlendirilmiştir. 1. SOKAĞA ÇIKMA KISITLAMASI Kademeli normalleşme döneminin ikinci etabında;Pazartesi, Salı, Çarşamba, Perşembe, Cuma veCumartesi günleri 22.00 - ­05.00 saatleri arasında;Pazar günleri ise Cumartesi günü saat 22.00’denbaşlayıp Pazar gününün tamamını kapsayacak ve Pazartesi günü saat 05.00’tetamamlanacak şekildesokağa çıkma kısıtlaması uygulanacaktır. 1.1- Sokağa çıkma kısıtlaması uygulanacak süre ve günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğinin sağlanması amacıylaEk’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacaktır. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler, 14.12.2020 tarih ve 20799 sayılıGenelgemizde açıkça belirtildiği şekilde muafiyet nedeni ve buna bağlı olarak zaman ve güzergâh ilesınırlı olup aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konuedilecektir. Sokağa çıkma kısıtlamasından muaf tutulan iş yeri/fabrika/imalathane gibi yerlerde çalışan kişileryapılan denetimlerde 29.04.2021 tarih ve 7705 sayılı Genelgemiz çerçevesinde e-Devlet platformunda yeralan İçişleri Bakanlığı e-Başvuru sistemi üzerinden alınan “çalışma izni görev belgesini” ibraz etmekzorundadırlar. Ancak NACE kodu eşleşme hatası, muafiyet kapsamındaki bir iş yerinde görev yapmasınarağmen alt işverenin muafiyet kapsamında olmaması nedeniyle görev belgesi alınamaması veya erişimhatası gibi durumlarda örneği bahse konu genelge ekinde yer alan ve işveren ile çalışanınbeyanı/taahhüdüyle manuel doldurularak imza altına alınan “çalışma izni görev belgesi formu” dadenetimlerde ibraz edilebilecektir. 1.2-Tam gün sokağa çıkma kısıtlaması uygulanacak Pazar günlerindebakkal, market, manav,kasap, kuruyemişçi ve tatlıcılar10.00-17.00saatleri arasında faaliyet gösterebilecek, vatandaşlarımızzorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engellivatandaşlarımız hariç) ikametlerine en yakın bakkal, market, manav, kasap, kuruyemişçi vetatlıcılara gidip gelebileceklerdir. 1.3- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde ekmek üretiminin yapıldığı fırın ve/veyaunlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri (sadece ekmek ve unlumamul satışı için)açık olacaktır. Vatandaşlarımız ekmek ve unlu mamul ihtiyaçlarının karşılanmasıile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine yürümemesafesinde olan fırına gidip gelebileceklerdir. Fırın ve unlu mamul ruhsatlı iş yerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallaraekmek servisi yapılabilecek, sokak aralarında kesinlikle satış yapılmayacaktır. 1.4- Yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamakta olup; ikamet izinliler,geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzereturistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar sokağa çıkma kısıtlamalarına tabidirler. 1.5- Kendi ihtiyaçlarını karşılayamayacak durumda olan ileri yaş gruplarındaki veya ağırhastalığı olan vatandaşlarımızın112, 155 ve 156 numaraları üzerinden bildirdikleri temel ihtiyaçları,VEFA Sosyal Destek Gruplarınca karşılanacak olup, bu konuda gerek personel görevlendirilmesigerekse ihtiyaçların bir an evvel giderilmesi bakımından gerekli tedbirler Valiler ve Kaymakamlar tarafından alınacaktır. 1.6- Aşı hakkını kullanarak iki doz aşı olmuş olan 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımızla ilgili olarak, herkes için uygulanan sokağa çıkma kısıtlamasının dışında ayrıcabir sokağa çıkma kısıtlaması uygulanmayacaktır. Aşı hakkı bulunmasına rağmen aşı olmayan 65 yaş ve üzeri vatandaşlarımız pazar günleridışındaki diğer günlerde sadece 10.00 - 14.00 saatleri arasında sokağa çıkabilecekler; pazar günleri ise tamgün sokağa çıkma kısıtlamasına tabi olacaklardır. 1.7- Sokağa çıkma kısıtlamasına tabi olup olmadığına bakılmaksızın 65 yaş ve üzeri vatandaşlarımızile 18 yaş altı gençler ve çocuklarımız şehir içi toplu ulaşım araçlarını (metro, metrobüs, otobüs,minibüs, dolmuş vb.) kullanamayacaklardır. Bu hükümden, Milli Eğitim Bakanlığı nın yüz yüze eğitim ve öğretim yapmasını uygun gördüğüöğrenciler istisna tutulacaktır. 2. ŞEHİRLER ARASI SEYAHAT KISITLAMASI Kademeli normalleşme döneminin ikinci etabında; sadece sokağa çıkma kısıtlaması uygulanansüre ve günlerde şehirler arası seyahat kısıtlaması uygulanacak olup sokağa çıkma kısıtlamasıuygulanmayan süre içerisinde şehirler arası seyahate ilişkin herhangi bir kısıtlamaya gidilmeyecektir. 2.1- Şehirler arası seyahat kısıtlamasının istisnaları; - Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın uçak, tren, otobüs gibitoplu taşıma vasıtalarıyla yapacakları şehirler arası seyahatler için ayrıca seyahat izni almasıistenmeyecek, şehirler arası seyahat edeceğini bilet, rezervasyon kodu vb. ile ibraz etmeleri yeterliolacaktır. Bu durumdaki kişilerin şehirler arası toplu taşıma vasıtaları ile ikametleri arasındaki hareketlilikleri, kalkış-varış saatleriyle uyumlu olmak kalmak kaydıyla sokağa çıkma kısıtlamasından muaf olacaktır. - Zorunlu bir kamusal görevin ifası kapsamında ilgili Bakanlık ya da kamu kurum veyakuruluşu tarafından görevlendirilmiş olan kamu görevlilerinin (müfettiş, denetmen vb.) özel veyaresmi araçlarla yapacakları şehirler arası seyahatlerine, kurum kimlik kartı ve görevlendirme belgesini ibraz etmeleri kaydıyla izin verilecektir. - Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmakiçin veya cenaze nakil işlemine refakat etmek amacıyla herhangi bir cenaze yakınının e-devletkapısındaki İçişleri Bakanlığına aite-BaşvuruveyaALO 199sistemleri üzerinden yapacaklarıbaşvurular (yanında akraba konumundaki 9 kişiye kadar bildirimde bulunabilecektir) sistem tarafındanvakit kaybetmeksizin otomatik olarak onaylanarak cenaze yakınlarına özel araçlarıyla seyahatedebilmeleri için gerekli seyahat izin belgesi oluşturulacaktır. Cenaze nakil ve defin işlemleri kapsamında başvuru yapacak vatandaşlarımızdan herhangi bir belgeibrazı istenilmeyecek olup Sağlık Bakanlığı ile sağlanan entegrasyon üzerinden gerekli sorgulama seyahatizin belgesi düzenlenmeden önce otomatik olarak yapılacaktır. 2.2- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın özel araçlarıylaşehirler arası seyahate çıkmamaları esastır. Ancak aşağıda belirtilen zorunlu hallerin varlığı durumunda vatandaşlarımız, bu durumubelgelendirmek; e-devlet üzerinden İçişleri Bakanlığına aite-Başvuruve ALO 199sistemleriüzerinden Valilik/Kaymakamlık bünyesinde oluşturulan Seyahat İzin Kurullarından izin almak kaydıylaözel araçlarıyla da seyahat edebileceklerdir. Seyahat İzin Belgesi verilen kişiler, seyahat süreleri boyuncasokağa çıkma kısıtlamasından muaf olacaktır. Zorunlu Hal Sayılacak Durumlar; Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevkolan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, Kendisi veya eşinin, hastanede tedavi gören birinci derece yakınına ya da kardeşine refakatedecek olan (en fazla 2 kişi), Bulunduğu şehre son5 güniçerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikametettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araçplakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ÖSYM tarafından ilan edilen sınavlar ile merkezi düzeyde planlanan sınavlara katılacakolanlar, Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, Özel veya kamudan günlü sözleşmeye davet yazısı olan, Ceza infaz kurumlarından salıverilen, kişilerin zorunlu hali bulunduğu kabul edilecektir. 3. İŞ YERLERİNİN FAALİYETLERİ 3.1- Yeme-içme yerleri (restoran, lokanta, kafeterya, pastane gibi); Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirtilen tüm kurallara uyulması,masalar arasında her yönden2 metre, yan yana sandalyeler arasında60 cmmesafe bırakılması, Aynı anda aynı masadaaçık alanlarında üç, kapalı alanlarında ise ikiden fazlamüşterikabul edilmemesi, kaydıyla, Pazartesi, Salı, Çarşamba, Perşembe, Cuma ve Cumartesi günlerinde 07.00-21.00saatleriarasında masada servis, gel-al ve paket servis,21.00 - 24.00saatleri arasında ise sadece paket servis, Pazar günleri ise 07.00 - 24.00saatleri arasında sadece paket servis,şeklinde faaliyet gösterebileceklerdir. 3.2- 14 Nisan 2021 tarihinden bu yana faaliyetlerine ara verilmiş durumda olan; Sinema salonları, Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi gibi yerler, İnternet kafe/salonu, elektronik oyun yerleri, bilardo salonları, Halı sahalar, spor salonları, açık yüzme havuzları, Lunaparklar ve tematik parkları, Faaliyet alanında bulunan iş yerleri; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde her bir iş kolu/faaliyet alanı için ayrıayrı belirlenen kurallara eksiksiz uyulması, Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi, çay ocağı gibi yerlerde herhangi birşekilde oyun (kağıt-okey, tavla dahil) oynanmaması, aynı anda aynı masada açık alanlarında üç, kapalı alanlarında ise ikiden fazla müşteri kabul edilmemesi, Sinema salonlarında% 50 kapasite (bir koltuk dolu bir koltuk boş)sınırına uyulması, kaydıyla 1 Haziran 2021 tarihinden itibaren (Pazar günleri hariç) 07.00 - 21.00 saatleri arasında faaliyet gösterebileceklerdir. Öte yandan kapalı yüzme havuzları, hamamlar, saunalar ve masaj salonları, nargilesalonu/kafeleri ile gazino, taverna, birahane gibi iş yerlerinin faaliyetlerine yeni bir karar alınıncayakadar ara verilmesine devam edilecektir. 3.3- Yukarıda sayılan iş yerleri dışında kalan perakende ve hizmet sektöründeki giyim, tuhafiye,züccaciye, hırdavat, terzi, berber gibi dükkanlar, büro ve ofisler vb. iş yerleri ile AVM’ler; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde içerisinde bulunduğu iş kolu içinbelirlenen tüm salgınla mücadele tedbirlerine riayet etmek kaydıyla (Pazar günleri hariç) 07.00 - 21.00saatleri arasında faaliyet gösterebileceklerdir. 3.4- Zincir marketler başta olmak üzere çeşitli iş yerleri tarafından açılış veya belirli gün ya dasaatlere özgü genel indirim uygulamalarının oluşturduğu yoğunluğun önüne geçilebilmesi için indirimuygulamalarının en az bir hafta sürecek şekilde uzun periyodlarla yapılması gerekmektedir. 3.5- Tam gün sokağa çıkma kısıtlaması uygulanacak olan Pazar günlerinde; marketlerde (zincirve süper marketler dahil) zorunlu temel ihtiyaçlar kapsamındaki ürünler dışında elektronik eşya, oyuncak,kırtasiye, giyim ve aksesuar, alkol, ev tekstili, oto aksesuar, bahçe malzemeleri, hırdavat, züccaciye vb.ürünlerin satışına izin verilmeyecektir. 3.6- Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirlenen kurallara uymakkaydıyla pazar yerleri (Pazar günleri hariç) 07.00 - 20.00 saatleri arasında faaliyet gösterebileceklerdir. 3.7- Online market ve yemek sipariş firmaları, hafta içi ve hafta sonu 07.00 - 24.00 saatleriarasında evlere/adrese servis şeklinde çalışabileceklerdir. 4. EĞİTİM - ÖĞRETİM FAALİYETLERİ Halihazırda faaliyetlerine devam etmekte olan kreşler ve anaokulları kademeli normalleşmeninikinci etabında da faaliyetlerine devam edecek olup diğer tüm okul ve sınıf seviyeleri için Milli EğitimBakanlığı nca kamuoyuna duyurulduğu şekilde uygulama sürdürülecektir. 5. KAMU KURUM VE KURULUŞLARINDA MESAİ Cumhurbaşkanlığının 14.04.2021 tarih ve 2021/8 sayılı Genelgesi ile Cumhurbaşkanlığı İdari İşlerBaşkanlığının 27.04.2021 tarih ve 17665 sayılı yazısı doğrultusunda, kamu kurum ve kuruluşlarındauygulanmakta olan10.00 - 16.00saatleri arası mesai sistemi ile uzaktan/dönüşümlü gibi esnek çalışma usulünün uygulanmasına kademeli normalleşme döneminin ikinci etabında da devam edilecektir. 6. TOPLANTI / ETKİNLİKLER İLE NİKAHLAR / DÜĞÜNLER VE ZİYARETLER 6.1- Dönemsel açıdan zorunluluk taşıyan spor kulüplerinin genel kurulları hariç olmak üzere siviltoplum kuruluşları, sendikalar, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üstkuruluşları ile birlikler ve kooperatiflerin genel kurul dahil yapacakları geniş katılımlı her türlüetkinlikleri15 Haziran 2021tarihine kadar ertelenecektir. Dönemsel açıdan yapılması zorunlu olan spor kulüplerinin genel kurulları ise; fiziki mesafe iletemizlik/maske/mesafe kurallarına uyulması ve açık alanlarda kişi başı asgari4 m², kapalı alanlarda kişi başı asgari6m²alan bırakılması kaydıyla yapılabilecektir. 15 Haziran 2021 Salı gününden itibaren ise sivil toplum kuruluşları, sendikalar, kamu kurumuniteliğindeki meslek kuruluşları, birlikler ve kooperatiflerce yapılacak genel kurul dahil geniş katılımlıetkinliklere; fiziki mesafe ile maske/mesafe/temizlik kurallarına uyulması ve açık alanlarda kişi başıasgari 4 m², kapalı alanlarda kişi başı asgari 6 m²alan bırakılması kaydıyla izin verilecektir. 6.2- Nikah törenleri ile nikah merasimi şeklindeki düğünler; - Açık alanlarda; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde nikah törenleri ve düğünlerleilgili belirlenen tüm kurallara eksiksiz riayet edilmesi, Masa ve sandalyeler arasında gerekli mesafenin bırakılması ile temizlik, maske, mesafekurallarına uyulması, Yiyecek-içecek ikramının yapılmaması, Kapalı alanlarda ise yukarıdaki kurallara ilave olarak; Kişi başı asgari 6 m²alan bırakılması, Azami 100 davetli ile sınırlandırılması, kaydıyla 1 Haziran 2021 Salı gününden itibaren yapılabilecektir. Yiyecek-içecek ikramına ve kapalı alanlarda azami davetli sayısına ilişkin kısıtlamalara 15Haziran 2021 Salı günü son verilecektir. Bu tarihten sonraki nikah törenleri ve düğünlerde yiyecek-içecek ikramı yapılabilecek olup kapalı alanlarda kişi başına en az 6 m²alan bırakılması kaydıyla azamikatılımcı sınırı uygulanmayacaktır. Nişan ve kına gibi etkinliklere 1 Temmuz 2021 tarihinden sonra izin verilecektir. 6.3- Huzurevi, yaşlı bakımevi, rehabilitasyon merkezi, çocuk evleri gibi sosyal koruma/bakımmerkezlerinde kalanlara yönelik ziyaretlere bu yerlerde kalan her kişi için haftada en fazla bir ziyaretolacak şekilde izin verilecektir. 7. TOPLU ULAŞIM TEDBİRLERİ 7.1- Şehirler arası faaliyet gösteren toplu taşıma araçları (uçak hariç); araç ruhsatında belirtilenyolcu taşıma kapasitesinin%50’sioranında yolcu kabul edebilecekler ve araç içindeki yolcularınoturma şekli yolcuların birbirleriyle temasını engelleyecek(1 dolu 1 boş) şekilde olacaktır. Otobüs, tren vb. şehirler arası toplu taşıma araçlarında kapasite sınırlamasının tespiti sırasında aynıadreste ikamet eden ve aynı çekirdek aileden (eş, anne-baba, kardeş) olan kişiler, hesaplamaya dahiledilmeyecek ve yan yana seyahat etmelerine izin verilecektir. Ayrıca 2+1 koltuk düzenindeki şehirler arası toplu taşıma yapan otobüslerde her iki camkenarındaki koltuklara yolcu kabul edilebilecek olup (ortadaki koltuklar boş bırakılacaktır), yolcu taşımakapasitesi buna göre belirlenecektir. 7.2- Şehir içi toplu ulaşım araçları (minibüs, midibüs vb.) ise 14.04.2021 tarih ve 6638 sayılıGenelgemizle getirilen esaslar çerçevesinde % 50 kapasite sınırlamasına ile ayakta yolcu kabuledilmemesi kuralına tabi olarak faaliyet sunabileceklerdir. 8. KONAKLAMA TESİSLERİNE DAİR TEDBİRLER 8.1- Şehirler arası karayolları üzerinde bulunan dinlenme tesisleri (yerleşim sahası içerisindebulunanlar hariç) ile konaklama tesislerinin (otel, motel, apart otel, pansiyon vb.) içerisinde bulunanyeme-içme yerleri (sadece konaklamalı müşterilerle sınırlı olacak şekilde); aynı masada aynı anda açıkalanlarında üç, kapalı alanlarında ise ikiden fazla müşteri kabul edilmemek kaydıyla hizmetverebileceklerdir. 8.2- Konaklama tesislerinin kapalı alanlarında bulunan eğlence merkezleri kapalı tutulacak ve bualanlarda müşteri kabul edilmeyecektir. 8.3- Konaklama tesislerinin açık alanlarında toplu eğlence şeklinde etkinliklere kesinlikle izinverilmeyecek, bu yerlerde yoğunlaşmanın önüne geçilebilmek adına fiziksel mesafe kurallarına azamiözen gösterilecektir. 8.4- Sokağa çıkma kısıtlaması uygulanacak olan süre ve günlerde konaklama tesislerinderezervasyonunun bulunması (bedelinin tamamı ödenmiş olmak kaydıyla) vatandaşlarımız açısındansokağa çıkma ve/veya şehirler arası seyahat kısıtlamasından muafiyet sağlayacak olup bu amaçlaseyahat edecek vatandaşlarımızın denetimlerde rezervasyon ve ödeme belgelerini ibraz etmeleri yeterliolacaktır. 8.5- 30.09.2020 tarih ve 16007 sayılı ile 28.11.2020 tarih ve 19986 sayılı Genelgelerimizdoğrultusunda konaklama tesislerinin denetimleri etkin şekilde sürdürülecek, sahte rezervasyon baştaolmak üzere her türlü kötüye kullanımın önüne geçilecektir. 9. GENEL ESASLAR 9.1- Valilik ve Kaymakamlıklarca; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde herbir iş kolu/faaliyet alanına ilişkin ayrı ayrı olarak belirlenmiş olan koronavirüs salgınıyla mücadele amaçlıtedbir, usul ve esasların ilgili iş yeri yetkilileri ve çalışanlarına hatırlatılmasına dair bilgilendirmefaaliyetlerine ağırlık verilecektir. 9.2- Gerek Bakanlığımız Genelgeleri gerekse Sağlık Bakanlığı Salgın Yönetimi ve ÇalışmaRehberinde belirlenen tedbir, usul ve esaslar çerçevesinde, Vali ve Kaymakamlarımızın koordinesindekolluk kuvvetlerinin azami düzeyde kapasite ile katılım gösterdiği (diğer kurum ve kuruluşlarınpersoneli/görevlileri ile takviye edilmiş şekilde) yoğunlaştırılmış denetimler gerçekleştirilecektir. 9.3- Yürütülecek her türlü denetim faaliyetinde iş yeri sahipleri/çalışanları ile vatandaşlarımızıkurallara uymaya/sorumlu davranmaya nezaketle davet eden rehberlik edici bir yaklaşım sergilenecekolup, kurallara aykırılıklarda ısrar, tekerrür, kuralların esaslı ihlali gibi suistimal edici tutum vedavranışlarla karşılaşılması halinde ise gerekli idari/adli işlem tesisinden imtina edilmeyecektir.
Mezbuh Taze Soğutulmuş Karkas Alımı Piyasa Araştırması
Sayın Üyemiz, Et ve Süt Kurumu tarafından piyasa şartların ve fiyatlarının değerlendirilmesi amacıyla, onaylıkesimhanelerde kesilmiş, 0-4 C soğutulmuş, yağsız kesim 1. Kalite Dana Karkas o ( 1-4 yaş (dahil)arasındaki erkek sığırlardan elde edilen karkas) ve 3. Kalite Dişi Karkas (reforme olan ve/veya gebeolmayan dişi sığırlar ile 3 yaşını aşmış, reforme olan ve/veya gebe olmayan düvelerden elde edilenkarkas) alımına esas teşkil edecek şekilde piyasa araştırması yapılmaktadır. Ekteki tabloda esvafı belirtilmiş olan dişi ve dana karkaslar için alıcı rampa teslim piyasafiyatlarınızı mgultekin.gulhan@esk.gov.tr mail adresine veya 0 (312) 270 42 14 numarasına fax olarakEk te sunulan birim fiyat cetveline bedel, rakam, yazı biribirine uygun olacak şekilde açıkca yazılarak, üzerinde kazıntı, silinti ve düzeltme yapılmadan, kaşe ve imzalı bir şekilde 31.05.2021 Pazartesi günüsaat 17.00 a kadar gönderilmesi hususunda; Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2021 Nefes Kredisi
Sayın Üyemiz, T.C. Hazine ve Maliye Bakanlığınca yapılan basın açıklaması bilgilerinize sunulur. Koronavirüs salgınının ekonomik etkilerinin sınırlanmasına katkı sunmak ve KOBİ’lere uygun koşullarda finansman desteği sağlamak amacıyla “2021 Nefes Kredisi”, 10 bankanın katılımı ile TOBB ve KGF işbirliğinde 1 Haziran 2021 itibarı ile uygulamaya alınacaktır. Nefes Kredi Paketi ile yıllık cirosu 10 milyon TL altında olan ve 2020 yılı cirosunda 2019 yılına göre yüzde 25 kayıp yaşayan; Ticaret, Deniz Ticaret, Sanayi, Ticaret ve Sanayi veya Ticaret Borsası’na kayıtlı üyelere işletme sermayesi finansman imkânı sağlanacaktır. 2020 yılı cirosu 1 milyon TL’yi aşmayan KOBİ’ler azami 50 bin TL, cirosu 1-10 milyon TL arasında olan KOBİ’ler ise azami 200 bin TL kredi kullanabilecektir. TOBB ve Oda / Borsalar da kaynaklarını bu bankalarda değerlendirerek projeye katkı sunacaktır. 6 ay ödemesiz dönem imkânı sağlanıyor İşletmelere 6 ay ödemesiz dönem imkânı sağlanacak olan 2021 Nefes Kredisi uygulamasında, kredi geri ödemeleri 12 eşit taksitte yapılacaktır. Söz konusu uygulamada Hazine destekli KGF kefaleti sağlanacak olup, faiz oranı yıllık yüzde 17,5 olarak belirlenmiştir. Kamuoyuna saygıyla duyurulur. Katılımcı Bankalar T.C. ZİRAAT BANKASI A.Ş. TÜRKİYE VAKIFLAR BANKASI T.A.O. TÜRKİYE HALK BANKASI A.Ş. TÜRKİYE İŞ BANKASI A.Ş. T.GARANTİ BANKASI A.Ş. YAPI VE KREDİ BANKASI A.Ş. AKBANK T.A.Ş. DENİZBANK A.Ş. ZİRAAT KATILIM BANKASI A.Ş. VAKIF KATILIM BANKASI A.Ş.
Ticaret Müşavirlerimizle Elektronik Sohbetler-Rusya Federasyonu
Sayın Üyemiz, 27 Mayıs Perşembe günü 15:00-17:00 saatleri arasında Rusya Federasyonu nda görev yapmakta olan Ticaret Müşavirlerimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu etkinliğin programı ve kayıt linki ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Kamu İhale Kurumu, TOBB ve TOBB ETÜ iş birliğinde27-28 Mayıs 2021tarihlerinde"Kamu İhale Sözleşmelerinde Güncel Sorunlar, Çözüm Önerileri ve Elektronik Dönüşüm"konulu sempozyumu internet üzerinden düzenlenecektir. Sempozyum davetine ilişkin afiş ekte yer almaktadır. Sempozyumda ekli program kapsamındaKamu İhale Sözleşmelerinde Borçlar Hukuku, Şirketler Hukuku ve İdare Hukukuna İlişkin Sorunlar ve Çözüm Önerileri ile Kamu İhalelerinde Elektronik Dönüşümkonuları anlatılacaktır. Saygılarımızla Gültekin GÜLER Genel Sekreter
Avrupa Mükemmeliyet Destinasyonu Yarışması
Sayın Üyemiz, Avrupa Birliği İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programının (COSME) ulusal koordinasyonundan sorumlu kurum olarak yetkilendirilmiş olan KOSGEB tarafından; COSME Programının bileşenlerinden biri olan "Çerçeve Koşulların İyileştirilmesi" bileşeni altında turizme yönelik faaliyetlere yönelik olarak Avrupa Mükemmeliyet Destinasyonu Yarışması düzenlenmektedir. Bu kapsamda, Avrupa Komisyonu tarafından düzenlenen, Avrupa Mükemmeliyet Destinasyonu Yarışmasına, nüfusu 25.000-100.000 arasında bulunan destinasyonlar için, destinasyonu yasal olarak temsil etme yetkisine sahip temsilciler tarafından başvuru yapılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Endonezya Yatırım Forumu
Sayın Üyemiz, Endonezya Yatırım Forumu nun çevrimiçi olarak düzenleneceği belirtilmekte olup, anılan Forum kapsamında birinci gün Endonezya ekonomi ve yatırım ortamı hakkında konuşmacılar tarafından bilgilendirme yapılacağı, ikinci gün ise yatırım projeleri üzerine ikili görüşmelerinin gerçekleştirileceği belirtilmektedir. Bu kapsamda, söz konusu etkinlik hakkında detaylı bilgilere https://investinindonesia.uk/iif-2021/ internet sayfasından ulaşılabilmekte olup, konu ile ilgili Endonezya Ankara Büyükelçiliği ile (Mr. Faisal Rachman, Birinci Sekreter, E-posta: faisal.rachman@kemlu.go.id) temas kurulması ayrıca mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler- Venezuela
Sayın Üyemiz, 25 Mayıs 2021 Salı günü 16.00-17.30 saatleri arasında Venezuela da görev yapmakta olan Ticaret Müşavirimiz ve bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşılacağı e-sohbet toplantısının gerçekleştirileceği bildirilmiştir. Toplantı programı ve linki ekte sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yeşil Lojistik ve Yeşil Tedarik Zinciri Semineri
Sayın Üyemiz, Yeşil lojistik ve yeşil tedarik zinciri hakkında işletmeleri bilgilendirmek amacıyla 25 Mayıs 2021 Salı günü saat 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; AB Yeşil Mutabakatı kapsamında gelişmelerin ticarete etkileri, yeşil tedarik zinciri yönetimi, yeşil satınalma ve yeşil lojistik uygulamalarının faydaları ile etik perspektifinden yeşil tedarik kavramı anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Devlet Destek ve Teşvikleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden Devlet Destek ve Teşvikleri Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Devlet Destek ve Teşvikleri Eğitimi" başlıklı eğitime; Devletin verdiği destek ve teşviklerden istifade ederek pazarda var olmak, büyümek, işini geliştirmek isteyen vizyon sahibi girişimciler, yatırımcılar, sanayiciler, hizmet işletmesi sahip ve yöneticileri ile potansiyel yararlanıcılar katılabilecek olup, eğitimde tüm devlet kurumlarınca sağlanan destek ve teşvikler topluca sunularak bunlardan yararlanma yolları anlatılacaktır. Eğitim sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin % 70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sri Lanka Yatırım Forumu
Sayın Üyemiz, Sri Lanka nın Ankara Büyükelçiliğinden alınan yazıda, Sri Lanka Ticaret Odası nın (CCC), Sri Lanka Yatırım Kurulu (BOI) ve Colombo Borsası (CSE) işbirliğinde 7-9 Haziran 2021 tarihleri arasında sanal "Sri Lanka Yatırım Forumu" organizasyonu için çalışmalarının devam ettiği belirtilmektedir. Sri Lanka Yatırım Forumu nun temasının "Sri Lanka- Asya nın bir sonraki büyüme cenneti" olacağı ve üç günlük etkinlikte üst düzey hükümet liderleri, kamu ve özel şirketlerin üst düzey liderleri, küresel uzmanlar, yatırım bankacıları ve danışmanlık firmaları tarafından gerçekleştirilecek oturumların ve sunumların yer alacağı ifade edilmektedir. Etkinlik kaydı ve katılım ücretsizdir. Sri Lanka Sanal Yatırım Forumu nun, iş ortakları da dahil olmak üzere potansiyel yatırımları Sri Lanka ya çekmek üzere yatırım kararları için gerekli ve kapsamlı bilgileri sağlamanın yanı sıra Sri Lanka ile yabancı iş adamları arasında iş bağlantıları kurmaya odaklanacağı belirtilmektedir. Söz konusu etkinliğe ücretsiz kayıt ve diğer detayları linkinden https://invest-srilanka.lk ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kuveyt te Atık Lastik Dönüşümü Alanındaki Yatırım Fırsatı Hk.
Sayın Üyemiz, Kuveyt Ticaret Müşavirliğimizden alınan bir yazıya atfen, ülkedeki atık lastik sayısının fazla olduğu ve bu durumunun lastik geri dönüşüm sektöründe faaliyet gösteren ve yurt dışında tesis kurmak isteyen firmalarımız tarafından fırsat olarak değerlendirilebileceği ifade edilmektedir. Ticaret Müşavirliğimizce konuya ilişkin hazırlanan bilgi notu ekte gönderilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Staj Seferbirliği Programı
Sayın Üyemiz, Cumhurbaşkanlığı İnsan Kaynakları Ofisi Başkanlığı koordinasyonunda, kamu kurumları ve özel sektörden gönüllü işverenlerin iş birliğiyle, üniversite öğrencilerine yönelik hazırlanan 2021 Staj Seferbirliği Programı değerleme süreci tamamlanmıştır. Program kapsamında oluşturulan 136 bin öğrencinin yer aldığı yurt içi stajyer havuzu, 27.04.2021 tarihinde saat 13.00 itibari ile işverenlerin erişimine https://kariyerkapisi.cbiko.gov.tr/ adresi üzerinden açılmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kanada Montreal Limanında Grevin Sona Ermesi
Sayın Üyemiz, Ticaret Bakanlığı nın Birliğimize ilettiği ilgi (b) de kayıtlı yazısı ile, Ottava Ticaret Müşavirliğinden alınan bir yazıya atfen, Montreal Liman İdaresi tarafından 1 Mayıs 2021 tarihinde yapılan açıklamaya göre; Bill C29 adlı Kanunun Kanada Parlamentosu Avam Kamarasından (House of Commons) geçerek 30 Nisan 2021 tarihinde onaylanmasının akabinde Montreal Limanının 2 Mayıs 2021 Pazar günü faaliyetlerine başladığı belirtilmiş olup Montreal Limanı üzerinden Kanada ile ticaret yapan firmalarımızın Limandaki iş ve işlemlerine yönelik planlamalarında bahse konu gelişmeleri dikkate almasında fayda olduğunun düşünüldüğü ifade edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, TMO hububat ve bakliyat alım fiyat ve politikaları belirlenmiş olup Sayın Cumhurbaşkanımız tarafından17.05.2021tarihinde alım fiyatları açıklanmıştır. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Sanayi ve Teknoloji Bakanlığı tarafından iletilen yazı ile 21-26 Eylül 2021 tarihleri arasında gerçekleştirilecek Teknofest ile ilgili bilgi verilmektedir. Ayrıntılar Ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
She Trades Global Etkinliği
Sayın Üyemiz, Kadın girişimci, ihracatçı, yatırımcı ve diğer paydaşları bir araya getiren "She Trades Global" etkinliğinin 17-19 Ekim 2021 tarihlerinde Dubai de düzenleneceği ve etkinliğe sanal ortamda da katılım sağlanmasının mümkün olduğu belirtilmektedir. Söz konusu etkinliğe ilişkin broşürün bir örneği ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kademeli Normalleşme Tedbirleri Genelgesi
Sayın Üyemiz, İçişleri Bakanlığı nca "Kademeli Normalleşme Tedbirleri Genelgesi" yayınlandı. Genelgede, Koronavirüs (Covid-19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme ve hastalığın yayılım hızını kontrol altında tutma amacıyla, salgınla mücadele sürecinin temel prensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemler; salgının genel seyrinin ve Sağlık Bakanlığı ile Koronavirüs Bilim Kurulunun önerilerinin değerlendirilmesi sonucunda alınan kararlar doğrultusunda belirlenmektedir. Bu kapsamda salgının seyrinde yaşanan artışa bağlı olarak 14 Nisan 2021 tarihinden itibaren kısmi kapanma, 29 Nisan 2021 tarihinden itibaren tam kapanma tedbirleri hayata geçirilmiştir. Gerek kısmı kapanma ve tam kapanma döneminde alınan tedbirlerle sosyal izolasyonun artırılması gerekse aziz milletimizin tedbirlere uyum noktasındaki sağduyulu ve fedakarca yaklaşımı sonucunda günlük vaka, hasta ve ağır hasta sayılarında ciddi bir düşüş yaşandığı kamuoyunun malumudur. Öte yandan hep birlikte elde edilen bu başarının sürdürülmesi, salgının yayılımının kontrol altında tutulması ve yeniden ivmelenen aşılama faaliyetleri ile birlikte kalıcı normalleşmenin sağlanması için salgınla mücadele tedbirlerine riayet etmek önümüzdeki kademeli normalleşme sürecinde de son derece önem taşımaktadır. Bu doğrultuda Sağlık Bakanlığı Koronavirüs Bilim Kurulunun tavsiyeleri ve salgının seyrinde yaşanan gelişmeler göz önüne alındığında 17 Mayıs 2021 Pazartesi günü saat 05.00’ten 1 Haziran 2021 Salı günü saat 05.00’e kadar uygulanacak olan kademeli normalleşme döneminde aşağıdaki tedbirlerin hayata geçirilmesi gerektiği değerlendirilmiştir. 1. Sokağa Çıkma Kısıtlaması Kademeli normalleşme döneminde;hafta içerisinde yer alan günlerde (Pazartesi, Salı, Çarşamba, Perşembe ve Cuma) 21.00­-5.00 saatleri arasında, hafta sonları ise Cuma günleri saat 21.00’den başlayıp, Cumartesi ve Pazar günlerinin tamamını kapsayacak ve Pazartesi günleri saat 05.00’de tamamlanacakşekilde sokağa çıkma kısıtlaması uygulanacaktır. 1.1- Sokağa çıkma kısıtlaması uygulanacak süre ve günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamak amacıyla Ek’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacaktır. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler, 14.12.2020 tarih ve 20799 sayılı Genelgemizde açıkça belirtildiği şekilde muafiyet nedeni ve buna bağlı olarak zaman ve güzergâh ile sınırlı olup, aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konu edilecektir. Sokağa çıkma kısıtlamasından muaf tutulan işyeri/fabrika/imalathane gibi yerlerde çalışan kişiler yapılan denetimlerde 29.04.2021 tarih ve 7705 sayılı yazımız çerçevesinde e-Devlet platformunda yer alan İçişleri Bakanlığı e-Başvuru sistemi üzerinden alınançalışma izni görev belgesiniibraz etmek zorundadırlar. Ancak Nace kodu eşleşme hatası, muafiyet kapsamındaki bir iş yerinde görev yapmasına rağmen alt işverenin muafiyet kapsamında olmaması nedeniyle görev belgesi alınamaması veya erişim hatası gibi durumlarda örneği bahse konu yazı ekinde yer alan ve işveren ile çalışanın beyanı/taahhüdüyle manuel doldurularak imza altına alınançalışma izni görev belgesi formuda denetimlerde ibraz edilebilecektir. 1.2- Tam gün sokağa çıkma kısıtlaması uygulanacakCumartesi-Pazar günlerinde bakkal, market, manav, kasap, kuruyemişçi ve tatlıcılar 10.00-17.00 saatleri arasında faaliyet gösterebilecek, vatandaşlarımız zorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın bakkal, market, manav, kasap, kuruyemişçi ve tatlıcılara gidip gelebilecektir. 1.3- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri (sadece ekmek ve unlu mamul satışı için) açık olacaktır. Vatandaşlarımız ekmek ve unlu mamul ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine yürüme mesafesinde olan fırına gidip gelebileceklerdir. Fırın ve unlu mamul ruhsatlı iş yerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallara ekmek servisi yapılabilecek, sokak aralarında kesinlikle satış yapılmayacaktır. 1.4- Yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamakta olup; ikamet izinliler, geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzere turistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar sokağa çıkma kısıtlamalarına tabidirler. 1.5- Tam kapanma sürecinde kendi ihtiyaçlarını karşılayamayacak durumdaki ileri yaş gruplarındaki veya ağır hastalığı olan vatandaşlarımızın 112, 155 ve 156 numaraları üzerinden bildirdikleri temel ihtiyaçları VEFA Sosyal Destek Gruplarınca karşılanacak olup, bu konuda gerek personel görevlendirilmesi gerekse ihtiyaçların bir an evvel giderilmesi bakımından gerekli tedbirler Valiler ve Kaymakamlar tarafından alınacaktır. 1.6- Aşı hakkını kullanarak iki doz aşı olmuş olan 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımız için herkes için uygulanan sokağa çıkma kısıtlamasının dışında ayrıca bir sokağa çıkma kısıtlaması uygulanmayacaktır. Aşı hakkı bulunmasına rağmen aşı olmayan 65 yaş ve üzeri vatandaşlarımız ise hafta içi günlerde sadece 10.00-14.00 saatleri arasında sokağa çıkabilecekler olup, hafta sonları tam gün sokağa çıkma kısıtlamasına tabi olacaklardır. Sokağa çıkma kısıtlamasına tabi olup olmadığına bakılmaksızın 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımız kademeli normalleşme döneminde şehir içi toplu ulaşım araçlarını (metro, metrobüs, otobüs, minibüs, dolmuş vb.) kullanamayacaklardır. 2. Şehirler Arası Seyehat Kısıtlaması Kademeli normalleşme döneminde; sokağa çıkma kısıtlaması uygulanan süre ve günlerde (hafta içi ve hafta sonunda) şehirler arası seyahat kısıtlaması uygulanacaktır. 2.1- Şehirler arası seyahat kısıtlamasının istisnaları; - Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın uçak, tren, otobüs gibi toplu taşıma vasıtalarıyla yapacakları şehirlerarası seyahatler için ayrıca seyahat izni alması istenmeyecek, şehirlerarası seyahat edeceğini bilet, rezervasyon kodu vb. ile ibraz etmesi yeterli olacaktır. Bu durumdaki kişilerin şehirler arası toplu taşıma vasıtaları ile ikametleri arasındaki hareketlilikleri, kalkış-varış saatleriyle uyumlu olmak kalmak kaydıyla sokağa çıkma kısıtlamasından muaf olacaktır. - Zorunlu bir kamusal görevin ifası kapsamında ilgili Bakanlık ya da kamu kurum veya kuruluşu tarafından görevlendirilmiş olan kamu görevlilerinin (müfettiş, denetmen vb.) özel veya resmi araçlarla yapacakları şehirler arası seyahatlerine, kurum kimlik kartı ve görevlendirme belgesini ibraz etmek kaydıyla izin verilecektir. - Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmak için veya cenaze nakil işlemine refakat etmek amacıyla herhangi bir cenaze yakınının e-Devlet kapısındaki İçişleri Bakanlığına ait e-Başvuru veya ALO 199 sistemleri üzerinden yapacakları başvurular (yanında akraba konumundaki 9 kişiye kadar bildirimde bulunabilecektir) sistem tarafından vakit kaybetmeksizin otomatik olarak onaylanarak cenaze yakınlarına özel araçlarıyla seyahat edebilmeleri için gerekli seyahat izin belgesi oluşturulacaktır. Cenaze nakil ve defin işlemleri kapsamında başvuru yapacak vatandaşlarımızdan herhangi bir belge ibrazı istenilmeyecek olup Sağlık Bakanlığı ile sağlanan entegrasyon üzerinden gerekli sorgulama seyahat izin belgesi düzenlenmeden önce otomatik olarak yapılacaktır. 2.2- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın özel araçlarıyla şehirler arası seyahate çıkmamaları esastır.Ancak aşağıda belirtilen zorunlu hallerin varlığı durumunda vatandaşlarımız, bu durumu belgelendirmek kaydıyla; e-Devlet üzerinden İçişleri Bakanlığına ait e-Başvuru ve ALO 199 sistemleri üzerinden Valilik/Kaymakamlık bünyesinde oluşturulan Seyahat İzin Kurullarından izin almak kaydıyla özel araçlarıyla da seyahat edebileceklerdir. Seyahat İzin Belgesi verilen kişiler, seyahat süreleri boyunca sokağa çıkma kısıtlamasından muaf olacaktır. Zorunlu Hal Sayılacak Durumlar; ▪ Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevk olan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, ▪ Kendisi veya eşinin, hastanede tedavi gören birinci derece yakınına ya da kardeşine refakat edecek olan (en fazla 2 kişi), ▪ Bulunduğu şehre son 5 gün içerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikamet ettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araç plakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ▪ ÖSYM tarafından ilan edilmiş merkezi sınavlara katılacak olan, ▪ Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, ▪ Özel veya kamudan günlü sözleşmeye davet yazısı olan, ▪ Ceza infaz kurumlarından salıverilen, Kişilerin zorunlu hali bulunduğu kabul edilecektir. 3. İş Yerlerinin Faaliyetleri 3.1- Yeme-içme yerleri (restoran, lokanta, kafeterya, pastane gibi); - Hafta içi günlerde 07.00-20.00 saatleri arasında gel-al ve paket servis, 20.00-24.00 saatleri arasında ise sadece paket servis, - Hafta sonlarında ise 07.00-24.00 saatleri arasında sadece paket servis,şeklinde faaliyet gösterebileceklerdir. 3.2-.17 Mayıs-1 Haziran arası uygulanacak olan kademeli normalleşme döneminde aşağıda sayılan iş yerlerinin faaliyetlerine geçici olarak ara verilmesine devam edilecektir. - Gazino, taverna, birahane, nargile salonu/kafeleri, - Sinema salonları, - Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi gibi yerler, - İnternet kafe/salonu, elektronik oyun yerleri, bilardo salonları, - Halı saha, yüzme havuzu, spor salonları, - Hamam, sauna ve masaj salonları, - Lunaparklar ve tematik parklar. Çay ocakları ise masa, sandalye/taburelerini kaldırmak ve sadece esnafa servis yapmak kaydıyla faaliyetlerine devam edebileceklerdir. 3.3- Yukarıda sayılan iş yerleri dışında kalan ve tam kapanma döneminde faaliyetlerine ara verilen perakende ve hizmet sektöründeki giyim, tuhafiye, züccaciye, hırdavat gibi dükkanlar ile büro ve ofisler vb. iş yerleri; - Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde içerisinde bulunduğu işkolu için belirlenen tüm salgınla mücadele tedbirlerine riayet etmek kaydıyla hafta içi günlerde 07.00-20.00 saatleri arasında faaliyet gösterebileceklerdir. - Alışveriş merkezlerinin (AVM) ise; hafta içi 10.00-20.00 saatleri arasında faaliyet gösterebilecek olup, hafta sonları kapalı olacaktır. 3.4- Zincir marketler başta olmak üzere çeşitli iş yerleri tarafından açılış veya belirli gün ya da saatlere özgü genel indirim uygulamalarının oluşturduğu yoğunluğun önüne geçilebilmesi için indirim uygulamalarının en az bir hafta sürecek şekilde uzun periyodlarla yapılması gerekmektedir. 3.5- Marketlerde (zincir ve süper marketler dahil) zorunlu temel ihtiyaçlar kapsamındaki ürünler dışında elektronik eşya, oyuncak, kırtasiye, giyim ve aksesuar, alkol, ev tekstili, oto aksesuar, bahçe malzemeleri, hırdavat, züccaciye vb. ürünlerin satışına tam gün sokağa çıkma kısıtlaması uygulanacak olan hafta sonlarında izin verilmeyecektir. 3.6- Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirlenen kurallara uymak kaydıyla pazaryerleri hafta içi günlerde 07.00-19.00 saatleri arasında faaliyet gösterebilecek olup, hafta sonları ise pazar yerlerinin kurulmasına izin verilmeyecektir. 3.7- Online market ve yemek sipariş firmaları, hafta içi ve hafta sonu 07.00-24.00 saatleri arasında evlere/adrese servis şeklinde çalışabileceklerdir. 4. Eğitim-Öğretim Faaliyetleri Halihazırda faaliyetlerine devam etmekte olan kreşlerle birlikte Milli Eğitim Bakanlığıyla yapılan değerlendirmeler çerçevesinde kademeli normalleşme döneminde anaokulları da faaliyetlerine devam edecek olup diğer tüm okul ve sınıf seviyeleri için Milli Eğitim Bakanlığınca kamuoyuna duyurulduğu şekilde uygulama sürdürülecektir. 5. Kamu Kurum ve Kuruluşlarında Mesai Cumhurbaşkanlığının 14.04.2021 tarih ve 2021/8 sayılı Genelgesi ile Cumhurbaşkanlığı İdari İşler Başkanlığının 27.04.2021 tarih ve 17665 sayılı yazısı doğrultusunda, kamu kurum ve kuruluşlarında uygulanmakta olan 10.00-16.00 saatleri arası mesai sistemi ile uzaktan/dönüşümlü gibi esnek çalışma usulünün uygulanmasına kademeli normalleşme döneminde de devam edilecektir. 6. Ertelenen FaaliyetEtkinlik ve Törenler 6.1- Sivil toplum kuruluşları, sendikalar, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üst kuruluşları ile birlikler ve kooperatiflerin genel kurul dahil yapacakları geniş katılımlı her türlü etkinlikleri 1 Haziran 2021 tarihine kadar ertelenecektir. 6.2- Evlendirme işlemlerinin gerçekleştirilmesine devam edilmekle birlikte halen uygulanmakta olan nikah ve nikah merasimi şeklindeki düğünler ile nişan ve kına gibi etkinliklerin yapılmaması uygulaması, 1 Haziran 2021 tarihine kadar devam edecektir. 6.3- Huzurevi, yaşlı bakımevi, rehabilitasyon merkezi, çocuk evleri gibi sosyal koruma/bakım merkezlerinde halihazırda uygulanmakta olan ziyaretçi kısıtlaması 1 Haziran 2021 tarihine kadar uzatılacaktır. 7. Toplu Ulaşım Tedbirleri 7.1- Şehirler arası faaliyet gösteren toplu taşıma araçları (uçak hariç); araç ruhsatında belirtilen yolcu taşıma kapasitesinin %50’si oranında yolcu kabul edebilecekler ve araç içindeki yolcuların oturma şekli yolcuların birbirleriyle temasını engelleyecek (1 dolu 1 boş) şekilde olacaktır. 7.2- Şehir içi toplu ulaşım araçları (minibüs, midibüs vb.) ise 14.04.2021 tarih ve 6638 sayılı Genelgemizle getirilen esaslar çerçevesinde % 50 kapasite sınırlamasına ile ayakta yolcu kabul edilmemesi kuralına tabi olarak faaliyet sunabileceklerdir. 8. Konaklama Tesislerine Dair Tedbirler 8.1- Şehirler arası karayolları üzerinde bulunan dinlenme tesisleri (yerleşim sahası içerisinde bulunanlar hariç) ile konaklama tesislerinin (otel, motel, apart otel, pansiyon vb.) içerisinde bulunan yeme-içme yerleri (sadece konaklamalı müşterilerle sınırlı olacak şekilde) aynı masada aynı anda en fazla 2 kişiye servis açılması kaydıyla hizmet verebileceklerdir. 8.2- Konaklama tesislerinin kapalı alanlarında bulunan eğlence merkezleri kapalı tutulacak ve bu alanlarda müşteri kabul edilmeyecektir. 8.3- Konaklama tesislerinin açık alanlarında toplu eğlence şeklinde etkinliklere kesinlikle izin verilmeyecek, bu yerlerde yoğunlaşmanın önüne geçilebilmek adına fiziksel mesafe kurallarına azami özen gösterilecektir. 8.4- Sokağa çıkma kısıtlaması uygulanacak olan süre ve günlerde konaklama tesislerinde rezervasyonunun bulunması (bedelinin tamamı ödenmiş olmak kaydıyla) vatandaşlarımız açısından sokağa çıkma ve/veya şehirler arası seyahat kısıtlamasından muafiyet sağlayacak olup bu amaçla seyahat edecek vatandaşlarımızın denetimlerde rezervasyon ve ödeme belgelerini ibraz etmeleri yeterli olacaktır. 8.5- 30.09.2020 tarih ve 16007 sayılı ile 28.11.2020 tarih ve 19986 sayılı Genelgelerimiz doğrultusunda konaklama tesislerinin denetimleri etkin şekilde sürdürülecek, sahte rezervasyon başta olmak üzere her türlü kötüye kullanımın önüne geçilecektir. Yukarıda belirtilen esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27 nci ve 72 nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararlarının ivedilikle alınması, uygulamada herhangi bir aksaklığa meydan verilmemesi ve mağduriyete neden olunmaması hususunda;
Karayolu Taşıma Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik
Sayın Üyemiz, Bu Yönetmelik ile Bakanlığın, salgın, olağanüstü hal, gerginlik, buhran, kriz dönemleri ile afet ve acil durumlarında; bu Yönetmelik kapsamında öngörülen uyarma, geçici durdurma ve iptal gibi müeyyideler ile taşıt yaşları, sözleşmeli taşıt oranları, yetki belgesi almanın diğer özel/genel şartları veya belirlenmiş sürelerin, azaltılmasına, arttırılmasına veya durdurulmasına ilişkin geçici düzenlemeler yapabileceği, yetki belgeleri ile ilgili bazı konular ve sair değişiklikler düzenlenmektedir. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TARSİM Ayçiçeği Sigortası
Sayın Üyemiz, Tarım Sigortaları Havuzu’ndan (TARSİM) yapılan açıklamada, üreticilereyüzde 50Devlet prim desteğinden faydalanmaları ve ‘ayçiçeği’ ürününü zamanında sigortalatmaları konusunda uyarıda bulunuldu. Üreticilerin ‘ayçiçeği’ ürünü için son günü beklemeden, bir an önce sigorta yaptırmalarının vurgulandığı açıklamada, öncelikle Çiftçi Kayıt Sistemi’ne (ÇKS) kayıt olunması ya da kaydın güncellenmesi gerektiği, sonrasında ise yetkili sigorta şirketlerinin acenteleri aracılığıyla tarım sigortası poliçesinin düzenlenebileceği bildirildi. Açıklamada şu ifadeler yer aldı: “1 dekarlıkalanda sigorta bedeli891 TLolan yağlık ayçiçeği ürününün sigortalanması halinde ‘dolu paketi’ için ödenecek tutar sadece8 TL. Sigorta bedeli1.625 TLolan çerezlik ayçiçeği ürününün sigortalanmasıhalinde ise ödenecek tutar15 TL. Dijital Tarım Pazarı (DİTAP) sistemine kayıtlı üreticilere toplam poliçe primi üzerindenyüzde 5; aynı zamanda DİTAP üzerinden sözleşme yapmış olmaları durumunda ilaveyüzde 5olmak üzere toplamdayüzde 10‘DİTAP indirimi’, hasarsız geçen yıllara bağlı olarakyüzde 30’a varan oranda ‘hasarsızlık indirimi’, sigorta yaptıran üreticinin yaşının 30 ve altında olması halinde, dolu paket primi üzerindenyüzde 5nispetinde ‘genç çiftçi indirimi’, sigorta yaptıran üreticinin kadın olması halinde dolu paket primi üzerindenyüzde 5nispetinde ‘kadın çiftçi indirimi’ uygulanıyor. Prim tutarının tamamının peşin ödenmesi durumunda toplam poliçe primi üzerindenyüzde 5oranında ‘peşin ödeme indirimi’ ile üreticinin aldığı risk önleyici ve azaltıcı önlem türüne göre çeşitli oranlarda indirimler de mevcut. Ayçiçeği ürününde teminat, dolu, fırtına, hortum, yangın, deprem, heyelan, sel ve su baskını ile yaban domuzu riskleri için bitkinin yeşermesinden ve filizlenmesinden itibaren başlıyor. Kuş zararında ise, dane olum ile hasat dönemi arasında teminat veriliyor. Ayçiçeği, dolu, fırtına, hortum, yangın, heyelan, deprem ile sel ve su baskını, yaban domuzu ve bu yıl itibarıyla teminat kapsamına alınan kuş zararı risklerinin neden olduğu miktar kaybına karşı sigortalanabiliyor. Bu üründe poliçe kabul tarihi lokasyonlara göre değişmekte olup, 1. ürün için10 Haziran, 2. ürün için ise8 Ağustostarihinde sona eriyor. Üreticiler, yetkili acentelerden ve tarsim.gov.tr’den detaylı bilgi edinebilir.” Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
HUBUDER Konferansı
Sayın Üyemiz, HUBUDER tarafından her yıl geleneksel olarak düzenlenen uluslararası hasat öncesi değerlendirme toplantımızı 2020 yılında Pandemi nedeniyle düzenleyemedik. Pandemi sürecinin 2021 yılında da devam etmesi nedeniyle“2021 YILI HASADINA DOĞRU TÜRKİYE VE DÜNYA’DA TAHIL”konulu konferansımızın26 Mayıs 2021, Çarşamba günüONLINE (ZOOM)ortamında düzenleme kararı alınmıştır. Bu kapsamda sanal konferansta, yurtdışı ve yurtdışından katılacak olan konunun uzmanı kişiler Dünya özellikle Rusya, Ukrayna, AB, ABD ve Türkiye’de tahıl üretimi, arz talep durumu ve son piyasa gelişmeleri gibi konularda siz katılımcılara güncel sunum yapacaklar ve; 2021 yılı TMO politikaları Türkiye tahıl piyasasını nasıl etkileyecek? Türkiye’de tahıl üretimi bölgelere göre nasıl gerçekleşecek? Lisanslı depoculuk sistemi piyasaları nasıl etkileyecek? Rusya, Ukrayna, AB ve ABD’de üretim nasıl gerçekleşecek? Rusya ve Ukrayna ihracat politikaları ne olacak? Türkiye ekonomisindeki beklentiler neler? Covid etkisindeki ekonomik gelişmeler tarım piyasalarını nasıl etkileyecek? Konularında detaylı bilgilendirileceklerdir. Ayrıca konferans esnasında konuşmacılara soru sorma fırsatı bulacaksınız. Konferansta simultane tercüme yapılacak olup katılım formu ve programahttps://hubuder.org/konferanslinkinden ulaşabilirsiniz. Hasat öncesinde faydalı olacağını umduğumuz konferansımıza katılımlarınızı bekliyoruz. NOT: Güncel mail adresimizhubuder@hubuder.org.trolarak güncellenmiş olup, konferans ile alakalı dönüşlerinizi güncel mail adresimize yapmanızı rica ederiz. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bitkisel Üretime Destekleme Ödemesi Yapılmasına Hk.
Sayın Üyemiz, Resmî Gazete’de yayımlanan Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğ (Tebliğ No: 2020/31)’in EK-2’sindeki “Destekleme Uygulama Takvimi”nde yer alan “HububatBaklagilve Dane Mısır Fark Ödemesi Desteği” satırı aşağıdaki şekilde değiştirilmiş ve bu satırdan sonra gelmek üzere aşağıdaki satır eklenmiş; “Destekleme Uygulama Takvimi” içerisinde yer alan “Organik Tarım Desteği” ve “İyi Tarım Uygulamaları Desteği” satırlarında yer alan “29/3/2021” ibareleri “28/5/2021” olarak değiştirilmiştir. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye Odalar ve Borsalar Birliği (TOBB) Başkanı’na iftira.
KAMUOYUNUN BİLGİSİNE Türkiye Odalar ve Borsalar Birliği (TOBB) Başkanı’na iftira. Odatv internet sitesinde ‘’Al Gülüm Ver Gülüm’’ başlıklı haberde iftira ve yanlış bilgiler yer almaktadır. TOBB’un, TOBB Başkanı Rifat Hisarcıklıoğlu’nun ortak olduğu şirketten hizmet alması asla söz konusu değildir. TOBB’un hizmet aldığı Tür-Sum şirketinde TOBB Başkanı Rifat Hisarcıklıoğlu’nun hiçbir ortaklığı söz konusu değildir. TOBB Başkanı ve Yönetim Kurulu üyelerinin şirketleri TOBB’un düzenlediği ihalelere giremezler ve TOBB’a kendi ürün ve hizmetlerini satamazlar. TOBB ve iştiraklerinin düzenlediği ihalelerde, ihaleyi kazanan firmadanyazılıbir taahhütname de alınır. Bu taahhütname ile ihaleyi alan şirket, TOBB Başkanı’nın şirketlerinden mal almayacağını taahhüt eder. Haberde yer alan iftira, iddia, itham ve yorumların aksine TOBB’un etik kuralları da hiçbir şekilde çiğnenmemiştir. TOBB, büyük hassasiyet gösterdiği bu kuralları en başından itibaren kararlılıkla uygulamıştır ve uygulamayı da sürdürecektir. Haberde ismi geçen Tür-Sum şirketi, TOBB’unil ve ilçelerdekiokul yapımı gibi bazı faaliyetlerde teknik müşavirlik hizmeti vermiştir. Bu hizmet, söz konusu faaliyetlerin inşaat ve alım işlerinden bağımsız olarakdenetimine yöneliktir. Kamu ve özel sektörde herkes gayet iyi bilir ki, asıl büyük önem taşıyan inşaat ihalesinin düzgün ve şartnameye uygun yürütülmesidir. Bu noktada kilit bir rolü olan teknik müşavir seçiminde, geçmiş performansının ve yetkinliğinin bilinmesi çok büyük önem taşımaktadır. Kamu ve özel sektöre hizmet veren ve 44 yıldır faaliyet gösteren Tür-Sum, yurtiçi ve yurtdışı iş deneyimleri, yetkin kadrosu nedeniyle tercih edilmiştir. Ahmet Akpınar’ın Yönetim Kurulu Başkanlığı’nı yaptığı Tür-Sum şirketi ile TOBB Başkanı Rifat Hisarcıklıoğlu’nun herhangi bir ortaklığı veya bağı bulunmamaktadır. Haberde söz edilen Armada ve Söğütözü çok ortaklı şirketlerdir. Söğütözü mal sahibidir. Armada ise sadece işletici firmadır. 58ortağı vardır. Rifat Hisarcıklıoğluyüzde 9.74 oranı ile azınlıkhissedarlardan birisidir. Yüzde 3.2 oranı ile küçük hissedarlardan biri de Ahmet Akpınar’dır. Bu çerçevede söz konusu teknik müşavirlik şirketinin sahibinin, TOBB Başkanı Rifat Hisarcıklıoğlu’nun azınlık hissedarı olduğu bir şirkette çok küçük hissedarlardan biri olması gündeme getirilerek tüm bu gerçeklerin göz ardı edilmeye çalışılması son derece yanlış ve yanıltıcıdır. Kamuoyuna saygı ile duyurulur. Türkiye Odalar ve Borsalar Birliği (TOBB)
Webinar - Karbon Ayak İzi Nedir ve Nasıl Ölçülür?
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği Türkiye İklimlendirme Meclisi tarafından 20 Mayıs 2021 tarihinde saat 11.30 da "Karbon Ayak İzi Nedir ve Nasıl Ölçülür?" isimli bir seminer gerçekleştirilecektir. Toplantıya http://webinar.tobb.org.tr adresinde yer alan linkten erişim sağlanabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Fuar Başvuruları
Sayın Üyemiz, COVID-19 Pandemisinin fuarcılık sektöründeki olumsuz etkilerinin artmasından dolayı;  31.12.2021 tarihine kadar, 2021 Fuar Takviminde yapılacak olan iptal ve değişiklik başvurularından ücret alınmamasına,  Bu tarihe kadarki 2021 Fuar Takvimine ekleme ve değişiklik başvurularında Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esaslar ın 17 nci maddesinde düzenlenen ekleme başvurularının ana fuar takviminde yer alan bir fuar ile çakışması halinde reddedileceğine ilişkin hükmün askıya alınarak değerlendirilmesine,  Bu tarihe kadar yapılan ekleme, iptal ve değişiklik başvurularında Esaslar da yer alan sürelere uyulmasa dahi başvuruların değerlendirilmeye alınmasına karar verilmiştir.  2021 yılında düzenlenmek üzere Fuar Takviminde yer alan ancak mücbir nedenlerden dolayı 2022 yılına ertelemek isteyen fuarların normal değişiklik başvurusu yapmaları halinde başvurularının kabul edilmesine, değişiklik başvurularından ücret alınmamasına ve bu değişikliklerin 2022 yılı Ana Fuar Takvimine dahil edilmesine karar verilmiştir. Ayrıca, Yurt İçinde Fuar Düzenlenme Yetki Belgesi sahibi firmalardan 2 yılda bir talep edilen en az 250.000 TL sermayenin öz varlık içinde korunduğuna dair mali durumunu gösterir Yeminli Mali Müşavir raporunun 2021 senesi için talep edilmemesine karar verilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Samsun Export- Samsun Sanayi ve İhraç Ürünleri Sanal Fuarı
Sayın Üyemiz, 3-12 Mayıs 2021 tarihleri arasında ihracatçı ve sanayici firmaların sanal ortamda yer alarak ürünlerini tanıtabileceği Samsun Export – Samsun Sanayi ve İhraç Ürünleri Sanal Fuarı nı düzenleyeceklerini bildirmektedirler. Sanal Fuar da KOBİ lerin ürünlerini 7 dilde tanıtma, B2B görüşmeler yapma imkanı sağlanacağını bildirilmekte, yurt içi ve yurt dışından birçok ziyaretçinin fuara iştirak edeceği bildirilmektedir. Fuar 3-12 Mayıs 2021 tarihleri arasında www.digitalsamsunfair.com web sitesi üzerinden ziyaret edilebilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Trakya ya Hayvan Sevki
Sayın Üyemiz, Tarım ve Orman Bakanlığı Gıda ve Kontrol Genel Müdürlüğünden, Bakanlıklarına iletilen yazı ile hayvan sevkleri hakkında bilgilendirme yapıldığı iletilmektedir. Ticaret Bakanlığı ndan alınan söz konusu yazı ve ekinde bulunan Tarım ve Orman Bakanlığı Gıda ve Kontrol Genel Müdürlüğü nün yazısı ve ekleri ilişikte gönderilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çalışma İzin Görev Belgesi Süresi Uzatıldı
Sayın Üyemiz, İçişleri Bakanlığı muafiyet kapsamındaki işveren ve çalışanların manuel olarak doldurduklarıçalışma izni görev belgesi formunungeçerlilik süresi12 Mayıs 2021 Çarşamba Günü saat 24.00’ekadar uzatıldı. Genelgede, tam kapanma döneminde üretim, imalat, tedarik ve lojistik zincirlerinde herhangi bir aksama yaşanmaması için sokağa çıkma kısıtlaması muafiyeti getirilen işkolları ve görevlileri tespit edilerek duyurulduğu bildirildi. Genelgede, tam kapanma sürecinde muafiyet kapsamında bulunan işkollarında üretim faaliyetlerinin devamlılığını sağlamak ve muafiyetlerin suistimal edilmesini önlemek amacıyla, sokağa çıkma kısıtlamalarından muaf iş yerlerinde görevli kişilere e-Başvuru sistemi üzerinden“çalışma izin belgesi”veya manuel olarak doldurularak çalışan ve iş yeri yetkilisince imzalanıp onaylanan“çalışma izni görev belgesi formunu”alma ve denetimlerde ibraz etme zorunluluğunun getirildiği hatırlatıldı. Genelgede, tam kapanma sürecinde muafiyet tanınan sektör çalışanlarına yönelik e-Başvuru sistemi üzerindenbugün itibariyle 9.5 milyona yakın başvuru neticelendirildiği ve muafiyet nedeni, güzergahı ve zamanı ile kısıtlı olacak şekilde çalışma izni görev belgesi düzenlendiği belirtildi. Genelgede, Nace kodu eşleşme hatası, muafiyet kapsamındaki bir işyerinde görev yapmasına rağmen alt işvereninin muafiyet kapsamında olmaması nedeniyle çalışma izni görev belgesi alamayanlar ile erişim hatası gibi geçici durumlar göz önünde bulundurulduğunda;sistem üzerinden görev belgesi alınamamasının üretim, imalat, tedarik ve lojistik zincirlerinde herhangi bir aksamaya yol açmaması için Ek’te yer alan ve işveren ile çalışanın beyanı/taahhüdüyle manuel doldurularak imza altına alınan“çalışma izni görev belgesi formunun”geçerlilik süresinin12 Mayıs 2021 Çarşamba Günü saat 24.00’ekadar uzatıldığı ifade edildi. Çalışma izin belgesi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
81 İl Valiliğine Pazar Yerleri Genelgesi Gönderildi
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl ValiliğinePazar YerleriGenelgesigönderildi. Genelgede, tam kapanma sürecindeki sokağa çıkma kısıtlamasında, temel gıda, ilaç ve temizlik ürünlerinin satıldığı yerler (bakkal, market, kasap, manav, kuruyemişçi, tatlıcı, fırın ve yeme-içme yerleri) ile üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması amacıyla muafiyet kapsamında bulunan işyerleri dışındaki tüm ticari işletme, işyeri ve/veya ofislerin kapalı olacağının düzenlendiği hatırlatıldı. Genelgede, mevsimsel etkiler nedeniyle ürün arzında yaşanan artış, ürünlerin saklama zorluğu ve raf ömürlerindeki kısalık nedeniyle çiftçiler tarafından üretilen tarımsal ürünlerin (yaş sebze-meyve) zayi olabileceği yönünde tespitler bulunduğu belirtildi. Bu doğrultuda, ilgili Bakanlıklar, kamu kurum ve kuruluşları, meslek odaları ve sektör temsilcileri ile yapılan görüşmeler sonucunda alınan kararlar şu şekilde sıralandı: Tam kapanma dönemi içerisinde8 ve 15 Mayıs 2021tarihlerine denk gelenCumartesi günleri 10.00-17.00saatleri arasındasadece yaş sebze/meyve ile fide satışı yapan pazar yerleri açık olacak.Vatandaşların yaş sebze/meyve ve fide ihtiyaçlarını temin amacıyla ikametlerine en yakın pazar yerine gidip gelebilmelerine izin verilecek. Cumartesi günleri 10.00-17.00 saatleri arasında kurulacak pazarlarda sadece yaş sebze/meyve ile fide satılabilecek, (özellikle köylülerimizin ürünleri olmak üzere), temizlik ürünleri, giyim, züccaciye, oyuncak, süs eşyası, çanta vb. ürünlerin satışına ise izin verilmeyecek. Pazar yerlerinde oluşabilecek yoğunluk göz önünde tutularak Valilik/Kaymakamlıkların koordinasyonunda mahalli idareler tarafından gerekli tedbirler alınacak. Bu amaçla mevcut pazaryerleri genişletilecek veya ilave pazar alanları oluşturulacak. Pazar yerlerine kontrollü giriş/çıkışları sağlamak için belirlenen noktalar haricinde diğer tüm alanlar demir bariyer ve benzeri araç-gereç ile kapatılarak kontrolsüz giriş/çıkışlar engellenecek. Pazar yerlerinde Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirtildiği üzeresergi ve tezgahlar arasında en az 3 metre olacak şekilde mesafe bırakılacak. Her bir pazar yerinde gerekli kontrolleri yapmak için başta zabıta olmak üzere yeterli sayıda personel görevlendirilecek, görevlendirilen personel tarafından pazar yerlerinin içerisinde yoğunluk oluşmaması için gerekli tedbirler alınacak, bu kapsamda içerdeki yoğunluk azaltılana kadar yeni müşteri girişine geçici olarak izin verilmeyecek. Pazar yerlerinde ambalajsız satılan yaş sebze ve meyvelerin tüketicilerce temas edilmeden, doğrudan pazarcı esnafı tarafından hijyen koşullarına dikkat edilerek poşetlenecek ve satışı yapılacak. İlgili mahalli idare birimlerince pazaryerlerinde çöp toplama, hijyen ve dezenfeksiyon hususunda gerekli tedbirler alınacak. Pazar yerlerinde satış yapacak pazarcılar, ilgili meslek odası tarafından düzenlenenmesleki faaliyet belgesiileticari araç görevlendirme belgesiniibraz etmek ve güzergahla sınırlı kalmak kaydıyla Cumartesi günleri sokağa çıkma kısıtlamasından muaf olacak. Bu esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27 nci ve 72 nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararları ivedilikle alınacak. Pazar yerlerine yönelik her türlü tedbirin; Vali/Kaymakamlar ile belediye başkanları ve meslek odası temsilcilerinin katılımıyla planlancak vesahada bizzat takip edilmesi sağlanacak. Başta zabıta görevliler ve kolluk kuvvetleri olmak üzere denetim ekiplerince bu hususa ilişkin gerekli kontrol faaliyetlerinin eksiksiz yerine getirilecek. Uygulamada herhangi bir aksaklığa meydan verilmeyecek ve mağduriyete neden olunmayacak.
TGK-Zeytinyagı ve Pirina Yagı Tebligi
Sayın Üyemiz, Tarım ve Orman Bakanlığı ndan alınan ilgi yazı ile TGK-Zeytinyagı ve Pirina Yagı Tebligi (Özel Hüküm Uygulama Talimatı-2021) gönderilmiştir. Tarım ve Orman Bakanlığı ndan alınan söz konusu yazı ekte gönderilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekrete
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO stoklarında bulunan ve ekli listede yer alan hububat (Ek-1) ve bakliyat aşağıdabelirtilen esaslar ve ekte (Ek-2) yer alan fiyatlarla 03 Mayıs 2021 tarihinden itibaren peşin bedelmukabilinde satılacaktır. Besici ve yetiştiricilere yapılan arpa satışları peşin veya 90 güne kadar vadeli vevade farksız olarak gerçekleştirilecektir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Online Toplantı Raporları
Sayın Üyemiz / Paydaşımız, T.C. Eskişehir Ticaret Borsası ev sahipliğinde, 23 Ekim 2020 tarihinde "Covid-19 Sonrası Eskişehir Tahıl Tarımında Öncelikler ve Tercihler Neler Olmalıdır" ve 19 Şubat, 2021 tarihinde “Yaşamakta Olduğumuz Kuraklığın Eskişehir de Kışlık Tahıllara Etkileri Konusunda Gözlemler, Olası Sonuçları ve Öneriler" başlıklı online (Zoom) olarak gerçekleştirilen toplantılarda verilen bilgiler, görüş ve yorumları da içeren sonuç raporunu siz değerli tarım paydaşlarımızın bilgisine sunarız. İlgili rapora ulaşmak için tıklayınız. Üyelerimize ve paydaşlarımıza duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOSGEB Mikro ve Küçük İşletmelere Hızlı Destek Programı
Sayın Üyemiz, Covid-19 pandemisinden etkilenen öncelikli sektörlerdeki mikro ve küçük işletmelerin faaliyetlerini sürdürebilmeleri ve istihdam seviyelerini muhafaza edebilmeleri için tasarlanan "KOSGEB Mikro ve Küçük İşletmelere Hızlı Destek Programı" 29 Nisan 2021 tarihi itibariyle Cumhurbaşkanı tarafından kamuoyuna ilan edilmiştir. Başvurular 3 Mayıs 2021 Pazartesi günü başlayacak olup, destek programına ilişkin bilgi notu ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
81 İl Valiliğine Market Tedbirleri Genelgesi gönderildi
Sayın Üyemiz, Genelgede, tam kapanma sürecinde uygulanan sokağa çıkma kısıtlaması ile ilgili usül ve esasların belirlenerek, valilere duyurulduğu hatırlatıldı. Bu kapsamda daha önce illere gönderilen sokağa çıkma kısıtlaması sırasında temel gıda, ilaç ve temizlik ürünlerinin satıldığı yerler ile üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması amacıyla muafiyet kapsamında bulunan iş yerleri dışında tüm ticari işletme, iş yeri ve/veya ofislerin kapalı olacağı belirtilmiş, vatandaşlarımızın zorunlu temel ihtiyaçlarını karşılamakla sınırlı olacak şekilde bakkal, market, fırın, kasap, manav, kuruyemişçi ve tatlıcıların tam kapanma döneminde 10.00 - 17.00 saatleri arasında faaliyet gösterebileceği, zincir ve süper marketlerin Pazar günleri kapalı kalacağı bildirilmişti. Genelgede, sokağa çıkma kısıtlaması sırasında marketlerde oluşabilecek yoğunlukların önüne geçmek amacıyla ilgili Bakanlıklar, kamu kurum ve kuruluşları, meslek odaları ve sektör temsilcileri ile yapılan görüşmeler sonucunda alınan tedbirler şu şekilde sıralandı: Marketlerde (zincir ve süper marketler dâhil) vatandaşlarımızın zorunlu temel ihtiyaçları kapsamındaki ürünlerin dışında herhangi bir ürün satışına izin verilmeyecek. 7 Mayıs 2021 Cuma gününden itibaren marketlerde (zincir ve süper marketler dâhil) temel gıda ve temizlik ürünlerinin yanı sıra sadece hayvan yemi, mamaları ile kozmetik ürünleri (parfümeri ve makyaj malzemeleri hariç) satılabilecek. Daha önce getirilen alkollü ürün satışı kısıtlamasının yanı sıra marketlerde (zincir ve süper marketler dâhil) elektronik eşya, oyuncak, kırtasiye, giyim ve aksesuar, ev tekstili, oto aksesuar, bahçe malzemeleri, hırdavat, zücaciye vb. ürünlerin satışına izin verilmeyecek. Bu esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27’nci ve 72’nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararları ivedilikle alınacak. Başta zabıta görevlileri ve kolluk kuvvetleri olmak üzere denetim ekiplerince bu hususa ilişkin tebliğler ve kontroller eksiksiz yerine getirilecek. Uygulamada herhangi bir aksaklığa meydan verilmeyecek ve mağduriyete neden olunmayacak. Genelge içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Görev Belgesi Hakkında
Sayın Üyemiz, İçişleri Bakanlığı tarafından Görev Belgesi Düzenlenmesi hakkında yeni bir Genelge gönderildi. Genelgede,26.04.2021tarihliCumhurbaşkanlığıKabinesindealınan“tamkapanma”kararıkapsamında29Nisan 2021Perşembegünüsaat19.00’dan17Mayıs2021Pazartesigünüsaat05.00’ekadaruygulanacakolan sokağaçıkmakısıtlamasınıntemelusulveesaslarıBakanlığımızınilgi(a)Genelgesiylebelirlenerek Valiliklere duyurulmuştur. Yineilgi(a)Genelgemizle,dahaöncekikısıtlamadönemlerindeolduğugibitamkapanmadöneminde detemelönceliğiüretim,imalat,tedarikvelojistikzincirlerindeherhangibiraksamayaşanmaması olan sokağaçıkmakısıtlaması muafiyetigetirilenişkollarıvegörevlilertespitedilmiştir. Hemmuafiyetkapsamındabulunanişkollarındagörevlikişilerinüretimdevamlılıklarınınsürdürülmesi vehemdemuafiyetlerinkötüyekullanılmasınınönünegeçilebilmesiamacıylailgi(b)Genelgemizle; ­E­başvurusistemiüzerindençalışmaizinbelgesialınmasına, ­Ek’tebelirtilenyenioluşturduğumuzçalışmaiznigörevbelgesiformuna, dairusulveesaslarbelirlenmiştir. Sokağaçıkmakısıtlamasısırasındamuafiyettanınanişkollarındaçalışankişilerinbaşvurularının değerlendirildiği,e­devletplatformundayeralanİçişleriBakanlığıe­başvurusistemiüzerinden02.05.2021 saat17.00’yekadar2.677.000başvurugereklisorgulamalaryapılarakneticelendirilmişveilgili vatandaşlarımıziçinçalışmaizni görevbelgesidüzenlenmiştir. Halihazırdamuafiyetalanındaolmasınarağmensistemüzerindençalışmaiznigörevbelgesialma imkanıolmayan; ­İşyerisahipleri, ­Kendinamvehesabınabağımsızçalışanlar, ­ Kendiözelsandıklarınatabiolmalarınedeniylesosyalgüvenliksistemindekayıtlarıbulunmayan bankacılıksektörüçalışanları, gibialanlardadagereklikurumlararasıentegrasyonGelirİdaresiBaşkanlığıveTürkiyeBankalarBirliği baştaolmaküzereilgilikurumvekuruluşlarca2Mayıs2021Pazargünütamamlanacaktır. Tamkapanmadöneminde;üretim,imalat,tedarikvelojistikzincirlerindeherhangibiraksama yaşanmamasıvevatandaşlarımızıntemelihtiyaçmalzemelerineerişimlerininsağlanmasıiçinhertürlü tedbiralınmış/alınmaktaolmasınarağmen,buişkollarındazorunlubirgörevinifasıiçinişyerinegidip gelmekdurumundakiişyerisahipleriveyaçalışanlarınherhangibirsorunlakarşıkarşıyakalmamasıiçin; 1.Dahaöncekiilgi(b)Genelgemizleyenioluşturduğumuz“çalışmaiznigörevbelgesiformunun”5 MayısÇarşambagününekadargeçerliolacağıbildirilmişti.Muafiyetalanındakiişkollarıiçinişvereninve çalışanınbeyanıvetaahhüdüylemanuelolarakdoldurularakçalışanveişyeri/firmayetkilisininimzasıyladüzenlenecek“çalışmaiznigörevbelgesiformunun”geçerliliksüresi7Mayıs2021Cumagünüsaat 24.00’ekadaruzatılmıştır. 2.Çalışmaiznigörevbelgesinin,esasitibariylee­devletplatformuüzerindeyeralanİçişleriBakanlığı e­başvurusistemiüzerindenalınmasının,gerekdenetimlerdegereksededüzenlenmesiveişleyişi açısındanrahatlıksağlayacağıvesuiistimaliengelleyeceğiaçıktır.BuçerçevedeEk’tekiformauygunşekilde manuelçalışmaiznigörevbelgesidüzenlenmesi,e­başvurusistemininkullanımındaoluşabilecek problemler,sistemselyoğunluk,erişimhatasıgibigeçicidurumlarnedeniylezamanındagörevbelgesi alınamamasıgibizorunluhallerdekullanılabilecekbiruygulamadır. 3.Öteyandankollukgörevlilerinceyapılacakdenetimlerde,e­başvurusistemiüzerindenalınan çalışmaiznigörevbelgelerirutinkontrole,manueltanzimedilençalışmaiznigörevbelgeleriisekolluk kuvvetlerininkullandıklarıbilgisistemleriüzerindenayrıcadenetimetabitutulacaktır.Bukontrollerde çalışmaiznigörevbelgesininsuiistimaledildiğinintespitihalindetaahhüttebulunanlarlailgiliolarakgerekli idari/adliişlemlergerçekleştirilecektir. Biryılıaşkınsüredirazizmilletimizinçeşitlifedakârlıklardabulunduğu,baştasağlıkçalışanlarıve kollukkuvvetleriolmaküzeretümdenetimekiplerindegörevalanpersonelinbüyükbirözveriylegörev yaptığıvehepimizinbirbirimizekarşısorumluolduğusalgınlamücadelesürecinde;muafiyetlerinsuiistimal edilmemesi,salgınnedeniylekatlanmakdurumundakalınantoplumsalyükünartmamasıaçısındanson dereceönemlidir. YukarıdabelirtilenesaslardoğrultusundaUmumiHıfzıssıhhaKanununun27ncive72ncimaddeleri uyarıncaİl/İlçeUmumiHıfzıssıhhaKurullarıkararlarınınivediliklealınması,uygulamadaherhangibir aksaklığameydanverilmemesivemağduriyetenedenolunmamasıhususunda; bilgisi yer almaktadır. İlgili genelgeye ulaşmak için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Bakanlığı çek ile ilgili genelge ve tebliğ yayınladı
Sayın Üyemiz, Ticaret Bakanlığı, genelgeden sonra mükerrer Resmi Gazete’de bir de tebliğ yayınladı. Çek ile ilgili sıkıntıları genelge ile çözmeye çalışan Ticaret Bakanlığı genelgeden sonra öğleden sonra mükerrer Resmi Gazete’de bir de tebliğ yayınladı. Tebliğde 30 Nisan ile 31 Mayıs tarihleri arasında çek ibraz yasağının bulunduğu belirtilirken, bu hükmün gerekçesinde kapanmanın ticari hayata olumsuz etkilerinin azaltılmasının amaçlandığına dikkat çekildi. Tebliğde, düzenlemeyle COVID-19 salgın hastalığı nedeniyle uygulanan kısıtlama tedbirleri kapsamında çekini bankaya ibraz edemeyen alacaklının hakkının korunmasının yanı sıra borçlunun ödeme günü bu tarihler arasına denk gelen borçlarını 1/6/2021 tarihinden sonra ödeyebilmesine de imkân sağlandığı belirtilerek, “a) İbraz süresinin son günü, 30/4/2021 ila 31/5/2021 tarihleri arasına isabet eden çeklerin, belirtilen tarihler arasında bankaya ibraz edilmesi halinde, çek hesabı sahibinin hesabında çekin karşılığının bulunması kaydıyla çek bedelinin ödenmesi gerekmektedir. b) İbraz süresinin son günü, 30/4/2021 ila 31/5/2021 tarihleri arasına isabet eden çeklerin, belirtilen tarihler arasında bankaya ibraz edilmesi ve çek hesabı sahibinin hesabında çekin karşılığının bulunmaması halinde, 1/6/2021 tarihinden önce 5941 sayılı Çek Kanunu kapsamında karşılıksızdır işlemi yapılmayacaktır. 1/6/2021 tarihinden sonra ise söz konusu çeklerle ilgili gerekli işlemler yapılabilecektir” ifadeleri kullanıldı. c) 10.12.2003 tarihli ve 5018 sayılı Kamu Mali Yönetimi ve Kontrol Kanunu kapsamına giren kamu idarelerinin kamu hukukundan veya özel hukuktan doğan alacakları hakkında, 30.04.2021 ila 31.05.2021 (bu tarihler dahil) tarihleri arasında icra ve iflas takibi başlatılamaz. İlgili kanun içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tam Kapanma Süreci doğrultusunda açıklanan ekonomik destekler
Sayın Üyemiz, 29 Nisan 2020 tarihinde CumhurbaşkanıRecep Tayyip Erdoğan tarafından açıklanan desteklerin tam metni şu şekilde; Salgının faaliyetlerini olumsuz etkilediği esnafımıza yapılan 1.000 TL Gelir desteği ile 500 ve 750 TL olarak verilen kira desteği uygulamasının süresini 1 ay daha uzatıyoruz, TESKOMB ve Halkbank aracılığıyla esnafa kullandırdığımız kredilerin taksit ödemelerini 1 Temmuz 2021 tarihine kadar erteliyoruz, TESKOMB kefaleti ile kredi kullanan esnafımızdan taksit ödemesi yapamayan 240 bin kişinin 1 milyar lira tutarındaki borcu daha sonra tahsil edilmek üzere TESKOMB tarafından bankaya ödenmiştir, Çek ve senetlerle ilgili önemli bir düzenleme Mecliste uzlaşmayla görüşülmektedir, İş Bu sözleşmelerin fesih yasağı 30 Haziran’a kadar uzatılmıştır. Kısa Çalışma Ödeneği süresi Nisan başından Haziran sonuna kadar uzatılmıştır, KOSGEB VASITASIYLA TOPLAMDA 5 MİLYAR TL BÜTÇELİ YENİ BİR DESTEK PROGRAMI BAŞLATIYORUZ; COVID Salgını sebebiyle gelir kaybına uğramış veya nakit akışı bozulmuş ama istihdamını koruyan, imalat sektörlerinde faaliyet gösteren mikro ve küçük ölçekli işletmelere yöneliktir, Teknoloji alanında faaliyet gösteren filiz şirketler de bu desteğe başvurabilecektir, Mikro işletmeler 30 birn TL’ye kadar, küçük işletmeler 75 bin TL’ye kadar olmak üzere 3 yıl geri ödemesiz, tamamı faizsiz şekilde bu destekten faydalanacaklardır, Sektörlerde şartları taşıyan işletmeler 3 Mayıs Pazartesi gününden itibaren e-devlet üzerinden KOSGEB aracılığıyla başvurularını yapabilirler
Görev Belgesi Düzenlenmesi Konulu Genelge
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl ValiliğineGörev Belgesi DüzenlenmesiGenelgesigönderildi. Genelgede,Bakanlığımız 81 İl ValiliğineGörev Belgesi Düzenlenmesikonulu genelge gönderdi. Genelgede daha önceki kısıtlama dönemlerinde olduğu gibi tam kapanma döneminde de temel önceliği üretim, imalat, tedarik ve lojistik zincirlerinde herhangi bir aksama yaşanmaması olan sokağa çıkma kısıtlaması sırasında bahse konu sektörlerde çalışanlara yönelik sokağa çıkma muafiyeti getirildiği hatırlatıldı. Genelgede, salgınla mücadele sürecinde; muafiyetlerin suiistimal edilmemesi, hastalığın yayılımı ve başta sağlık çalışanları olmak üzere toplumsal yükün artmaması açısından son derece önemli olduğu belirtilerek, üretim, imalat, tedarik ve lojistik sektörleri başta olmak üzere daha önce genelgelerlemuafiyet tanınan işyerlerinde çalışan görevliler için bu işyerlerinin yetkililerince tüm belgelerin geçerliliğin2 Mayıs 2021 Pazar günü saat 24.00’de sona ereceği ifade edildi. Genelge görev belgeleri ile ilgili şu bilgilere yer verildi: 29 Nisan 2021 Perşembe gününden itibaren muafiyetler kapsamında bulunan işyeri/fabrika/imalathane gibi yerlerde çalışan kişilerin, e-devlet platformunda yer alan İçişleri Bakanlığı e-başvuru sistemi üzerindengörev belgesibaşvurusunda bulunacak. Görev belgesi başvurusunda bulunan kişilerin sosyal güvenlik numarasına göre halen çalışmakta olduğu işyeri sicil numarası belirlenecek ve iş yerinin faaliyet alanına göre muafiyet kapsamında kalıp kalmadığı kontrol edilecek. İlgili Bakanlıklarla sağlanan entegrasyonlar sayesinde anlık ve otomatik olarak yapılacak bu sorgulamalar sonucunda bildirim ile aranan şartlar arasında uyumluluğun tespiti halinde sistem üzerinden otomatik olarak görev belgesi düzenlenecek. Başvuruda bulunan çalışana dair kimlik bilgilerinin yanı sıra sokağa çıkma kısıtlaması sırasında hangi amaçla işyerinde olması gerektiği, çalışma süresi/zaman dilimi, işyeri ve ikamet adresi, varsa kullanacağı servis ya da araç plaka bilgisinin de yer alacağı görev belgesinin çıktısı başvuruda bulunan kişi tarafından alınarak işyeri/firma yetkilisine imzalatılacak. Başvuruda bulunacak çalışanın e-başvuru sistemini kullanımında oluşabilecek problemler, sistemsel yoğunluk, erişim hatası gibi geçici durumlar nedeniyle zamanında görev belgesi alınamaması durumunda bir defaya mahsus olmak ve en fazla üç gün için geçerli olmak kaydıyla Ek-1’de örneği sunulan görev belgesi formu manuel olarak doldurularak çalışan ve işyeri/firma yetkilisi tarafından imzalanmak suretiyle düzenlenebilecek. e-başvuru sitemi üzerinden veya zorunlu hallerde manuel olarak düzenlenen görev belgeleri kapsamında; İşyeri/firma yetkilisi, imza altına aldığı belgede belirtilen kişinin yetkilisi olduğu işyerinde/firmada çalıştığı, sokağa çıkma kısıtlaması sırasında zorunlu bir amaçla işyerinde olması gerektiği bilgisinin doğruluğundan, Hakkında görev belgesi düzenlenen kişi ise kendisi ile ilgili bilgilerin doğruluğundan ve sokağa çıkma kısıtlaması sırasında muafiyet nedeni ile buna bağlı olarak zaman ve güzergahla sınırlı davranmaktan, sorumlu olacak. Düzenlenen görev belgesi, sokağa çıkma kısıtlamaları sırasında muafiyet tanınan işyerlerinde çalışan personelin yanında bulundurulacak ve yapılacak kontrollerde denetim ekiplerine ibraz edilecek. e-başvuru sistemi üzerinden üretilen görev belgeleri eş zamanlı olarak kolluk kuvvetlerinin bilgi sistemlerine de iletilecek olup, kolluk kuvvetlerince yürütülecek denetim faaliyetleri sırasında, geçerli görev belgesi olmayan/ibraz edemeyen veya görev belgesinde belirtilen muafiyet nedeni, zamanı ve güzergahı ile denetim sırasındaki durumu uyumlu olmayan kişiler ile eksik/yanlış bilgi veren işyeri yetkilileri hakkında adli ve idari işlem uygulanacak. Bu noktada esnaf, sanayi ve/veya ticaret ile ziraat odaları başta olmak üzere ilgili meslek odaları tarafından gerekli rehberlik faaliyetlerine ağırlık verilecek ve faaliyet alanlarındaki işyerlerinin/firmaların bilgilendirilmeleri ve kurallara uymaya teşvik edilecek. Tam kapanma dönemi içerisinde asgari personel ile hizmet sunacak kamu kurum ve kuruluşlarının hizmet binalarında/yerlerinde görev yapacak kamu personeli için de yetkili yönetici tarafından bu durumu ortaya koyan Ek-2’de örneği verilenKamu Personeli Görev Bildirim Belgesidüzenlenecek ve bu kapsamdaki kamu personeli, görevli olduğu zaman dilimi içerisinde ikameti ile işyeri arasındaki güzergahla sınırlı olacak şekilde muafiyete tabi olacak. Ayrıca seyahat izin başvuruları, önceden e-Devlette Bakanlığımızca sunulan hizmetlerden olan E-Başvuru Sisteminin içerisindeyken vatandaşlarımızın erişimlerini kolaylaştırmak üzere yapılan geliştirmeler ile birlikte e-Devlet İçişleri Bakanlığı Hizmetleri listesinden doğrudan erişim sağlanabilecek hale getirildi. Cenaze sahibi vatandaşların mağdur olmalarının önüne geçilmesi amacıylaCenaze İzin Hizmetiseyahat izni başvurusundan ayrı olarak doğrudan erişilebilir hale getirildi. Ayrıca cenaze izni için başvuru esnasında vatandaşların elektronik ortamdaÖlüm Belgesi yüklemesi uygulamasından da vazgeçildi. Başvuru konusunun doğruluğu, Bakanlığımız ve Sağlık Bakanlığı arasındaki sistem entegrasyonları ile teyit edilecek.
Üye İzin Belgesi
27 NİSAN 2021 TARİHİNDE İÇİŞLERİ BAKANLIĞI TARAFINDAN YAYINLANAN "TAM KAPANMA TEDBİRLERİ"GENELGESİ VE AŞAĞIDA YAZILI MADDELERİ GEREĞİNCE İSTENEN BELGERİN SORUMLULUĞU KENDİLERİNE AİT OLMAK ÜZERE BORSAMIZIN ÜYELERİNİN FAALİYETLERİNE İZİN VERİLENLER. -Üretim ve imalat tesisleri ile inşaat faaliyetleri ve bu yerlerde çalışanlar, -Bitkisel ve hayvansal ürünlerin üretimi, sulanması, işlenmesi, ilaçlanması, hasadı, pazarlanması ve nakliyesinde çalışanlar, -Tarımsal üretime ilişkin zirai ilaç̧ tohum, fide, gübre vb. ürünlerin satışı yapılan işyerleri ve buralarda çalışanlar, -Yurt içi ve dışı taşımacılık (ihracat/ithalat/transit geçişler dâhil) ve lojistiğini yapan firmalar ve bunların çalışanları, - Ürün ve/veya malzemelerin nakliyesinde ya da lojistiğinde (kargo dahil), yurt içi ve yurt dışı taşımacılık, depolama ve ilgili faaliyetler kapsamında görevli olanlar, -Sebze/meyve ve su ürünleri toptancı halleri ile buralarda çalışanlar. MESAİ GÜN-SAATLERİNE VE COVİD-19 TEDBİRLERİNE RİAYET ETMEK KAYDIYLA İŞYERLERİNİ AÇABİLECEKLERDİR. MAL VE SEVKİYATLARDA İSE BİR SINIRLAMA YOKTUR. ÜYELERİMİZİN FAALİYET BELGELERİNİ VE ÇALIŞAN PERSONELİN SGK VE GÖREVLENDİRME BELGELERİNİ İŞYERLERİNDE VE ARAÇLARINDA BULUNDURMALARI GEREKECEKTİR. Örnek izin belgesi ekte bilgilerinize sunulmuştur. ÜYELERİMİZE SAYGILARIMIZLA DUYURULUR
Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari Para Cezalarının Hesaplanmasına Dair Yönetmelik
Sayın Üyemiz, 16 Nisan 2021 tarih ve 31456 sayılı Resmi Gazete de Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari ParaCezalarının Hesaplanmasına Dair Yönetmelik yayımlanmış olup ekte dikkatinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tam Kapanma Tedbirleri Genelgesi
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl Valiliğine Tam KapanmaGenelgesigönderildi. Genelgede,Covid-19 virüsünün mutasyona uğrayan yeni varyantları sonrasında artan bulaşıcılığıyla birlikte Koronavirüs (Covid-19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme ve hastalığın yayılım hızını kontrol altında tutma amacıyla yeni tedbirlerin alınması gerekmiş ve 13 Nisan 2021 tarihli Cumhurbaşkanlığı Kabinesi toplantısında alınan kararlar doğrultusunda 14 Nisan 2021 Çarşamba gününden itibaren iki haftalık kısmi kapanma sürecine girilmiştir. Gelinen aşamada temel usul ve esasları 14.04.2021 tarih ve 6638 sayılı Genelgemizle belirlenen kısmi kapanma tedbirleri sonrasında salgının artış hızının önce yavaşladığı, akabinde durduğu, son günlerde ise bir düşüş eğilimine girdiği görülmektedir. Bu çerçevede 26.04.2021 tarihinde Sayın Cumhurbaşkanımızın başkanlığında toplanan Cumhurbaşkanlığı Kabinesi nde alınan kararlar doğrultusunda; halihazırda uygulanmakta olan kısmi kapanma tedbirlerine yeni önlemler eklenerek tam kapanma dönemine geçilecektir.29 Nisan 2021 Perşembegünü saat19.00’danitibaren17 Mayıs 2021 Pazartesigünü saat05.00’ekadar sürecek olan tam kapanma döneminde ülke genelini kapsayacak şekilde aşağıdaki tedbirlerin alınması gerektiği değerlendirilmektedir. Tam kapanma döneminde 14.04.2021 tarih ve 6638 sayılı Genelgemizde belirtilen tedbirlere ilave olarak; 1. Sokağa Çıkma Kısıtlaması Hafta içi hafta sonu ayrımı olmaksızın29 Nisan 2021 Perşembegünü saat19.00’dabaşlayıp17 Mayıs 2021 Pazartesigünü saat05.00’tebitecek şekilde tam zamanlı sokağa çıkma kısıtlaması uygulanacaktır. 1.1-Sokağa çıkma kısıtlaması uygulanacak günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamak amacıyla Ek’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacaktır. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler, 14.12.2020 tarih ve 20799 sayılı genelgemizde açıkça belirtildiği şekilde muafiyet nedeni ve buna bağlı olarak zaman ve güzergâh ile sınırlı olup, aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konu edilecektir. 1.2-Sokağa çıkma kısıtlamasının olduğu günlerdebakkal, market, manav, kasap, kuruyemişçi ve tatlıcılar10.00-17.00saatleri arasında faaliyet gösterebilecek, vatandaşlarımız zorunluihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın bakkal, market, manav, kasap, kuruyemişçi ve tatlıcılara gidip gelebilecektir. Aynı saatler arasında bakkal, market, manav, kasap, kuruyemişçi, tatlıcılar ve online sipariş firmaları evlere/adrese servis şeklinde de satış yapabileceklerdir. Yukarıda belirtilen uygulama zincir ve süper marketler için haftanın altı günü geçerli olacak, zincir marketler pazar günleri kapalı kalacaktır. 1.3-Sokağa çıkma kısıtlamasının olduğu günlerde yeme-içme yerleri (restoran, lokanta, kafeterya, pastane gibi yerler) sadece paket servis şeklinde faaliyet gösterebileceklerdir. Yeme-içme yerleri ile online yemek sipariş firmalarıRamazan ayı sonuna denk gelen13 Mayıs 2021 Perşembe gününe kadar 24 saat esasına görepaket servis yapabilecektir. Yeme-içme yerleri ile online yemek sipariş firmalarıRamazan ayının sona ermesiylebirlikte saat01.00’ekadar paket servis yapabilecektir. 1.4-Tam kapanma döneminde ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri açık olacaktır (Bu iş yerlerinde sadece ekmek ve unlu mamul satışı yapılabilir.). Vatandaşlarımız ekmek ve unlu mamul ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerineyürümemesafesindeolan fırına gidip gelebileceklerdir. Fırın ve unlu mamul ruhsatlı iş yerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallara ekmek servisi yapılabilecek, sokak aralarında kesinlikle satış yapılmayacaktır. 1.5-Sokağa çıkma kısıtlaması sırasında yukarıda belirtilen temel gıda, ilaç ve temizlik ürünlerinin satıldığı yerler ile üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması amacıyla muafiyet kapsamında bulunan iş yerleri dışında tüm ticari işletme, iş yeri ve/veya ofisler kapalı olacak olup uzaktan çalışma haricinde yüz yüze hizmet verilmeyecektir. 1.6-Sokağa çıkma kısıtlaması uygulanacak olan dönemde konaklama tesislerinde rezervasyonunun bulunması vatandaşlarımız açısından sokağa çıkma ve/veya şehirler arası seyahat kısıtlamasından muafiyet sağlamayacak olup bu dönemde konaklama tesisleri sadece zorunlu durumlara bağlı olarak seyahat izin belgesi alan kişilere hizmet verebileceklerdir. 1.7-Yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamakta olup; ikamet izinliler, geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzere turistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar sokağa çıkmakısıtlamalarına tabidirler. 1.8-Tam kapanma sürecinde kendi ihtiyaçlarını karşılayamayacak durumdaki ileri yaş gruplarındaki veya ağır hastalığı olan vatandaşlarımızın112,155ve156numaraları üzerinden bildirdikleri temel ihtiyaçlarıVEFA Sosyal Destek Gruplarıncakarşılanacak olup, bu konuda gerek personel görevlendirilmesi gerekse ihtiyaçların bir an evvel giderilmesi bakımından gerekli tedbirlerValiler ve Kaymakamlar tarafından alınacaktır. 2. Şehirler Arası Seyahat Kısıtlaması Sokağa çıkma kısıtlaması uygulanacak olan 29 Nisan 2021 Perşembe günü saat 19.00’dan 17 Mayıs 2021 Pazartesi günü saat 05.00’e kadar vatandaşlarımızın şehirler arası seyahatlerine zorunlu haller dışında izin verilmeyecektir. 2.1-Şehirler arası seyahat kısıtlamasının istisnaları; Zorunlu bir kamusal görevin ifası kapsamında ilgili Bakanlık ya da kamu kurum veya kuruluşu tarafından görevlendirilmiş olan kamu görevlileri (müfettiş, denetmen vb.) kurum kimlik kartı ile birlikte görev belgesini ibraz etmek kaydıyla bu hükümden muaf tutulacaktır. Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmak için veya cenaze nakil işlemine refakat etmek amacıyla herhangi bir cenaze yakınının e-Devlet kapısındaki İçişleri Bakanlığına aite-BAŞVURUveyaALO 199sistemleri üzerinden yapacakları başvurular (yanında akraba konumundaki 9 kişiye kadar bildirimde bulunabilecektir) sistem tarafından vakit kaybetmeksizin otomatik olarak onaylanarak cenaze yakınlarına gerekli seyahat izin belgesi oluşturulacaktır. Cenaze nakil ve defin işlemleri kapsamında başvuru yapacak vatandaşlarımızdan herhangi bir belge ibrazı istenilmeyecek olup Sağlık Bakanlığı ile sağlanan entegrasyon üzerinden gerekli sorgulama seyahat izin belgesi düzenlenmeden önce otomatik olarak yapılacaktır. 2.2-Zorunlu Hal Sayılacak Durumlar; Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevk olan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, Kendisi veya eşinin, hastanede tedavi gören birinci derece yakınına ya da kardeşine refakat edecek olan (en fazla 2 kişi), Bulunduğu şehre son 5 gün içerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikamet ettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araç plakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ÖSYM tarafından ilan edilmiş merkezi sınavlara katılacak olan, Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, Özel veya kamudan günlü sözleşmeye davet yazısı olan, Ceza infaz kurumlarından salıverilen, Kişilerin zorunlu hali bulunduğu kabul edilecektir. 2.3-Vatandaşlarımız, yukarıda belirtilen zorunlu hallerin varlığı halinde bu durumu belgelendirmek kaydıyla; e-devlet üzerinden İçişleri Bakanlığına aitE-BAŞVURUveALO 199sistemleri üzerinden Valilik/Kaymakamlık bünyesinde oluşturulan Seyahat İzin Kurullarından izin almak kaydıyla seyahat edebileceklerdir. Seyahat İzin Belgesi verilen kişiler seyahat süreleri boyunca sokağa çıkma kısıtlamasından muaf olacaktır. 2.4-Tam kapanma sürecinde seyahat izin taleplerinde yaşanabilecek artış göz önünde bulundurularak Vali ve Kaymakamlarımızca yeterli sayıda personel görevlendirilmesi başta olmak üzere seyahat izin taleplerinin hızlı bir şekilde değerlendirilerek karara bağlanabilmesi için her türlü tedbir alınacaktır. 2.5-Belirtilen dönem içerisinde uçak, tren, gemi veya otobüs gibi toplu ulaşım aracıyla seyahat edecek kişilere biletleme işlemi yapılmadan önce mutlaka seyahat izin belgesinin olup olmadığı kontrol edilecek, geçerli bir seyahat izninin bulunması halinde biletleme işlemi gerçekleştirilecektir. Uçak, tren, gemi veya otobüs gibi toplu taşıma araçlarıyla yapılacak seferlerde yolcuların araçlara kabulü öncesinde HES kodu sorgulaması muhakkak yapılacak ve tanılı/temaslı gibi sakıncalı bir durumun olmaması halinde araca alınacaktır. 2.6-Şehirler arası faaliyet gösteren toplu taşıma araçları (uçak hariç); araç ruhsatında belirtilen yolcu taşıma kapasitesinin %50’si oranında yolcu kabul edebilecekler ve araç içindeki yolcuların oturma şekli yolcuların birbirleriyle temasını engelleyecek (1 dolu 1 boş) şekilde olacaktır. 3.Tam kapanma sürecinde sağlık, güvenlik, acil çağrı gibi kritik görev alanları hariç olmak üzere kamu kurum ve kuruluşlarında hizmetlerin sürdürülebilmesi için gerekli olan asgari personel seviyesine düşülecek (asgari personel seviyesi toplam personel sayısının % 50’sini aşmayacak ölçüde) şekilde uzaktan veya dönüşümlü çalışmaya geçilecektir. Bu dönemde; Uzaktan ve dönüşümlü çalışmaya tabi kamu personeli, herhangi bir özel muafiyete sahip olmamaları nedeniyle diğer vatandaşlarımızın tabi olduğu esaslar haricinde ikametlerinden ayrılmayacaklardır. Kamu kurum ve kuruluşlarının hizmet binalarında/yerlerinde görev alacak kamu personeli için yetkili yönetici tarafından bu durumu ortaya koyan görev belgesi düzenlenecek ve görevli olduğu zaman dilimi içerisinde ikameti ile iş yeri arasındaki güzergahla sınırlı şekilde muafiyete tabi olacaktır. 4.İller arası hareketliliğin zorunlu olduğu mevsimlik tarım işçileri, hayvancılık ve arıcılık faaliyetlerinde salgınla mücadele koşullarına uygun hareket edilebilmesi için Tarım ve Orman Bakanlığının koordinasyonunda valilikler tarafından gerekli tedbirler eş zamanlı olarak alınacak, bu bağlamda mevsimlik tarım işçilerinin iller arası hareketliliği ile konaklayacakları alanlarda alınacak tedbirler ve iller arası hayvancılık ve arıcılık faaliyetleri konusunda Bakanlığımızca yeni bir Genelge yayımlanıncaya kadar 03.04.2020 tarih ve 6202 sayılı Genelgemizde belirlenen esaslara göre hareket edilecektir. 5.Tam gün uygulanacak sokağa çıkma kısıtlaması tedbirinin konut sitelerinde de uygulanmasını temin etmek amacıyla site yönetimlerine sorumluluk verilecek, site içerisinde izinsiz şekilde dışarı çıkan kişilerin (özellikle çocukların ve gençlerin) ikametlerine dönmeleri konusunda uyarılmaları sağlanacaktır. 6.Sokağa çıkma süresi boyunca sokak hayvanlarının beslenmelerine özel önem verilecek, bu kapsamda Vali/Kaymakamlar tarafından yerel yönetimler, ilgili kamu kurum ve kuruluşları ile gerekli koordinasyon tesis edilerek sokak hayvanlarının beslenmeleri için gerekli tedbirler alınacak, bu amaçla başta hayvan barınakları olmak üzere park, bahçe, orman gibi sokak hayvanlarının doğal yaşam alanlarına düzenli olarak mama, yem, yiyecek ve su bırakılması sağlanacaktır. 7. Denetim Faaliyetlerinin Etkinliğinin Artırılması 7.1-Tam kapanma döneminde kolluk kuvvetlerinin tam kapasiteyle denetim faaliyetlerine katılımı sağlanacak, özellikle sokağa çıkma ile şehirler arası seyahat kısıtlamaları başta olmak üzere kolluk kuvvetleri tarafından kapsamlı, geniş katılımlı, etkili ve sürekli denetim faaliyetleri planlanarak uygulamaya geçirilecektir. 7.2-Sokağa çıkma kısıtlamaları sırasında; Muafiyet tanınan iş yerlerinde çalışıldığına dair gerçeğe aykırı belge düzenlenmesi, Özel sağlık kuruluşlarından sahte randevu alınması, Fırın, market, bakkal, kasap, manav, kuruyemişçi veya tatlıcılara çıkış serbestisinin maksadını aşan şekilde kullanımı (markete ailece gidilmesi gibi), Çiftçi Kayıt Belgesinin (ÇKS) amaç dışı kullanılmasıgibi durumlarda muafiyetlerin giderek artan bir sıklıkla kötüye kullanıldığı göz önünde bulundurularak, bu suistimallerin önlenmesi amacıyla kolluk kuvvetleri tarafından her türlü tedbir alınacak ve yapılacak denetimlerde bu hususların kontrolü özellikle sağlanacaktır. 7.3-Şehirler arası seyahat kısıtlamasının etkinliğinin artırılması amacıyla şehirlerin tüm giriş ve çıkışlarında (iller arası koordinasyon sağlanmak kaydıyla) kontrol noktaları oluşturulacak, kontrol noktalarında görevlendirilecek yeterli sayıda kolluk personeli (trafik ve asayiş birimlerinden) marifetiyle toplu ulaşım araçlarıyla veya özel araçlarla yolculuk edenlerin seyahat izin belgelerinin olup olmadığı muhakkak tetkik edilecek ve geçerli bir mazereti/muafiyeti bulunmayan kişilerin şehirler arası seyahatlerine izin verilmeyecektir. 7.4-Tam gün sokağa çıkma kısıtlaması uygulanacak olan tam kapanma döneminde, vatandaşlarımızın sadece temel ihtiyaçlarının giderilmesi amacıyla açık tutulacak fırın, market, bakkal, kasap, manav, kuruyemişçi ve tatlıcı gibi iş yerlerinin çevresinde gerekli kontrollerinyapılabilmesi için yeterli sayıda kolluk personeli görevlendirilecek; yürütülecek devriye ve denetim faaliyetlerinde, bu iş yerlerinin kurallara uyup uymadıkları ile vatandaşlarımızın bu iş yerlerine gidişlerinde araç kullanmama ve ikametlerine en yakın yere gitme kuralına riayet edip etmedikleri kontrol edilecektir. EK: Sokağa Çıkma Kısıtlamasından Muaf Yerler ve Kişiler Listesi Sokağa çıkma kısıtlamalarının uygulanacağı günlerde istisna kapsamında olduğunu belgelemek ve muafiyet nedeni/güzergahı ile sınırlı olmak kaydıyla; 1.TBMM üyeleri ve çalışanları, 2.Kamu düzeni ve güvenliğinin sağlanmasında görevli olanlar (özel güvenlik görevlileri dâhil), 3. Zorunlu kamu hizmetlerinin sürdürülmesi için gerekli kamu kurum ve kuruluşları ile işletmeler (Havalimanları, limanlar, sınır kapıları, gümrükler, karayolları, huzurevleri, yaşlı bakım evleri, rehabilitasyon merkezleri, PTT vb.), buralarda çalışanlar ile ibadethanelerdeki din görevlileri, Acil Çağrı Merkezleri, Vefa Sosyal Destek Birimleri, İl/İlçe Salgın Denetim Merkezleri, Göç İdaresi, Kızılay, AFAD ve afet kapsamındaki faaliyetlerde görevli olanlar ve gönüllü olarak görev verilenler, cemevlerinin dede ve görevlileri, 4.Kamu ve özel sağlık kurum ve kuruluşları, eczaneler, veteriner klinikleri ve hayvan hastaneleri ile buralarda çalışanlar, hekimler ve veteriner hekimler, 5.Zorunlu sağlık randevusu olanlar (Kızılay a yapılacak kan ve plazma bağışları dahil), 6.İlaç, tıbbi cihaz, tıbbi maske ve dezenfektan üretimi, nakliyesi ve satışına ilişkin faaliyet yürüten iş yerleri ile buralarda çalışanlar, 7.Üretim ve imalat tesisleri ile inşaat faaliyetleri ve bu yerlerde çalışanlar, 8.Bitkisel ve hayvansal ürünlerin üretimi, sulanması, işlenmesi, ilaçlanması, hasadı, pazarlanması ve nakliyesinde çalışanlar, 9.Tarımsal üretime ilişkin zirai ilaç, tohum, fide, gübre vb. ürünlerin satışı yapılan iş yerleri ve buralarda çalışanlar, 10.Yurt içi ve dışı taşımacılık (ihracat/ithalat/transit geçişler dâhil) ve lojistiğini yapan firmalar ve bunların çalışanları, 11.Ürün ve/veya malzemelerin nakliyesinde ya da lojistiğinde (kargo dahil), yurt içi ve yurt dışı taşımacılık, depolama ve ilgili faaliyetler kapsamında görevli olanlar, 12.Oteller ve konaklama yerleri ile buralarda çalışanlar, 13.Sokak hayvanlarını besleyecek olanlar, hayvan barınakları/çiftlikleri/bakım merkezlerinin görevlileri/gönüllü çalışanları ve 7486 sayılı Genelgemizle oluşturulan Hayvan Besleme Grubu üyeleri, 14.İkametinin önü ile sınırlı olmak kaydıyla evcil hayvanlarının zorunlu ihtiyacını karşılamak üzere dışarı çıkanlar, 15. Gazete, dergi, radyo, televizyon ve internet medya kuruluşları, medya takip merkezleri, gazete basım matbaaları, bu yerlerde çalışanlar ile gazete dağıtıcıları, 16.Akaryakıt istasyonları, lastik tamircileri ve buralarda çalışanlar, 17.Sebze/meyve ve su ürünleri toptancı halleri ile buralarda çalışanlar, 18.Ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri, üretilen ekmeğin dağıtımında görevli olan araçlar ile buralarda çalışanlar, 19.Cenaze defin işlemlerinde görevli olanlar (din görevlileri, hastane ve belediye görevlileri vb.) ile birinci derece yakınlarının cenazelerine katılacak olanlar, 20. Doğalgaz, elektrik, petrol sektöründe stratejik olarak faaliyet gösteren büyük tesis ve işletmeler (rafineri ve petrokimya tesisleri ile termik ve doğalgaz çevrim santralleri gibi) ile bu yerlerde çalışanlar, 21.Elektrik, su, doğalgaz, telekomünikasyon vb. kesintiye uğramaması gereken iletim ve altyapı sistemlerinin sürdürülmesi ve arızalarının giderilmesinde görevli olanlar ile servis hizmeti vermek üzere görevde olduklarını belgelemek şartı ile teknik servis çalışanları, 22.Kargo, su, gazete ve mutfak tüpü dağıtım şirketleri ve çalışanları, 23.Mahalli idarelerin toplu taşıma, temizlik, katı atık, su ve kanalizasyon, karla mücadele, ilaçlama, itfaiye ve mezarlık hizmetlerini yürütmek üzere çalışacak personeli, 24.Şehir içi toplu ulaşım araçlarının (metrobüs, metro, otobüs, dolmuş, taksi vb.) sürücü ve görevlileri, 25.Yurt, pansiyon, şantiye vb. toplu yerlerde kalanların gereksinim duyacağı temel ihtiyaçların karşılanmasında görevli olanlar, 26.İş sağlığı ve güvenliği ile iş yerlerinin güvenliğini sağlamak amacıyla iş yerlerinde bulunması gerekli olan çalışanlar (iş yeri hekimi, güvenlik görevlisi, bekçi vb.), 27.Otizm, ağır mental retardasyon, down sendromu gibi “Özel Gereksinimi” olanlar ile bunların veli/vasi veya refakatçileri, 28.Mahkeme kararı çerçevesinde çocukları ile şahsi münasebet tesis edecekler (mahkeme kararını ibraz etmeleri şartı ile), 29.Yurt içi ve yurt dışı müsabaka ve kamplara katılacak olan milli sporcular ile seyircisiz oynanabilecek profesyonel spor müsabakalarındaki sporcu, yönetici ve diğer görevliler, 30.Bankalar başta olmak üzere yurt çapında yaygın hizmet ağı olan kurum, kuruluş ve işletmelerin bilgi işlem merkezleri ile çalışanları (asgari sayıda olmak kaydıyla), 31.ÖSYM tarafından ilan edilmiş merkezi sınavlara katılacağını belgeleyenler (bu kişilerin yanlarında bulunan eş, kardeş, anne veya babadan bir refakatçi) ile sınav görevlileri, 32.İl/İlçe Umumi Hıfzıssıhha Kurullarınca izin verilen, şehirler arası karayolları kenarında bulunan dinleme tesislerinde yer alan yeme-içme yerleri ve buralarda çalışanlar, 33.Zorunlu müdafi/vekil, duruşma, ifade gibi yargısal görevlerin icrasıyla sınırlı kalmak kaydıyla avukatlar, 34.Dava ve icra takiplerine ilişkin yapılacak zorunlu iş ve işlemler için adliyelere gitmesi gereken taraf veya vekilleri (avukat) ile mezat salonlarına gidecek ilgililer, 35.Araç muayene istasyonları ve buralarda çalışan personel ile araç muayene randevusu bulunan taşıt sahipleri, 36.Milli Eğitim BakanlığıEBA LİSE TV MTALveEBAplatformunda yayınlanmak üzere Bakanlığa bağlı mesleki ve teknik ortaöğretim okul/kurumlarında çalışmaları devam eden uzaktan eğitim video çekimi, kurgu ve montaj faaliyetlerini yürütmekte olan ya da söz konusu çalışmaların koordinasyonunu sağlayan personel, 37.Profesyonel site yöneticileri ile apartman/site yönetimince düzenlenen görevli olduklarına dair belgeyi ibraz etmek ve ikametleriyle görevli oldukları apartman veya sitelere gidiş-geliş güzergâhıyla sınırlı olmak kaydıyla apartman ve sitelerin temizlik, ısınma vb. işlerini yerine getiren görevliler, 38.İş yerinde bulunan hayvanların günlük bakım ve beslenmelerini yapabilmek için ikamet ile iş yeri arasındaki güzergâh ile sınırlı olmak kaydıyla evcil hayvan satışı yapan iş yerlerinin sahipleri ve çalışanları, 39.Sadece yarış atlarının bakım ve beslenmelerini ve yarışlara hazırlık antrenmanlarını yapmak ve ikamet ile yarış ya da antrenman alanı arasındaki güzergâhla sınırlı kalmak kaydıyla at sahipleri, antrenörler, seyisler ve diğer çalışanlar, 40.Sadece ilaçlama faaliyetleri için zorunlu olan güzergâhlarda kalmak ve bu durumu belgelemek kaydıyla iş yerlerinin haşere ve diğer zararlı böceklere karşı ilaçlamasını yapan firmalarda görevli olanlar, 41.Muafiyet nedenine bağlı olmak ve ikametlerinden iş yerlerine gidiş/gelişleri ile sınırlı olmak kaydıyla serbest muhasebeciler, serbest muhasebeci mali müşavirler, yeminli mali müşavirler ile çalışanları, 42.10.00-16.00 saatleri arasında sayıları banka yönetimlerince belirlenecek şekilde sınırlı sayıda şube ve personel ile hizmet verecek olan banka şubeleri ile çalışanları, 43.Nöbetçi noterler ile buralarda çalışanlar.
KOSGEB Desteği Webinarı
Sayın Üyemiz, KOSGEB in "Ar-Ge, Ür-Ge ve İnovasyon Destek Programı"nın açık çağrısı hakkında 28 Nisan 2021 Çarşamba günü saat: 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. KOSGEB ve TOBB işbirliğinde gerçekleştirilecek olan seminerde ekli davette yer alan tabloda bulunan hedef sektörlerde ve uygun proje konularında işletme büyüklüğüne göre 6 Milyon TL ye kadar geri ödemesiz destek sağlayan "Ar-Ge, Ür-Ge ve İnovasyon Destek Programı" anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB UYUM - OSBÜK iş birliği protokol töreni
Sayın Üyemiz, Organize Sanayi Bölgeleri Üst Kuruluşu ve TOBB UYUM Arabuluculuk Uyuşmazlık ve Çözüm Merkezi arasında 29 Nisan 2021 Perşembe günü saat 11:00 de iş birliği protokolü imzalanacaktır. İnternet üzerinden katılımın mümkün olduğu protokol imza törenine ilişkin davet ekte sunulmaktadır. Törende öncelikle TOBB UYUM un kuruluş amacı, TOBB UYUM un hizmetleri ve OSBÜK - TOBB UYUM işbirliği hakkında sunum yapılacak ardından karar alma süreçlerinde üst kuruluşların rolü değerlendirilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Ödeneği Haziran Sonuna Kadar Sürecek
Sayın Üyemiz, Cumhurbaşkanı Recep Tayyip Erdoğan, kısa çalışma ödeneği uygulamasının Haziran ayı sonuna kadar devam edeceğini açıkladı. Erdoğan, turizm sektöründe de mayısta sona erecek KDV indirimini bir ay daha uzatıldığını duyurdu. İş dünyasının talep ettiği kısa çalışma ödeneğinde beklenen adım atıldı ve süre uzatıldı. Cumhurbaşkanı Recep Tayyip Erdoğan, tüm sektörler için geçerli olmak üzere Nisan, Mayıs, Haziranı kapsayacak şekilde kısa çalışma ödeneği uygulamasının devam ettirileceğini açıkladı. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Slovak Matchmaking Fair 2021
Sayın Üyemiz, Slovakya Ekonomi Bakanlığı nın himayelerinde,25-26 Mayıs 2021 tarihlerinde ZOOM da "Slovak Eşleştirme Fuarı (Slovak Matchmaking Fair 2021)"nıngerçekleştirileceği bildirilmektedir. Bahsi geçen fuarın, Slovak ve yabancı katılımcıların bir araya gelerek ikili görüşmeler gerçekleştirmesi,potansiyel iş ortaklıkları ve yeni temaslar kurma noktasında etkili bir araç olması sebebiyle Slovakya nınönemli bir etkinliği olarak görüldüğü belirtilmektedir. İş insanlarının, potansiyel ortaklarıyla, hükümet temsilcileri ve Slovak Ticaret ve Yatırım Ajansı yetkilileriylegörüşme fırsatı yakalayabileceği söz konusu etkinliğin detaylı bilgileri ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Çiğ Süte 2 Yıllık Destekleme Kararı
Sayın Üyemiz, Çiğ süt desteği ve süt piyasasının düzenlenmesine ilişkin Cumhurbaşkanı Kararı Resmi Gazete de yayınlanarak yürürlüğe girdi. Karara göre, 2021 ve 2022 de destekler çiğ süt sınıflandırmasına göre ödenecek. Et ve Süt Kurumu nun üretici örgütleri üzerinden çiğ sütü süt tozuna dönüştürmesi de destekleme kapsamında olacak. Desteklemeden kimler yararlanacak? 1- Tarım ve Orman Bakanlığının belirleyeceği dönemler, kriterler ve birim fiyatlar üzerinden çiftçilere çiğ süt destekleme ödemesi yapılacak. 2- Desteklemeden üretmiş olduğu çiğ sütü, süt işleme tesislerine satan ve bir üretici örgütüne üye olan yetiştiriciler yararlanacak. 3- Manda, inek, koyun ve keçi sütü, soğutulmuş inek sütü, üretici örgütleri kanalı ile pazarlanan soğutulmuş inek sütü destekleme kapsamında olacak. 4- Çiğ inek sütü desteklemesi, protein ve yağ değerine göre yapılan A,B,C sınıflamasına göre ödenecek. 5- Üretmiş olduğu çiğ sütü, süt piyasasının düzenlenmesi uygulaması kapsamında, üretici örgütleri aracılığı ile süt ürününe(süt tozu) çevirterek Et ve Süt Kurumu Genel Müdürlüğü (ESK)’ne satan üreticiler çiğ süt desteklemesinden yararlandırılacak. 6- Hastalıktan ari işletme belgeli süt üreten işletmeler, ürettikleri çiğ sütü, faaliyet alannda sütün arzı/satışı bulunan işletme kayıt belgesine sahip ve Bakanlık Süt Kayıt Sistemine kayıtlı yerel perakendecilere, işletme kayıt belgesine sahip Bakanlık Süt Kayıt Sistemine kayıtlı süt dolum tesislerine fatura/müstahsil makbuzu karşılığında satmaları şartıyla çiğ süt desteklemesinden yararlandırılacak. 7-Ürettiği çiğ sütü, Dijital Tarım Pazarı (DİTAP) üzerinden doğrudan veya üyesi olduğu üretici/yetiştirici örgütü üzerinden satan üreticilere Bakanlığın belirleyeceği dönemler, kriterler ve birim fiyatlar üzerinden ilave destekleme ödemesi yapılacak. Çiğ süt piyasasının düzenlenmesi Çiğ süt piyasasının düzenlenmesi uygulamasında, Et ve Süt Kurumu tarafından yapılan alım ve satım arasında oluşacak fark, hayvancılık destekleme bütçesinden karşılanacak. Üretici örgütleri için yüzde 3 kesinti Çiğ sütü toplayan, pazarlayan üretici örgütlerine desteğin yüzde 3 ü "çiftçi örgütlerini güçlendirme" amacıyla ödendikten sonra kalan miktar çiftçiye ödenecek. Ödemeler nasıl olacak? Destek ödemeleri, Tarım ve Orman Bakanlığının 2021-2022 yılları bütçesinde hayvancılık desteklemeleri için ayrılan ödenekten sağlanacak. 2022 yılından kalan ödemeler 2023 bütçesinden hayvancılık desteklemeleri için ayrılacak ödenekten sağlanacak. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Pandemi Kurallarına Uygun 23 Nisan Kutlamaları Genelgesi
Sayın Üyemiz, T.C. İçişleri Bakanlığından yapılan açıklamada; 81 İl Valiliği nePandemi Kurallarına Uygun 23 Nisan Kutlamaları Genelgesi gönderildi. Genelgeye göre; 23 Nisan Ulusal Egemenlik ve Çocuk Bayramıresmi tatil olması dolayısıyla bu hafta sonuna özel sokağa çıkma kısıtlaması22 Nisan Perşembe günü saat 19.00’dabaşlayacak. Cuma, cumartesi, pazar günlerinin tamamını kapsayacak sokağa çıkma kısıtlaması,26 Nisan Pazartesi günü saat 05.00’tesona erecek. Daha önce genelge ile belirtilenSokağa Çıkma Kısıtlamasından Muaf Yerler ve Kişiler Listesiaynen geçerli olacak. Hafta sonu 10.00 - 17.00 saatleri arasında açık olan bakkal, market, kasap, manav ve kuruyemişçi ile şehirlerarası seyahat kısıtlamasına dair usul ve esaslar 23 Nisan Cuma günü de birebir uygulanacak. Türkiye Büyük Millet Meclisi, Anıtkabir ve Birinci Meclis’te gerçekleştirilecek tören ve kutlamalar dışında tüm il ve ilçelerde Ulusal Egemenlik ve Çocuk Bayramı aşağıdaki esaslara göre kutlanacak. Milli Eğitim Bakanlığı nın 06.04.2021 tarih ve 23672112 sayılı yazısı doğrultusunda çelenk sunma törenleri fiziki mesafe koşullarına uygun şekilde asgari düzeyde katılımla gerçekleştirilecek. Çelenk sunma törenleri dışında kişilerin bir araya gelmesine neden olabilecek kutlama programları yapılmayacak. Bunun yerineUlusal Egemenlik ve Çocuk Bayramının coşkusunu yansıtabilecek başta kolluk araçlarından oluşmak üzere araç konvoyları, ses, ışık ve havai ışık gösterileri, mobil araçlarla gösteriler ile çevrimiçi etkinliklere ağırlık verilecek. Ulusal Egemenlik ve Çocuk Bayramı kutlama törenlerinde görevli olan kişiler de tören ve kutlama programları süresi ile sınırlı olmak kaydıyla sokağa çıkma kısıtlamalarından muaf tutulacak. Bu esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27 nci ve 72 nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararları ivedilikle alınacak. Bilgisi yeralmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Et ve Süt Kurumu Hayvansal Yağ Satışı
Sayın Üyemiz, Et ve Süt Kurumu Sincan Et Kombinasından Borsamıza gelen yazıda; Kombinamızın stoklarında insani gıda özelliğini kaybeden, 5.187 kg sığır böbrek yağı, 24.868 kgsığır iç yağı ve 36.554 kg sığır kavurma bulunmaktadır. İnsani tüketim amacı dışında kullanılmak üzeresöz konusu emtiların birim fiyat teklifi toplanarak satışı yapılacaktır. İnsani gıda tüketimi dışında kullanılmak üzere satışı yapılacak ürünler için birim fiyat teklifleri07.05.2021 günü mesai saati sonuna kadar Sincan Et Kombinası Müdürlüğü ne elden yada kargo ilekapalı zarf içinde vereceklerdir. Satış yapılmadan önce alınan ürünün insani gıda olarak kullanılmayacağına dair noter tasdiklitaahhütname istenecektir. Satılacak yağlar ve kavurmalar ile ilgili ekteki listede gönderilen miktarlarınhepsine yada bir kısmına teklif verilebilecektir. Teklifler Genel Müdürlüğümüz tarafındandeğerlendirilecektir. Birim fiyat teklifi uygun görülen firma/şahıs peşin bedel veya kredi kartı tek çekim olarakverilen süre içerisinde söz konusu emtiaları Sincan Et Kombina sından teslim alacaklardır. Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Pandemi Döneminde Türk-Alman Ekonomik İlişkileri
Sayın Üyemiz, Türkiye ve Almanya arasındaki ilişkiler uzun bir geçmişe dayanmaktadır. İki ülke arasında var olan gerek ekonomik ilişkiler, gerekse insani ilişkiler özellikle son yarımasırda kat kat artmış bulunmaktadır. Pandeminin hayatımızı değiştirmesi, Almanya ile Türkiye arasındaki ticari ilişkilere de etki etmiş ve birçok iş insanının akıllarında farklı soruların ortaya çıkmasına sebep olmuştur. Pandeminin dünya çapında getirdiği sorunlarla birlikte, ikili ilşikilerde güncel durum nasıl değişmiştir? İki ülke arasındaki karşılıklı yatırımların cazibesi artmış mıdır, ya da Pandemi dönemi karşılıklı yeni frırsatlar yaratmış mıdır? Türk kökenli iş insanları, hangi koşullar altında Alman pazarına açılabilmekte ve iş takibi açısından Almanya için vize ya da oturum izni alabilmektedirler? Türkiye pazarına girmek, Alman iş insanları için ne tür avantajlar getirmektedir? Türk ve Alman iş insanları için hangi alanlarda iş birliği potansiyelleri mevcuttur? Düzce Ticaret ve Sanayi Odasıile birlikte22 Nisan 2021tarihindeTSİ 11:00’de (DE 10:00)gerçekleştireceğimiz web seminerimizde ele alacağımız bu ve benzeri konuları dinlemek üzere Sizleri de etkinliğimize içtenlikle davet ediyoruz. Ayrıntılı program için ekte ki dosyaya (2. sayfa) bakınız. Katılmak için bir zoom hesabına ihtiyacınız olacaktır. Eğer yoksahttps://zoom.us/signuplinki üzerinden ücretsiz ve kolayca sadece e-posta adresi ile kaydolabilirsiniz. Katılmak için lütfen seminerimize kaydolun:https://bit.ly/3mEo7Eo Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hayvancılık İşletmelerine İyi Tarım Uygulamaları Zorunluluğu
Sayın Üyemiz, Tarım ve Orman Bakanlığı, tarımsal faaliyetlerden kaynaklanan nitrat kirliliğinin önlenmesine yönelik tebliğde düzenlemeye gitti. Bakanlık’ın hazırladığı “Sularda Tarımsal Faaliyetlerden Kaynaklanan Nitrat Kirliliğinin Önlenmesine Yönelikİyi TarımUygulamaları Kodu Tebliğinde Değişiklik Yapılmasına Dair Tebliğ” Resmi Gazete’de yayımlandı. 11 Şubat 2024 tarihinde itibaren geçerli olmak üzere yürürlüğe giren tebliğe “nitrat eylem planı” eklendi.İyi tarımuygulamaları kodu nitrata hassas bölgelere özgü hazırlanan nitrat eylem planları ile uygulanacak. Tebliğ kapsamında yürürlüğe girecek olan değişikliklere göre, nitrata hassas bölgelerde, yılda 1600 kilogram ve üzeri azot üretenhayvancılıkişletmeleri hayvansal gübre deposu ve hayvansal gübre yönetim planı; yeter gelirli tarımsal arazi büyüklüğüne sahip tarımsal işletmeler ise gübreleme planı yapmakla yükümlü olacak. Bu bölgelerde, yılda 1600 kilogramdan az azot üretenhayvancılıkişletmeleri için hayvansal gübre deposu ve hayvansal gübre yönetim planına yönelik hükümlerin uygulanması zorunlu olmayıp gönüllülük esas alınacak ancak bu işletmeler, diğer tüm hükümleri uygulamakla yükümlü olacak. Tebliğe göre, hayvansal gübre deposu, hayvansal gübre yönetim planı ve/veya gübreleme planı yapacak tarımsal işletmeler il/ilçe müdürlükleri tarafından belirlenecek. HİBE VE TEŞVİKLE KURULACAK İŞLETMELER Nitrata hassas ve hassas olmayan bölgelerde ise yılda 1600 kilogram ve üzeri azot üretme kapasitesine sahip olarak kurulacakhayvancılıkişletmeleri ile yıllık ürettikleri azot miktarına bakılmaksızın hibe, destek, teşvik ve düşük faizli kredi kullanılarak kurulacakhayvancılıkişletmeleri,iyi tarımuygulamaları koduna uyumlu olarak planlanacak. Tarımsal işletmeleriniyi tarımuygulamaları koduna uygunluğu il/ilçe müdürlüğü tarafından değerlendirilecek. ÜÇ YILDAN AZ ZAMAN KALDI Tebliğ kapsamındaiyi tarımuygulamaları koduna uymakla yükümlü olan ve bu maddenin yürürlüğe girdiği tarih itibarıyla faaliyet gösterenhayvancılıkişletmeleri, 11 Şubat 2024 tarihine kadar iyi tarım uygulamaları koduna uyum sağlamak zorunda olacak. Resmi Gazetedeki ayrıntılara ulaşmak için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
"Petrol Endüstrisinde Millî Teknolojiler (PEMT)" Toplantısı Daveti
Sayın Üyemiz, Türkiye Cumhuriyeti Enerji ve Tabii Kaynaklar Bakanlığı’nın destekleri ve Türkiye Petrolleri Anonim Ortaklığı (TPAO) ev sahipliğinde, 10 Şubat 2020 tarihinde ilki düzenlenen "Petrol Endüstrisinde Millî Teknolojiler (PEMT)" Toplantısı bu yıl 20-21 Nisan 2021 tarihlerinde, pandemi koşulları nedeniyle dijital bir platform üzerinden düzenlenecektir. PEMT’21 Toplantısı ile petrol - doğal gaz arama ve üretim sektörü kapsamında yerli sanayinin ‘Millî Enerji ve Maden Politikası’nın bir parçası haline dönüştürülmesi, yüksek katma değerli mal / hizmet / teknoloji üretimine katkıda bulunulması ve paydaşların buluşturularak, yol haritası oluşturulmasına öncülük edilmesi hedeflenmektedir. Bu çerçevede; TPAO’nun yerli hizmet / ürün / teknoloji kullanımını artırma hedefi doğrultusunda, yerli tedarikçileri sektöre kazandırmak, karşılaşılan sorunlar karşısında alternatifli özgün çözümler geliştirilmesini sağlamak, faaliyetler ve tedarik süreçlerine ilişkin gerekli bilgilendirmeleri yaparak, işbirlikleri açısından fırsatlar yaratmak amaçlanmaktadır. Toplantı programına ve toplantıya ait diğer detaylara ekte sunulan e-davetiye, program veya ilgili web sitesiwww.pemt.com.tr<https://imsva91-ctp.trendmicro.com:443/wis/clicktime/v1/query?url=http%3a%2f%2fwww.pemt.com.tr&umid=D3ED0275-BFDF-0D05-949C-41FCA6EB8875&auth=b2fe8baccee5dc4fab1d34394afd8998ce5605da-f122f8a7e9f30ed25be859e64914a2f2af0c7bdc> aracılığıyla ulaşılabilir. Toplantıya katılım ücretsiz olup, web sitesi üzerinden kayıt yaptırılması (http://www.pemt.com.tr/kayit-ol/<https://imsva91-ctp.trendmicro.com:443/wis/clicktime/v1/query?url=http%3a%2f%2fwww.pemt.com.tr%2fkayit%2dol%2f&umid=D3ED0275-BFDF-0D05-949C-41FCA6EB8875&auth=b2fe8baccee5dc4fab1d34394afd8998ce5605da-8515c01eb65a0563a3a27bcdc4fb4ba9450e0058>) gerekmektedir. Kayıt altına alınan e-posta adreslerine, toplantı öncesinde, katılım için gerekli şifreler iletilecektir. Programa ilişkin her tür sorularınız için aşağıdaki iletişim bilgileri üzerinden temas sağlayabilirsiniz. pemt@tpao.gov.tr<mailto:pemt@tpao.gov.tr> /pemt.tpao@gmail.com<mailto:pemt.tpao@gmail.com> 0312 207 30 11 / 0533 789 68 68 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM 1.164,84 Ton Buğday Satışı
Sayın Üyemiz, 22.04.2021 günü saat 10:00 da Şanlıurfa Ticaret Borsasında işletmemize ait 2020 yılı istihsali1.164,84 ton mahsul buğdayınsatış tekrarıiçin açık artırma usulü satış ihalesi yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan "İşyeri Açma ve Çalışma Ruhsatlarına İlişkin " Yönetmelikte Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede Yayınlanan "İşyeri Açma ve Çalışma Ruhsatlarına İlişkin " Yönetmelikte Değişiklik yayınlanarak yürürlüğe girmiştir. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari Para Cezalarının Hesaplanmasına Dair Yönetmelik
Sayın Üyemiz, 16 Nisan 2021 Tarihli ve 31456 Sayılı Resmi Gazetede yayımlanan Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari Para Cezalarının Hesaplanmasına Dair Yönetmelikte; Veteriner Hizmetleri, Bitki Sağlığı, Gıda ve Yem Kanununun 24 üncü maddesinin dördüncü fıkrası uyarınca gıda ve yemde taklit ve tağşiş fiillerine yönelik yaptırımların uygulanmasına ilişkin usul ve esaslar düzenlenmektedir. İlgili yönetmeliğe ulaşmak için; https://www.resmigazete.gov.tr/eskiler/2021/04/20210416-2.htm Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tarım Römorkları İmalatı/İthalatı
Sayın Üyemiz, T.C. Sanayi ve Teknoloji Bakanlığı ndan alınan tarım römorku imalatı / ithalatı alanında faaliyet gösteren üyelerin yıl içerisinde Bakanlıkça gerçekleştirilmesi planlanan PGD faaliyetleri kapsamında yükümlülükleri hakkındaki yazı ektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Balıkesir Temalı Ürün Tasarım Yarışması
Sayın Üyemiz, Eskişehir Valiliğinden Borsamıza gönderilen yazıda; Balıkesir Büyükşehir Belediye Başkanlığı Kültür ve Sosyal İşler Dairesi Başkanlığıtarafından "Balıkesir Temalı Ürün Tasarım Yarışması" yapılacağı ilgi yazı ile duyurulmuştur. Bilgisi yer almaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ceylanpınar Tarım İşletmesi Müdürlüğü’ne Ait 24.500 Kg Mahsul Fıstık Satış Tekrarı
Sayın Üyemiz, TİGEM Ceylanpınar işletmesinden Borsamıza gelen yazıda,21.04.2021 günü saat 10:30 da Şanlıurfa Ticaret Borsası merkez binasında işletmemize ait 2019-2020 yılı istihsali24.500 kg mahsul fıstık içinaçık artırma usulü satış tekrarı ihalesi yapılacaktır. ihale ile ilgili evraklar www.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır.Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Damızlık Düve Yetiştiriciliğinin Desteklenmesine İlişkin Uygulama Esasları Tebliğinde Yapılan Değişiklik
Sayın Üyemiz, MADDE 1 –3/10/2016 tarihli ve 29846 sayılı Resmî Gazete’de yayımlanan Damızlık Düve Yetiştiriciliğinin Desteklenmesine İlişkin Uygulama Esasları Tebliği (Tebliğ No: 2016/39)’ne aşağıdaki geçici madde eklenmiştir.“Devam eden işlerde süre uzatımı GEÇİCİ MADDE 1 –(1) Bu Tebliğ kapsamında desteklenen işletmelerden Dünya Sağlık Örgütü tarafından pandemi ilan edilen Covid-19 salgını nedeniyle hayvan temininde yaşanan güçlükler sonucu belirlenmiş kapasitelerinin altına düşmüş olanlar kapasitelerine ulaşmalarına ve eksiklerini gidermelerine imkân sağlamak üzere bu maddenin yayımı tarihinden itibaren 30 gün içerisinde müracaat etmeleri halinde, ilave taahhütname vermeleri kaydıyla 12 nci madde hükümlerince belirlenen taahhüt süreleri 7 yıla çıkarılır.” MADDE 2 –Bu Tebliğ yayımı tarihinde yürürlüğe girer. MADDE 3 –Bu Tebliğ hükümlerini Tarım ve Orman Bakanı yürütür. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ceylanpınar Tarım İşletmesi Müdürülüğü Ne Ait 16.500 Kg Mahsul Badem Satışı
Sayın Üyemiz, TİGEM Ceylanpınar işletmesinden Borsamıza gelen yazıda, 21.04.2021 günü saat 10:00 da Şanlıurfa Ticaret Borsası merkez binasında işletmemize ait 2020 yılı istihsali16.500 kg mahsul badem satışıiçin açık artırma usulü satış tekrarı ihalesi yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sınıf Dana Karkas Arka Çeyrek (But) Alım İşi
Sayın Üyemiz, Et ve Süt Kurumundan Borsamıza gönderilen yazıda; Müdürlüğümüzce e-ihale ile 4734 sayılı Kamu İhale Kanununun 3-g maddesi (istisna)kapsamında; malın bedeli mal tesliminden sonraki 14 iş günü içerisinde ödenmek kaydıyla, Ek-1 de kiteknik şartnameye uygun olarak 65.000 kg Mezbuh Taze Soğutulmuş 1. Sınıf Dana Karkas Arka Çeyrek(but) et alımı yapılması planlanmaktadır. İstekliler, 14.04.2021 Çarşamba saat 16.00 a kadar Et ve Süt Kurumu Sincan Et KombinasıMüdürlüğü / Vakıflar Bankası / Çetinemeç Şubesi IBAN NO: TR84 0001 5001 5800 7293 6199 08numaralı hesaba nakit olarak veya geçici teminat mektubunu yaklaşık ihale bedeli üzerinden % 3 olanbedeli 79,100,00 TL nin altında olmamak kaydıyla geçici teminatlarını vermeleri gerekmektedir.Sözleşme, ekonomik açıdan en avantajlı teklif veren firma ile imzalanacaktır. Sözleşme yapılacakolan firma teklif ettiği bedeli ile 65.000 kg ın çarpımı sonucu ortaya çıkan tutarın %6 sı oranında 3 aysüreli teminat mektubu veya nakit para verecek, ihaleyi alan yüklenici firma sözleşme bedeli üzerindenkarar pulu (binde 5,69) ve damga vergisi (binde 9,48) yatıracaktır.Söz konusu alım işiyle ilgili ihaleye katılmak istemeniz halinde yazımız ekindeki teknikşartnameyi ve sözleşmeyi göz önünde bulundurarak ekte belirtilen belge ve dökümanları 14.04.2021Çarşamba tarihi saat 16:00 a kadar gerek görüldüğünde aslını ibraz etmek kaydıylamgultekin.gulhan@esk.gov.tr mail adresine mail olarak iletmeniz veya Et ve Süt Kurumu Sincan EtKombinası Müdürlüğü ne ulaştırmanız gerekmektedir.Zamanında gönderilmeyen, belge ve dökümanları eksik olan firmalar ihaleye katılamayacaklardır. Bilgisi yer almaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
81 İl Valiliğine Kısmi Kapanma Genelgesi Gönderildi
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl ValiliğineKısmi KapanmaGenelgesigönderildi. Genelgede, salgınla mücadele sürecinin temel prensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemler; Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun önerileri, Cumhurbaşkanımız Sn. Recep Tayyip Erdoğan’ın talimatları doğrultusunda belirlenerek uygulamaya geçirildiği belirtildi. Genelgede, mutasyona uğrayan Covid-19 virüsünün dünya genelinde hastalığın yayılımını artırdığı, Türkiye’de de özellikle İngiltere varyantı sebebiyle günlük vaka, yoğun bakım ve entübe hasta sayılarında hızlı bir artış yaşandığı ifade edildi. Genelgede 12.04.2021 tarihinde Cumhurbaşkanımız Sn. Recep Tayyip Erdoğan başkanlığında toplanan Cumhurbaşkanlığı Kabinesinde alınan kararlar doğrultusunda14 Nisan 2021 Çarşamba günü saat 19.00’dan itibarenülke genelini kapsayacak şekilde iki haftalık kısmi kapanmaya yönelik alındığı belirtilerek, alınan tedbirler şu şekilde sıralandı: 1. Hafta içerisinde yer alan günlerde (Pazartesi, Salı, Çarşamba, Perşembe ve Cuma) 19.00-­05.00 saatleri arasında, hafta sonları ise Cuma günleri saat 19.00’da başlayıp, Cumartesi ve Pazar günlerinin tamamını kapsayacak ve Pazartesi günleri saat 05.00’de tamamlanacak şekilde sokağa çıkma kısıtlaması uygulanacak. 1.1-Sokağa çıkma kısıtlaması uygulanan süre ve günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamak amacıyla belirtilen Ek’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacak. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler,daha önce illerimize gönderilen genelgemizle açıkça belirtildiği şekilde muafiyet nedenine ve buna bağlı olarak zaman ve güzergâh ile sınırlı olup, aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konu edilecek. Öte yandan yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamayacak. İkamet izinliler, geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzere turistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar, sokağa çıkma kısıtlamalarına tabi olacak. 1.2-Sokağa çıkma kısıtlamasının olduğuCumartesi ve Pazar günleri market, bakkal, manav, kasaplar ve kuruyemişçiler 10.00-17.00 saatleri arasında faaliyet gösterebilecek. 65 yaş ve üzeri ile 18 yaş altında bulunanlar hariç,zorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın market, bakkal, manav, kasap ve kuruyemişçilere gidip gelebilecek. Aynı saatler arasında market, bakkal, manav, kasap, kuruyemişçiler ve online sipariş firmaları evlere/adrese servis şeklinde de satış yapabilecek. 1.3-Sokağa çıkma kısıtlamasının olduğu Cumartesi ve Pazar günleri ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri açık olacak. (Bu iş yerlerinde sadece ekmek ve unlu mamul satışı yapılabilecek.). 65 yaş ve üzeri ile 18 yaş altında bulunanlar hariç ekmek ve unlu mamul ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine yürüme mesafesinde olan fırına gidip gelebilecek. Ramazan ayı süresince iftar saati ve hemen öncesinde oluşabilecek pide kuyrukları ve yoğunluğun oluşturacağı riskin önlenmesi amacıyla fırınlardaki özel sipariş üretimi de dahil pide ve ekmek üretimi iftardan 1 saat önce sonlandırılacak ve iftar saatine kadar sadece satış yapılabilecek. İftardan sonra fırınlarda üretim, satış ve diğer hazırlık işlemlerine devam edilebilecek. Fırın ve unlu mamul ruhsatlı işyerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallara ekmek servisi yapılabilecek, ekmek dağıtım araçlarıyla sokak aralarında kesinlikle satış yapılmayacak. 1.4-Sokağa çıkma kısıtlamasındaki sürelere uymak için tüm işyerlerinin (istisna getirilenler hariç) çalışma saatleri hafta içi günlerde 07.00-18.00 saatleri arası olarak belirlenecek. Zincir marketler ise saat 10.00’da açılacak. 2.Hafta içi günlerde;65 yaş ve üzeri vatandaşlarımız 10.00-14.00, 18 yaş altı gençler ve çocuklarımız ise 14.00-18.00 saatleri arasında sokağa çıkabilecekolup, bu saat aralıkları dışında sokağa çıkmayacak. Hafta içi/hafta sonu ayrımı olmaksızın 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımızın şehir içi toplu ulaşım araçlarını (metro, metrobüs, otobüs, minibüs, dolmuş vb.) kullanmalarına müsaade edilmeyecek. Milli Eğitim Bakanlığınca yüz yüze eğitimin devamına karar verilen sınıf seviyeleri ile destekleme ve yetiştirme kursları/takviye kurslarında eğitim gören 18 yaş altı gençlerimiz, durumlarını belgelendirmeleri şartıyla toplu ulaşım araçlarından istifade edebilecek. 3. Sokağa çıkma kısıtlaması uygulanan süre ve günlerde (hafta içi ve hafta sonunda) zorunlu haller dışında vatandaşlarımızın toplu ulaşım vasıtaları dışında şehirlerarası seyahatlerine izin verilmeyecek. 3.1-Herhangi bir zorunlu hali bulunmayan kişilerin sokağa çıkma kısıtlaması uygulanan süre ve günlerdeki şehirlerarası seyahatleri ancak toplu ulaşım araçları (uçak, otobüs, tren, gemi vb.) kullanılmak suretiyle mümkün olacak. İşi ile ilgili illiyetini belgeleyen toplu ulaşım araçlarının görevlileri ile şehirlerarası seyahat edeceğini bilet, rezervasyon kodu vb. ile ibraz eden kişiler sokağa çıkma kısıtlamasından muaf olacak. 3.2-Zorunlu Haller Sayılacak Durumlar; Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevk olan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmak için veya cenaze nakil işlemine refakat edecek olan (en fazla 8 kişi), Bulunduğu şehre son 5 gün içerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikamet ettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araç plakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ÖSYM tarafından ilan edilen ve diğer merkezi sınavlara katılacaklar ve refakatçileri, Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, Özel veya kamudan günlü sözleşmeye davet yazısı olan, Ceza infaz kurumlarından salıverilen, Belirtilen bu durumların varlığı halinde toplu ulaşım araçlarıyla veya İçişleri Bakanlığına ait E-BAŞVURU ve ALO 199 sistemleri üzerinden ya da Valilik/Kaymakamlıklara doğrudan başvuru yoluyla Seyahat İzin Kurullarından izin almak kaydıyla özel araçlarıyla seyahat edebilecek. 3.3-Sokağa çıkma kısıtlaması uygulanan süre ve günlerdeki şehirlerarası seyahat kısıtlamasının etkinliğinin artırılması amacıyla şehirlerin tüm giriş ve çıkışlarında (iller arası koordinasyon sağlanmak kaydıyla) kontrol noktaları oluşturulacak. Özel araçlarla seyahat edenlerin muafiyet kapsamında olup olmadıkları muhakkak tetkik edilecek ve geçerli bir mazereti/muafiyeti bulunmayan kişilerin şehirlerarası seyahatlerine izin verilmeyecek. 4. 16 Mayıs 2021 Pazar günü saat 24.00’e kadar yeme-içme yerleri (restoran, lokanta, kafeterya, pastane, tatlıcı gibi yerler) işyerlerinin iç veya dış alanlarında masada müşteri kabul edemeyecek. Bu süre içerisinde yeme-içme yerleri hafta içi günlerde 07.00-19.00 saatleri arasında gel-al ve paket servis, saat 19.00’dan sahur vaktine kadar sadece paket servis, Cumartesi ve Pazar günleri ise sabah 10.00’dan sahur vaktine kadar sadece paket servis şeklinde faaliyet gösterebilecek. Aynı şekilde online yemek sipariş firmaları hafta içi ve hafta sonlarında saat 10.00’dan sahur vaktine kadar evlere/adrese paket servis şeklinde satış yapabilecek. 5.Aşağıda belirtilen işyerlerinin faaliyetlerine 17 Mayıs 2021 Pazartesi gününe kadar geçici olarak ara verilecektir. Halı saha, yüzme havuzu, spor salonu, güzellik merkezi/salonları, hamam ve saunalar, lunaparklar ve tematik parkları, Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi gibi yerler, İnternet kafe/salonu, elektronik oyun yerleri, bilardo salonu gibi yerler. Çay ocakları ise masa, sandalye/taburelerini kaldırmak ve sadece esnafa servis yapmak kaydıyla faaliyetlerine devam edebilecek. 6.17 Mayıs 2021 tarihine kadar sivil toplum kuruluşları, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üst kuruluşları ile birlikler ve kooperatiflerin genel kurul dahil yapacakları geniş katılımlı her türlü etkinliklerine izin verilmeyecek. 7.Evlendirme işlemlerinin gerçekleştirilmesine devam edilmekle birlikte nikah ve nikah merasimi şeklindeki düğünler, 17 Mayıs 2021 tarihinden itibaren yapılabilecek. Bu süreye kadar herhangi bir şekilde nişan, kına, tören, merasim, düğün yapılmasına müsaade edilmeyecek. 8.Şehir içi toplu ulaşım araçlarında; Oturma kapasitesi % 50 ile sınırlandırılacak, Minibüs/midibüsler ile koltuk kapasitelerinde herhangi bir seyreltme ve kaldırılma yapılmayan otobüsler gibi iç hacim bakımından fiziki mesafe kurallarının uygulanamayacağı şehir içi toplu ulaşım araçlarında ayakta yolcu alınmasına müsaade edilmeyecek, Bunların dışında kalan raylı sistem araçları (metro, tramvay vb.), metrobüsler ve koltuk kapasiteleri seyreltilmiş/kaldırılmış otobüsler gibi ayakta yolcu taşıma ağırlıklı toplu ulaşım araçlarında; fiziki mesafe kurallarına aykırı olmayacak şekilde hangi oranda/sayıda ayakta yolcu alınabileceği il/ilçe umumi hıfzıssıhha kurulları tarafından tespit edilecek. Raylı sistem araçları (metro, tramvay vb.), metrobüsler ve koltuk kapasiteleri seyreltilmiş/kaldırılmış otobüslerde ayakta alınabilecek yolcu sayısını belirtir levha/tabela herkesin görebileceği şekilde asılacak ve ayaktaki yolcuların durabileceği yerler fiziki olarak işaretlenmek suretiyle belirlenecek. 9.Huzurevi, yaşlı bakımevi, rehabilitasyon merkezi, çocuk evleri gibi sosyal koruma/bakım merkezlerinde 17 Mayıs 2021 tarihine kadar ziyaretçi kabul edilmeyecek. 10.Turistik tesisler dahil tüm konaklama tesislerinin (otel, motel, apart otel, pansiyon vb.) içerisinde bulunan yeme-içme yerleri, sadece konaklamalı müşterilerle sınırlı olmak ve aynı masada en fazla 2 kişiye servis açılmaması kaydıyla hizmet verebilecek. Konaklama tesislerinde kesinlikle toplu iftar organizasyonları yapılmayacak. Daha önce illere gönderilen genelgeler doğrultusunda konaklama tesislerinin denetimleri etkin şekilde sürdürülecek, sahte rezervasyon başta olmak üzere her türlü kötüye kullanımın önüne geçilecek. 11.Çeşitli işyerleri tarafından açılış nedeniyle veya belirli gün ya da saatlere özgü yapılan indirim uygulamaları kontrolsüz şekilde kalabalıkların oluşmasına neden olabilmekte. Bu sebeple işyerleri tarafından açılış nedeniyle veya belirli gün ya da saatlere özgü genel indirim uygulamalarının yerine yoğunluğun önüne geçilebilmesi için en az bir hafta sürecek şekilde uzun periyodlarla indirim uygulamaları yapılacak. 12.Cumhurbaşkanlığının 2021/8 sayılı Genelgesi doğrultusunda kamu kurum ve kuruluşlarında uzaktan ve/veya dönüşümlü çalışma gibi esnek çalışma yöntemlerinden azami düzeyde istifade edilecek.İdari izin kapsamındaki personele (hamile çalışanlar, süt izni kullananlar, 10 yaş ve altında çocuğu olan kadın çalışanlar, engelli çalışanlar, 60 yaş üzerindeki personel, kronik rahatsızlığı bulunanlar) kolaylık gösterilecek ve kamuda mesai saatlerinin başlangıç ve bitiş saatlerinin 10.00-16.00 olarak uygulanması sağlanacak. Çalışma koşulları, şartları ve imkanları uygun olan özel sektör firmalarında da esnek çalışma yöntemlerine geçilmesi teşvik edilecek. 13.Daha önce illere gönderilen genelge ile tüm kara, deniz ve hava sınır kapılarımızdan 15 Nisan 2021 tarihine kadar ülkemize giriş yapmak isteyen kişilerden son 72 saat içerisinde yapılmış negatif SARS-CoV-2 PCR testi sonucu ibrazı zorunluluğu 31 Mayıs 2021 tarihine kadar devam ettirilecek. Negatif SARS-CoV-2 PCR testi sonucu ibraz edemeyen kişilere uygulanacak karantina koşullarına ilişkin iş ve işlemler daha önceden yayımlanmış olan genelgelerimize göre yerine getirilecek. Yukarıda belirtilen esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27’nci ve 72’nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararlarının ivedilikle alınacak. Uygulamada herhangi bir aksaklığa meydan verilmeyecek ve mağduriyete neden olunmayacak. Eskişehir Ticaret Borsası
Et ve Süt Kurumu Piyasa Araştırması
Sayın Üyemiz, Et ve Süt Kurumundan Borsamıza gelen yazıda; Kombina Müdürlüğümüzce Ek (1) de teknik şartname esaslarına uygun 65.000 kg Mezbuh TazeSoğutulmuş Dana Arka Çeyrek (but) Eti alımı planlanmaktadır. Söz konusu alım için yaklaşık maliyet hesaplamasında kullanılacak serbest piyasa birimfiyatlarınızı 13.04.2021 Salı saat 14:00 a kadar 0 (312) 270 42 14 numarasına fax olarak veyamgultekin.gulhan@esk.gov.tr mail adresine, Ek (2) de bulunan birim fiyat cetveline bedel, rakam veyazı birbirine uygun olarak açıkça yazılarak, üzerinde kazıntı, silinti ve düzeltme yapılmadan, kaşe veimzalı bir şekilde gönderilmesi hususunda; Konu ile ilgilenen üyelerimizin bilgisine, Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Connecting Eurasia: Smart Ports and Rail Forum
Sayın Üyemiz, A.B.D. Büyükelçiliği Ticaret Müsteşarlığı tarafından 27-28-29 Nisan 2021 tarihlerinde Azerbaycan, Gürcistan ve Türkiye deki demiryolu ve liman altyapıları için A.B.D li firmaların teknolojilerini, A.B.D ve uluslararası finansman kurumlarının ise finans araçlarını sunacağı "Connecting Eurasia: Smart Ports and Rail Forum isimli sanal etkinliğin gerçekleştirileceği bildirilmektedir. Etkinliğe ilişkin detaylı bilgi ve kayıt linkleri ekte sunulmakta olup, daha fazla bilgi için ABD Ticaret Müsteşarlığı Ticaret Ataşe Yardımcısı Naz Demirdöven ile Naz.Demirdoven@trade.gov adresinden iletişime geçilmesi mümkündür. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
IKBY İle Karşılıklı Ticari Temaslar
Sayın Üyemiz, Ticaret Bakanlığı nın kayıtlı yazılarında;  Irak ın ülkemizin geleneksel ihracat pazarları arasında en üst sıralarda yer aldığı,  Ülkemizin Irak a yaptığı ihracatın büyük bir kısmının karayolu ile Irak Kürt Bölgesel Yönetimi (IKBY) üzerinden Irak ın farklı bölgelerine taşınmakta veya IKBY içerisinde kalmakta olduğu,  Irak ile ticari ilişkilerimizin devam ettiği İbrahim Halil sınır kapısının da fiili olarak IKBY kontrolü altında bulunduğu bildirilmekte olup; kamu gelirleri ve ekonomik büyümesi büyük ölçüde petrol fiyatları ve gelirlerine bağlı olan IKBY ekonomisinin, petrol fiyatlarının son dönemde beklenenin üzerinde artmasıyla 2021 yılında ve pandemi sonrası süreçte toparlanma göstermesinin beklendiği bildirilmektedir. Bu çerçevede ilgide kayıtlı yazılarda;  Ülkemiz iş dünyasının IKBY iş insanları ve resmi iş kuruluşları ile sıcak temasının önemli olduğu ve önümüzdeki dönemlerde bu temasların gerek iş ziyaretleri gerekse nezaket ziyaretleri ile devam etmesinin ikili ticari ilişkilerimiz açısından faydalı olabileceği,  Başta IKBY Ticaret Odaları olmak üzere, ilgili IKBY kurum ve kuruluşları ile Irak iş çevreleri ile yapılan düzenli görüşmelerden, Türkiye den gelen iş heyetlerinin ve üst düzey ticari ziyaretlerin IKBY iş çevrelerinde memnuniyet yarattığı,  Irak ile ticaret ve turizm hacminin fazla olduğu şehirlerimizden başta İstanbul, Ankara, Bursa ve İzmir Ticaret ve Sanayi Odalarının IKBY yi ziyaret etmesinin yararlı olabileceği, bu yönde Erbil Ticaret Odası tarafından da mezkur illerle ilgili bir beklenti bulunduğu,  Bu ziyaretler ile beraber oluşturulacak taslak bir program kapsamında ilerleyen dönemlerde sonuç odaklı etkinlik/zirve/sektörel çalıştaylar yapılmasının faydalı olacağı değerlendirilmektedir. Diğer yandan, bu kapsamda düzenlenecek faaliyetlerin Ticaret Bakanlığı na iletilmek üzere Borsamıza (eskisehirtb@gmail.com) bildirilmesi önem arz etmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Moldova Ticaret Forumu Daveti
Sayın Üyemiz, Moldova Ticaret Forumu 2021 in, internet üzerinden, 28-30 Nisan 2021 tarihlerinde gerçekleştirileceği bildirilmektedir. 300 e yakın Moldovalı firmanın katılımının beklendiği etkinliğe kayıt için https://moldova-trade-forum.b2match.io/home adresi ziyareti edilmelidir. Etkinlikte yerel ve Avrupa pazarından yeni işbirliği imkanları bulma ve firmalar ile ikili görüşmeler gerçekleştirme fırsatları sağlanacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kişisel Verilerin Korunması Mevzuatına Uyum Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden, Kişisel Verilerin Korunması Mevzuatına Uyum Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Kişisel Verilerin Korunması Mevzuatına Uyum Eğitimi" başlıklı eğitimden; gerek çalışanlarının gerek müşterilerinin ve temasta bulunun diğer kişilerin kişisel verilerini mevzuata uygun şekilde işlemek isteyen şirket sahip ve yöneticileri bu eğitimden faydalanabilecektir. Eğitim sonunda katılımcılar kişisel verilerin korunması hukukunun temel kavramlarını, Kanun un getirdiği yeni koruma mekanizmasının işleyişini, riskleri, fırsatları, veri işleme faaliyetinde sorumluluğun ne şekilde işlediğini, verisi işlenenlerin haklarını, hak arama usulünü, kişisel verileri koruma envanterinin ne olduğunu, VERBİS e kayıt, aydınlatma, kişisel veri koruma politikası hazırlama gibi mutlaka yerine getirilmesi gereken çeşitli aşamaları öğrenmiş, farkındalık sahibi olmuş olurlar. Eğitim sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin % 70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TARSİM Son Kabul Tarihleri
Sayın Üyemiz, "Tarım Sigortaları Havuzu Tarafından 2021 Yılında Kapsama Alınacak Riskler,Kararın Ürünler ve Bölgeler ile Prim Desteği Oranlarına İlişkin (Karar Sayısı: 3205) 1 inci maddesinin 3üncü fıkrasında; "çiftçi kayıt sistemine (ÇKS) kayıtlı çiftçilerin özlük, ürün ve arazi bilgileri, dikkatealınarak Tarım Sigortaları havuzu tarafından teminat altına alınırlar" denilmekte olup, bölgemiz içinönemli olan ürünler (Arpa, Buğday, Yulaf, Tritikale, Çavdar, Mısır, vb.) için Tarsim sigortasıyaptırmak isteyen çiftçilerimizin, son kabul tarihlerinden önce, ÇKS dosyalarının Tarım BilgiSistemi (TBS) ne girilebilmesi için, İlçe Müdürlüğümüze ÇKS dosyalarını en az üç (3) gün öncedenteslim etmeleri gerekmektedir. Eskişehir İli Odunpazarı na ait ürünleri içeren (Ek) listede yadahttps://web.tarsim.gov.tr/havuz/ internet sitesinde duyurular kısmında "son kabul tarihleri" yeralmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bitkisel Üretime Destekleme Ödemesine Yapılmasına Dair Tebliğ
Sayın Üyemiz, 2021 üretim yılı Çiftçi Kayıt Sistemi (ÇKS) başvuruları için İlçe Müdürlüğünebaşvuruda bulunan çiftçilerimizin kurumumuza teslim etmiş oldukları Çiftçi Kayıt Sistemi (ÇKS)dosyaları, Tarım Bilgi Sistemi (TBS) ne girilmektedir. Dosyaların girilme süreci devam etmekteolup, dosyalarını teslim eden çiftçilerimizin herhangi bir hak kaybına uğramamaları için sistemdenya da başvuru evraklarındaki düzeltmelerden kaynaklanan hatalar olabileceği için, ÇKSdosyalarını teslim eden çiftçilerimizin, 2021 yılına ait ÇKS belgesi alarak ekiliş alanlarını kontroletmeleri ve dosyalarında girilmeyen herhangi bir parsel ya da ürün varsa, tarafımıza biran öncebildirerek gereken düzeltmeleri yapmamızın sağlanması için ilgili çiftçilerimizin İlçeMüdürlüğüne başvuruda bulunmaları gerekmektedir. Ayrıntılar ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
NASA | Tournament Earth (Dünya Turnuvası)
Sayın Üyemiz, Tatvan Ticaret ve Sanayi Odası ndan Borsamıza intikal eden yazıda; ABD Havacılık ve Uzay Ajansı nın (National Aeronautics and Space Administration - NASA) düzenlediği "Tournament Earth - Dünya Turnuvası" adlı online yarışmada, 2016 yılında Astronot Kate RUBINS in NASA nın yörüngesi etrafında dolaşırken çektiği Van Gölü fotoğrafının, huzur kategorisinde birinci olarak yarı finale kaldığı bildirilmektedir. Ayrıca, mevcut oylama sonuçları incelendiğinde Van Gölü fotoğrafının, rakibi Maysak Tayfunu nundan %5 puan önde olduğu görülmektedir. Bu kapsamda, oylama detayları ekli yazıda yer alan yarışmaya talep edilen desteğin verilmesi hususunu rica ederim Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2021–01 Proje Teklif Çağrısı
Syın Üyemiz, İmalat sanayii sektörlerinde teknoloji, yenilik, ürün kalitesi ve verimlilik artışı sağlanması, endüstriyel kapasitenin dönüştürülerek daha rekabetçi hale getirilmesi ve yüksek katma değerli üretimin artırılması amacıyla; Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB) tarafından Ar-Ge, Ür-Ge ve İnoasyon Destek Programı 2021 – 01 Proje Teklif Çağrısı duyurulmuştur. 2021 – 01 sayılı Proje Teklif Çağrısının genel amacı, Orta yüksek ve yüksek teknoloji düzeyinde faaliyet gösteren Küçük işletmelerle ve Orta Büyüklükteki işletmelerin, kritik teknolojilerdeki Ar-Ge ve İnovasyon ile Ür-Ge Projelerinin nitelikli bir şekilde desteklenerek uygulamaya geçirilmesinin sağlanmasıdır. Projeye ilişkin detaylı bilgi ekte tarafınıza sunulmaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Bakliyat Peşin Satışlar
Sayın Üyemiz, TMO tarafından 7 bin 811 ton ELÜS nohut stoku 4,25 TL/Kg fiyatla peşin bedel mukabili kullanıcılarına yönelik toptan olarak satışa açılmıştır. ELÜS nohut satışlarından TMO Elektronik Satış Platformuna ve TÜRİBE üye olan bakliyatimalatçıları, ulusal zincir marketler ve paketleyiciler faydalanabilecektir. Söz konu stoklar için 03Nisan – 09 Nisan 2021 tarihleri arasında TMO Elektronik Satış Platformu üzerinden talep toplanacak, 13Nisan 2021 tarihinde ilgili kişi ve kuruluşlarca Platform üzerinden tahsis miktarlarıgörüntülenebilecektir. 14 Nisan - 26 Nisan 2021 (dahil) tarihleri arasında her gün ELÜS tahsismiktarları takas için TÜRİB de işlem görecektir.Stoklarla sınırlı olup güncel stok ve satış fiyatlarına ait bilgilere internetsitesinden (www.tmo.gov.tr) ve Şube Müdürlüklerinden ulaşabilirsiniz. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
UBAK Çalıştayı Hk.
Sayın Üyemiz, UBAK izin belgesi dağıtım kriterlerinin yeniden değerlendirilmesi amacıyla, Ulaştırma ve Altyapı Bakanlığı yetkililerinin katılımıyla -COVID-19 salgını da dikkate alınarak video konferans yöntemiyle- Birliğimiz koordinasyonunda UBAK Çalıştayı20 Nisan 2021 tarihinde saat 14:00 dedüzenlenecektir. Katılım sağlayacak üyelerimiz 6 Nisan 2021 tarihine kadar Borsamıza (eskisehirtb@tobb.org.tr) bilgilerini iletmeleri gerekmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
BİGG GARAJ 2020/2 Tanıtım Duyurusu
Sayın Üyemiz, TOBB Ekonomi ve Teknoloji Üniversitesi ninbünyesindeki Teknoloji Transfer Ofisi nin TÜBİTAK BİGG (Bireysel Genç Girişim) Programı kapsamında 2020-2 çağrı döneminde Hacettepe TTM ile ortak yürütülecek ve online olarak gerçekleştirilecek tanıtım, eğitim ve mentorluk faaliyetlerini içeren BİGG GARAJ Programına katılım davet edilmektedir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
ELÜS, Yerli ve İthal Ürün Satışları
Sayın Üyemiz, TMO Genel Müdürlüğünden Borsamıza gelen yazıda, TMOElektronikSatışPlatformuüzerindendağıtımıvesatışıyapılacakekmeklik ve makarnalık buğdaylar ile arpa, mısır, nohut ve pirinç için 03 Nisan – 09 Nisan 2021 tarihleri arasındataleptoplanacak,taleptoplanmasısaat17:00 dasonaerecektir. Ayrıntılar ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İnteraktif Muz E-Çalıştayı Daveti
Sayın Üyemiz, Antalya Ticaret Borsası, Antalya Tarım Konseyi ve Antalya İl Tarım ve Orman Müdürlüğüişbirliğinde 05-10 Nisan 2021 tarihleri arasında “İnteraktif Muz E-Çalıştayı” düzenlenecektir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO stoklarında bulunan ve ekli listede yer alan hububat (Ek-1) ve bakliyat aşağıdabelirtilen esaslar ve ekte (Ek-2) yer alan fiyatlarla 02 Nisan 2021 tarihinden itibaren peşin bedelmukabilinde satılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Eskişehir İli Hayvan Sağlık Zabıtası Komisyon Kararı (2021/01)
Sayın Üyemiz, EskişehirIl Tarım ve Orman Müdürlügünden Borsamıza gönderilen yazıda, İlimiz 2021 yılı Hayvan Hastalıkları İle Mücadele ve Hayvan Hareketlerinin kontrolü ile ilgili,29.03.2021 tarih ve 2021/01 sayılı Eskişehir İli Hayvan Sağlık Zabıtası Komisyon Kararı ekte bilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Brezilya Sağlık Bakanlığının Tıbbi Malzeme İhtiyacı Hak.
Sayın Üyemiz, Brezilya Ankara Büyükelçiliği nin yazısı ile, T.C Dışişleri Bakanlığı na iletilen bir notaya atfen, Brezilya Sağlık Bakanlığı nın ekte sunulan tıbbi malzemeleri satın almak istediği bildirilmektedir. Konuyla ilgilenen firmaların, ürün bilgileri, firma bilgileri, tedarik miktarı ve irtibat detaylarını secom.ancara@itamaraty.gov.br adresine göndermek suretiyle iletişime geçmeleri mümkündür. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sulama Suyu Yetersizliği
Sayın Üyemiz, Eskişehir İl Tarım ve Orman Müdürlüğünden Borsamıza gönderilen Sulama Suyu Yetersizliği hakkındaki yazıda, Sulama sezonu 2020 yılı başında barajdaki su seviyesi 227 hm3 iken 15Mart 2021 tarihi itibariyle 175 hm3 (%37) olup, geçen yıl aynı tarihte 225 hm3 (%49)seviyesindedir. Eskişehir Sulamasında barajın mevcut durumuna göre kısıtlı sulama yapılması,Eskişehir içme suyu ve canlı hayatın idamesini sağlamak için bırakılacak suyun dışında dereyatağına ilave su bırakılması, kurak dönemlerin bu şekilde sürmesi halinde şehrin içme suyuihtiyacını riske edecektir. Bu nedenle, barajdaki doluluk oranının durumuna göre 2021 yılındamansaptaki talepler için ilave su bırakılamayacaktır. Porsuk barajının mevcut durumu ve Sakaryanehrinin debisindeki azalma dikkate alınarak; membadan mansaba tüm sulama teşkilatları içinsuya ihtiyacı az olan ürün deseni planlaması yapılması gerekmektedir. 2021 yılında halk sulaması adı altında sulama yapan çiftçilerimize Sakarya Nehri ve Porsuk çayıüzerinden su tahsisi yapılamayacağı göz önüne alınarak çiftçilerimizin su tüketimi açısından uygunbitki çeşitlerine yönlenmeleri suyun etkin kullanımı açısından önemli olup su sıkıntısınedeniyle mağduriyet yaşanmaması için gerekli tedbirlerin alınması gerekmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Çeşitli ihaleler Hk.
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen çeşitli ihale duyuruları ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kira, gelir ve ciro kaybı desteklerinde süre uzatıldı
Sayın Üyemiz, Ticaret Bakanı Ruhsar Pekcan, Twitter hesabından yaptığı paylaşımda, esnaf ve sanatkarlar ile gerçek kişi tacirlere yönelik kira ve gelir kaybı destekleri ile yiyecek içecek hizmeti faaliyetlerinde bulunan işletmelere yönelik ciro kaybı desteklerinde başvuru sürelerini, esnaf ve işletmelerin hak kaybına uğramamaları için uzattıklarını belirtti. Bakan Pekcan, "Desteklerden yararlanma şartlarını taşıyan fakat çeşitli sebeplerle başvuruda bulunamayan esnafımız ile işletmelerimiz 30 Nisan 2021 tarihi saat 23:59’a kadar e-devlet üzerinden başvuru yapabilecekler. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yenilenebilir Enerji Kaynak Garanti (YEK- G)
Sayın Üyemiz, Avrupa Birliği (AB) 2021 yılından itibaren Avrupa Yeşil Mutabakatında (Green Deal) yeni bir aşamayagelmiş durumdadır. İlerleyen günlerde karbon salınımları ile ilgili olarak AB dışından Avrupa ya ihracatyapan ülkelere "Sınırda Karbon Düzenlemesi" adıyla ilave maliyetlerin gelmesi söz konusu olacaktır. Bu maliyaptırımların; sanayiden enerjiye kadar birçok sektörü etkilemesi mümkündür. Sınıra Karbon Düzenlemesimekanizması ile ilgili detayların henüz netleşmemiş olmasına rağmen üretim süreçlerinde ve diğer hizmetaşamalarında tüketilen elektriğin yenilenebilir kaynaklardan üretildiğini belgeleme seçeneğinin önemkazanacağı düşünülmektedir. Enerji Piyasaları İşletme A.Ş. (EPİAŞ), elektriğin üretimi ve tüketiminde yenilenebilir enerji kaynaklarınınkullanımının belgelenmesi, yaygınlaştırılması ve çevrenin korunması amacıyla, 01 Haziran 2021tarihinde Yenilenebilir Enerji Kaynak Garanti (YEK-G) Sistemini devreye almayı planlamaktadır. Türkiye de devreye alınacak ve EPİAŞ bünyesinde işletilecek YEK-G Sisteminin anlatılması amacıyla; 07Nisan 2021 tarihinde 14.00-16.00 saatleri arasında gerçekleştirilecek olan toplantıya katılımınızı bekliyoruz. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TÜRİB Virman Emir Giriş Ekranına Ürün Rehberinin Eklenmesi Hk
Sayın Üyemiz, Sistem iyileştirme kapsamına alınan talepler doğrultusunda TÜRİB İşlem Platformu nda "Özel Emir İşlemleri" menüsü altında yer alan "Anlaşmalı Virman Girişi’’nde, normal seans alım ve satım emir girişi sayfalarında olduğu gibiürün seçimi alanına ürün rehberi eklenmişolup aşağıda anlaşmalı virman emri iletimine ilişkin adımlar ve ilgili değişiklik belirtilmiştir. Söz konusu değişiklik 26 Mart 2021 tarihinde devreye alınmıştır. 1)TÜRİB İşlem Platformu na giriş yapılması ve "Anlaşmalı Virman Girişi" seçilmesini takiben satıcı taraf, alıcı kişiye aitMKK sicil numarasını “Alıcı Kişi MKK Numarası” alanına girerek “Alıcı Kişi Bilgilerini Getir” butonuna basar ve alıcı tarafa ait bilgilerin otomatik olarak gelmesi sağlanır. 2)KVKK kapsamında gerçek kişi isim bilgileri belli alanları maskelenmiş olarak, tüzel kişilerin unvanı ise maskelenmeden satıcının kontrolü için bilgisine sunulmaktadır. 3)Alıcı isim/unvan doğru ise “Satıcı tarafın hesap Numarası seçimini takiben ürün seçimi aşamasında ilgili alanda yer alan büyüteç simgesi üzerinden ürün rehberi alanı açılır, seçilen hesap numarasında tanımlı olan ürün bilgileri görüntülenir ve ISIN seçimi yapılır. 4)Emre ilişkin fiyat ve miktar girişi yapılarak virman işlem girişi tamamlanır, emir karşı tarafın onayına sunulur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kademeli Normalleşme Süreci Kapsamında Alınan 15 Numaralı İl Umumi Hıfzıssıhha Kurul Kararı
81 İl Valiliğine Koronavirüs Tedbirlerinin Gözden Geçirilmesi Genelgesi
Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun tavsiyeleri göz önünde bulundurularak 29 Mart 2021 günü toplanan Cumhurbaşkanlığı Kabinesinde alınan kararlar doğrultusunda Bakanlığımız81 İl ValiliğineTedbirlerin Gözden Geçirilmesikonulu genelge gönderdi. Buna göre: 1.Yeni bir karar alınıncaya kadar illerinrisk grupları aşağıdaki şekilde değiştirildi: Düşük Risk Grubunda Yer Alan İller;Şırnak. (1 İl) Orta Risk Grubunda Yer Alan İller;Batman, Bitlis, Diyarbakır, Hakkari, Mardin, Muş, Siirt, Şanlıurfa, Uşak, Van. (10 İl) Yüksek Risk Grubunda Yer Alan İller;Adana, Afyonkarahisar, Ağrı, Bingöl, Burdur, Denizli, Hatay, Kahramanmaraş, Kars, Kırşehir, Manisa, Tunceli. (12 İl) Çok Yüksek Risk Grubunda Yer Alan İller;Adıyaman, Aksaray, Amasya, Ankara, Antalya, Ardahan, Artvin, Aydın, Balıkesir, Bartın, Bayburt, Bilecik, Bolu, Bursa, Çanakkale, Çankırı, Çorum, Düzce, Edirne, Elazığ, Erzincan, Erzurum, Eskişehir, Gaziantep, Giresun, Gümüşhane, Iğdır, Isparta, İstanbul, İzmir, Karabük, Karaman, Kastamonu, Kayseri, Kırıkkale, Kırklareli, Kilis, Kocaeli, Konya, Kütahya, Malatya, Mersin, Muğla, Nevşehir, Niğde, Ordu, Osmaniye, Rize, Sakarya, Samsun, Sinop, Sivas, Tekirdağ, Tokat, Trabzon, Yalova, Yozgat, Zonguldak, (58 İl) 2.Daha önceki genelgelerle risk gruplarına göre düzenlenen hafta içi ve hafta sonu sokağa çıkma kısıtlamaları yeniden düzenlendi. Buna göre; Hafta içi günlerde21.00 - 05.00saatleri arasında tüm Türkiye’de sokağa çıkma kısıtlaması uygulamasına devam edilecek. Hafta sonlarında; Düşük ve orta risk grubunda yer alan illerde hafta sonu sokağa çıkma kısıtlaması, hafta içinde olduğu gibi21.00 - 05.00saatleri arasında uygulanacak. Yüksek risk grubunda yer alan illerde hafta sonu sokağa çıkma kısıtlaması,Cuma 21.00 - Cumartesi 05.00saatleri arasıylaCumartesi günü saat 21.00’debaşlayıp Pazar gününün tamamını kapsayıpPazartesi günü saat05.00’debitecek şekilde uygulanacak. Çok yüksek risk grubunda yer alan illerde ise hafta sonu sokağa çıkma kısıtlaması,Cuma günü saat 21.00’debaşlayıp Cumartesi ve Pazar günlerinin tamamını kapsayıpPazartesi günü saat 05.00’debitecek şekilde uygulanacak. Uygulanacak olan sokağa çıkma kısıtlamaları sırasında daha önce illere gönderilenSokağa Çıkma Kısıtlamasından Muaf Yerler ve Kişiler Listesindeyer alan istisna/muafiyetler ile sokağa çıkma kısıtlaması uygulanan süre ve günlerde şehirlerarası seyahat edilmesine dair usul ve esasların uygulanmasına aynı şekilde devam edilecek. • Sokağa çıkma kısıtlamasının uygulama biçimine göre Cumartesi ve/veya Pazar günü market, bakkal, manav, kasap, kuruyemişçiler ve çiçekçiler 10.00 - 17.00 saatleri arasında açık olacak. Yine belirtilen süre içerisinde marketler, bakkallar, manavlar, kasaplar, kuruyemişçiler ve çiçekçiler telefonla ya da online olarak aldıkları siparişleri teslim edebilecek. •Cumartesi/Pazar günü ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri açık olacak. • Lokanta/restoran, pastane ve tatlıcı tarzı işyerleri Cumartesi ve/veya Pazar günü 10.00 - 20.00 saatleri arasında paket servis faaliyetlerine devam edebilecek. • Online sipariş firmaları da Cumartesi ve/veya Pazar günü 10.00 - 24.00 saatleri arasında siparişleri teslim edebilecek. 3.Tüm risk gruplarında yeme-içme yerleri (lokanta, restoran, kafeterya, pastane, tatlıcı vb.) ile dernek lokali, kıraathane, çay bahçesi gibi iş yerleri; Sağlık Bakanlığı Covid-19 Salgın Yönetimi ve Çalışma Rehberinde yer alan mesafe koşullarına (masalar ve koltuklar arası) göre açık ve kapalı alanlar için ayrı ayrı olacak şekilde % 50 kapasite sınırlaması ile mekanda bulunabilecek masa-koltuk sayısı ve aynı anda bulunabilecek azami kişi sayısı tespit edilecek. HES kodu sorgulaması yapılarak, 07.00 - 19.00 saatleri arasında müşteri kabul edecek. Ancak bu işyerlerinde aynı masada; düşük ve orta risk grubunda bulunan illerdeki iş yerlerinde en fazla 4 kişinin, yüksek ve çok yüksek risk grubunda bulunan illerdeki iş yerlerinde en fazla 2 kişinin aynı zamanda oturmasına izin verilecek. Tüm risk gruplarında yeme-içme yerleri 19:00 - 21.00 saatleri arasında paket servisi veya gel-al şeklinde, 21.00-24.00 saatleri arasında ise sadece paket servis şeklinde, tam gün sokağa çıkma kısıtlaması uygulanan Cumartesi ve/veya Pazar günleri ise 10.00 - 20.00 saatleri arasında sadece paket servis şeklinde hizmet verebilecek. 4.Sivil toplum kuruluşları, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üst kuruluşları ile birlikler ve kooperatifler tarafından düzenlenecek genel kurullar, kişilerin bir araya gelmesine neden olan her türlü etkinlikler, nikah ve nikah merasimi şeklindeki düğünler, halı saha, yüzme havuzu vb. tesislere daha önce illere gönderilen genelgede belirtilen usul ve esaslar doğrultusunda süregelen uygulanmasına aynen devam edilecek. Daha önce kısıtlama uygulanan yüksek ve çok yüksek risk grubunda bulunan illerde ise İl Hıfzıssıhha Kurullarınca alınan karara göre uygulama belirlenecek. Ancak yüksek ve çok yüksek risk gruplarındaki illerde bu hafta sonu (3-4 Nisan 2021) uygulanacak sokağa çıkma kısıtlaması kapsamında Cumartesi ve/veya Pazar günleri için daha önceden tarih almış nikah veya nikah merasimi şeklindeki düğünlere katılacaklar (katılımcı sınırlamasına uygun olmak kaydıyla) için muafiyet uygulanacak. 5.İnternet kafe/salonu, bilardo salonu, lunapark, hamam, sauna, masaj salonu gibi yerler için süregelen uygulamaya uygun şekilde; düşük, orta ve yüksek risk grubunda bulunan illerde % 50 kapasite sınırına uymak ve HES kodu sorgulaması yapmak kaydıyla 07.00 - 19.00 saatleri arasında faaliyette bulunabilecek.Çok yüksek risk grubunda bulunan 17 ilde ise İl Hıfzıssıhha Kurullarınca alınan karara göre uygulama belirlenecek. 6.Salgının bulaşmasında önemli bir kaynak olduğu tespit edilen aile ve akraba ziyaretleri gibi ev içi etkinliklerin sınırlandırılmasına yönelik bilgilendirme faaliyetlerine ülke genelinde ağırlık verilecek. 7.Risk grubuna göre il bazında tedbirlerin uygulanacağı kontrollü normalleşme döneminin sürdürülebilirliği ve bir an evvel tam anlamıyla normalleşmenin sağlanması için;Dinamik Denetim Sürecininuygulanmasına kesintisiz şekilde devam edilecek. Salgının seyrini etkileyen (olumlu-olumsuz) her türlü faktörün (ilçeler arası farklılıklar, il nüfusunun yaş ortalaması, il dışından kaynaklı sorunlar vb. il bazlı özel sebepler) analiz edildiği ve bu faktörlere yönelik alınan/alınması gereken tedbirler ile yürütülen/yürütülecek olan faaliyetlerin yer aldığı İl Salgın Risk Azaltma Planı (SARAP) doğrultusunda gerekli çalışmaların aksaklığa meydan verilmeden sürdürülecek. Bu doğrultuda; - Valiler tarafından ilin hangi risk grubunda bulunduğuna bağlı olarak yukarıda belirtilen usul ve esaslar çerçevesinde Hıfzıssıhha Kurul kararlarının alınması ve 30.03.2021 tarihinden itibaren uygulamaya geçirilmesi sağlanacak. Vali ve Kaymakamlarca yukarıda belirtilen esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27 nci ve 72 nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararlarıivedilikle alınacak. Uygulamada herhangi bir aksaklığa meydan verilmeyecek. - Hıfzıssıhha Kurullarınca alınan kararlara uymayanlara 1593 sayılı Umumi Hıfzıssıhha Kanununun ilgili maddeleri gereğince idari işlem tesis edilecek. Konusu suç teşkil eden davranışlara ilişkin Türk Ceza Kanununun 195 inci maddesi kapsamında gerekli adli işlemler başlatılacak.
TİGEM Mahsul Buğday Satışı
Sayın Üyemiz, 01.04.2021 gunu saat 10.30 da sanlıurfa tıcaret borsasında işletmemize aıt 2020 yılı ıstıhsalı 4.572,35 ton mahsul buğday için satış ihalesi tekrarı yapılacaktır. ıhale ıle ılgılı evraklar www.tigem.gov.tr elektronık adresının ıhaleler bolumunde yayınlanmıştır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
D-8 İş Forumu
Sayın Üyemiz, Ülkemiz ile Bangladeş, Endonezya, İran, Malezya, Mısır, Nijerya ve Pakistan dan oluşan Gelişen Sekiz Ülke (D-8) Ekonomik İşbirliği Teşkilatı, üye ülkeler arasında kalkınmaya yönelik işbirliğini geliştirmek, ekonomik ve sosyal ilişkileri zenginleştirmek amacıyla 1997 yılında kurulmuş olan bir örgüttür. Türkiye nin D-8 Dönem Başkanlığına bağlı olarak D-8 Ticaret ve Sanayi Odaları (D-8 TSO) Dönem Başkanlığı Birliğimizce yürütülmektedir. 8 Nisan 2021 tarihinde düzenlenecek olan D-8 10. Zirvesi ile D-8 Dönem Başkanlığı nın Bangladeş e devredilecek olması nedeniyle, D-8 TSO Dönem Başkanlığı Bangladeş Ticaret ve Sanayi Odaları Federasyonu na devredilecektir. Bu çerçevede, D-8 10. Zirvesi nin yan etkinliği olarak 5 Nisan 2021 tarihinde 11:00-13.40 saatlerinde (Türkiye saati ile) Birliğimiz ve Bangladeş Ticaret ve Sanayi Odaları Federasyonu işbirliğinde video konferans yöntemiyle D-8 İş Forumu düzenlenecektir. Anılan İş Forumu na Birliğimiz ve D-8 TSO Başkanı Sn. Rifat Hisarcıklıoğlu iştirak edecektir. İngilizce-Türkçe simültane tercüme hizmeti sağlanacak olan söz konusu Forumun taslak programı ekte sunulmakta olup, katılmak isteyen üyelerimizin https://www.d8dhaka.com/registration/ web sitesinden (Registration for Virtual D-8 Business Forum) kayıt yapmaları gerekmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
13 Numaralı İl Umumi Hıfzıssıhha Kurul Kararı
Sayın Üyemiz, ALINAN KARARLAR Koronavirüs (Covid­19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme, sosyal izolasyonu temin, fiziki mesafeyi koruma ve hastalığın yayılım hızını kontrol altında tutma amacıyla, içerisinde bulunduğumuz kontrollü sosyal hayat döneminin temel prensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemler; Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun önerileri doğrultusunda belirlenerek uygulamaya geçirilmektedir. Bu kapsamda; İlimiz genelindeki eğitim kurumlarında (Okul, özel eğitim kursu, atölye, halk eğitim kursu, özel öğretim kursu, sürücü kursu vb.) öğrenci ya da kurum çalışanlarından PCR testi pozitif olan vaka tespit edilmesi halindeyapılan değerlendirmeler sonucu ( vakanın aile ve okul çevresi ile temas durumu, maske kullanımı, sosyal mesafe uyumu vb.) yayılım oluşacağı kanaatine varılması durumundaeğitim kurumunun tüm birimlerinin 14 gün süre ile online eğitim faaliyetlerine geçmesine, ilgili iş ve işlemlerin İl Sağlık Müdürlüğü ve İl Milli Eğitim Müdürlüğü koordinesinde yapılarak Valiliğimizde bulunan İl Salgın Denetim Merkezine günlük olarak bilgi verilmesine, İlimiz şehir merkezinde bulunan yoğun kalabalıkların oluştuğu gözlemlenen Kanlıkavak ve Dede Korkut parkları ve Porsuk nehri gibi kalabalık alanlarda, ziyaretçilerin 8 m2ye 1 kişi ve gruplar arasında en az 3 m mesafe olacak şekilde düzenleme yapılmasına, diğer tedbirleri denetlemek amacıyla söz konusu alanlarda İlçe Salgın Denetim Merkezleri tarafından sokağa çıkma kısıtı bulunmayan gün ve saatlerde personel görevlendirilmesine, İlgili Kaymakamlıklar tarafından gerekli tedbirler alınarak Hamam yolu, İsmet İnönü ve İki Eylül Caddelerine giriş çıkışların kısıtlanarak kontrollü ve yoğunluk oluşturmayacak şekilde sınırlı sayıda vatandaşın girişine izin verilmesine, Otel ve konaklama yeri restoranlarının amacı dışında kullanımını engellemek amacıyla, İkameti ilimiz merkezinde (Odunpazarı, Tepebaşı ilçeleri) bulunan vatandaşların kısa süreli konaklamalarına (5 gün ve daha az) zaruri durumlar hariç (Uzaklaştırma kararı, yangın, su basması vb.) müsaade edilmemesine, Spor Salonlarının çalışanlarının ya da üyelerinin herhangi birinde PCR testi pozitif olan vaka tespit edilmesi halinde, spor salonunun 14 gün süre ile faaliyetine ara vermesine, Pandemi ile ilgili alınan İl Umumi Hıfzıssıhha Kurulu kararlarına uymayanlara; Birinci ihlalde uyarı, İkinci ihlalde 1593 sayılı Umumi Hıfzıssıhha Kanunu’nun 282’nci maddesi gereğince idari para cezası, İşyeri/işletmenin vatandaşlarımızın sağlığını koruyabilecek şekilde uygun hale getirilmesi için üçüncü ihlalde 3 gün; dördüncü ihlalde 1 ay süreyle faaliyet durdurma cezalarının uygulanmasına, Ayrıca 5237 sayılı Türk Ceza Kanunu’nun 195’inci maddesi kapsamında gerekli adli işlemlerin başlatılmasına, Oy birliği ile karar verilmiştir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ağlara Üyelik Desteği Hk.
Sayın Üyemiz, TÜBİTAK Uluslararası İşbirliklerine Katılımı Özendirmeye Yönelik Destek ve Ödül Programlarına ilişkin Usul ve Esaslar" kapsamında tasarlanan ve ilk kez 2020 yılında başvuruya açılan "Ağlara Üyelik Desteği" ile Avrupa Birliği Çerçeve Programı (AB ÇP) çerçevesinde sunulan başarılı olacak proje konsorsiyumlarına dâhil olunmasında doğru iletişim ağı içerisinde bulunmak ve AB ÇP önceliklerinin belirlenmesinde etkili olan ağlara üyeliğin teşvik edilmesi amaçlanmaktadır. Desteğe ilişkin detaylı bilgiye https://ufuk2020.org.tr/tr/haberler/aglara-uyelik-destegi-2021-yili-basvurutakvimi-belli-oldu adresinden erişilebilmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hava ve deniz limanları ile otogar ve tren garlarında sıfır atık bilgilendirme semineri
Sayın Üyemiz, Hava ve deniz limanları, otogarlar ve tren garları için sıfır atık uygulaması hakkında 30 Mart 2021 Salı günü saat 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Çevre ve Şehircilik Bakanlığı ile Birliğimiz işbirliğinde gerçekleştirilecek olan seminerde ekli program çerçevesinde hava ve deniz limanları, otogarlar ve tren garları için sıfır atık yaklaşımı ve sıfır atık sistemi kurulumu ile sıfır atık bilgi sistemi ve belgelendirme süreci anlatılacak olup, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Küçük İşletmeler İçin Google Platformu
Sayın Üyemiz, KOBİ lerin dijitalleşmesine yönelik olarak, internetteki varlıklarını oluşturması, müşterilerine farklı dijital kanallar üzerinden satış yapmasının desteklenmesi ve geliştirilmesine yardımcı olmak amacıyla "Küçük İşletmeler İçin Google" projesi başlatılmıştır. Bu kapsamda Birliğimiz ve Google işbirliğinde "Küçük İşletmeler İçin Google" platformu kullanıma sunulmuştur. Platforma ilişkin detaylı bilgiye https://smallbusiness.withgoogle.com/intl/tr_tr/#!/ adresinden erişilebilmektedir. Birliğimiz ve Google işbirliğinde kullanıma sunulan platformda KOBİ lerin dijital ekonomiye uyum sağlaması ve bu alanda güçlendirilmesi için gerekli ürün ve çözüm önerileri tek bir platform üzerinden adım adım açıklanmaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gürcistan Seracılık Projesi Hk.
Sayın Üyemiz, Gürcistan daki "Imereti Tarım Bölgesi-Sera Kümelenme Kalkınma Projesi ile ilgili olarak ülkemizyatırımcıları ile işbirliği yapmak istendiği bildirilmekte olup, konuya ilişkin ayrıntılı bilgiyehttps://www.iaz.ge/iaz-greenhouse-cluster- Development internet adresinden ve info@iaz.ge e-postaadresinden ulaşılabileceği ifade edilmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İl Umumi Hıfzıssıhha Kurul Kararı
Sayın Üyemiz, İl Umumi Hıfzıssıhha Kurulunca Koronavirüsle (COVID-19) mücadele kapsamında aşağıdaki kararlar alınmıştır. ALINAN KARARLAR Koronavirüs salgınıyla mücadele virüsün yayılım hızını düşürmek amacıyla alınan tedbirler kapsamında İl Umumi Hıfzıssıhha Kurulunun 04.11.2020 tarihli ve 98 no’lu, 01.12.2020 tarihli ve 108 no’lu, 07.12.2020 tarihli ve 110 no’lu ile 01.03.2021 tarihli ve 08 no’lu kararlar ile bazı işyerlerinin açılış ve kapanış saatlerine sınırlamalar getirilmiştir. Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun önerileri doğrultusundahâlihazırda uygulanmakta olan tedbir ve kuralların illerin risk grubuna göre kademeli olarak esnetilmesi kararlaştırılarakkontrollü normalleşme sürecinedair temel usul ve esaslar belirlenmiştir. Bu kapsamda 22.03.2021 Pazartesi gününden itibaren, 65 yaş ve üzeri vatandaşlarımızın sabah 07.00-09.00, akşam 16.30-18.30 saatleri arasında şehir içi toplu ulaşım araçlarını kullanmalarının kısıtlanmasına( işyerleri ile illiyetlerini gösteren çalışma/SGK kaydı vb. belgeyi ibraz eden çalışanlar, sağlık randevusu olanlar, özel gereksinime muhtaç çocuğu olanlar, bakıcılık faaliyeti yürütenler hariç), Pazaryerlerindeki yoğunluğu azaltmak üzere, 65 yaş ve üzeri vatandaşlarımızın 12.00’den önce pazar alışverişlerini tamamlamalarına, Yukarıda alınan kararlara uymayanlara; 1593 sayılı Umumi Hıfzıssıhha Kanunu’nun 282’nci maddesi gereğince idari para cezası uygulanmasına, 5237 sayılı Türk Ceza Kanunu’nun 195’inci maddesi kapsamında gerekli adli işlemlerin başlatılmasına, Oy birliği ile karar verilmiştir.
Türk Rus Ortak Sanayi Çalışma Grubu hk.
Sayın Üyemiz, Sanayi ve Teknoloji Bakanlığımız ve Rusya Federasyonu Sanayi ve Ticaret Bakanlığı koordinasyonunda yürütülen Türk-Rus Ortak Sanayi Çalışma Grubu nun (OSÇG) 14. Dönem Toplantısı nın, 7-8 Nisan 2021 tarihlerinde Moskova nın Tula Bölgesi nde gerçekleştirileceği bildirilmekte olup, iş insanlarımızın Rusya Federasyonu nda (varsa) karşılaştığı sorunlara ilişkin bilgi talep edilmektedir. Bilgileriniz ve ekte yer alan formun sizler tarafından doldurularak en geç 25 Mart 2021 Perşembe günü 12.00 a kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesini rica ederim. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB Çiçeksepeti İşbirliği
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği ve ÇiçekSepeti işbirliği ile 8 Mart Dünya Kadınlar Günü kapsamında kadın girişimcilerin e-ticarete yoluyla işlerini büyütmeleri desteklenecektir. İşbirliği kapsamında, 23-24 Mart 2021 tarihlerinde iki gün boyunca başvurular kabul edilecektir. Kadın Girişimcilerimize Özel Programımıza Kimler başvurabilir? 1) Kendi adınıza kurulan bir işletmeniz varsa, 2) Bu işletmedeki payınız 51% ve üzerinde ise, 3) Adi Ortaklık şirket türünde iki ortağın da girişimci kadın olması durumunda Başvurularınız yukarıdaki kriterler çerçevesinde incelenecek olup, uygun olan kadın girişimcilerimize sağlanacak imkanlar: Satışlar üzerinden alınan komisyonlarda 20.000 TL ye kadar %0 komisyon 1 yıl Listeleme Bedeli muafiyeti 250 TL site içi pazarlama bütçesi Eğitim desteği 23-24 Mart a özel Kadın Girişimcilerimiz için hazırladığımız kampanyamızdan faydalanmak isteyen bayilerin "Pazaryerinde kendi ürünlerimi satmak istiyorum" başlığından başvuru yapmalarını rica ederiz. Kampanyayla ilgili detaylarahttps://www.ciceksepeti.com/ciceksepetinde-satis-yaplinkinden ulaşabilirsiniz. ESKİŞEHİR TİCARET BORSASI
2021/2022 Pazarlama Yılı Şeker Kotaları Belirlendi
Sayın Üyemiz, 2021/2022 Pazarlama Yılı şeker kotalarının belirlendiği Cumhurbaşkanlığı kararı Resmi Gazetede yayınlandı. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ayçiçeği, Kanola ve Aspir İthalatında Gümrük Vergisinde Değişiklik
Sayın Üyemiz, Cumhurbaşkanı Kararnamesi ile Ayçiçeği, Kanola ve Aspir ithalatında 1 Temmuz 2021 tarihine kadar gümrük vergileri sıfırlandı. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ekonomik İşbirliği Teşkilatı (EİT) İstanbulTahran-İslamabad Yük Treni hk.
Sayın Üyemiz, Ekonomik İşbirliği Teşkilatı nın (EİT) ilgili toplantısı neticesinde, İstanbul-Tahran-İslamabad (ITI) Yük Treni nin hizmete sokulması konusunda, ülkemiz, İran ve Pakistan Demiryolları arasında mutabakata varıldığı ifade edilmektedir. Bu kapsamda, rekabetçi ve cazip bir taşıma tarifesi oluşturularak, taşıma organizasyonunun sağlanması adına, her ülke tarafından ekte bilgileri verilen ulusal forwarder şirketlerin tespit edildiği bildirilmektedir. Trenin, Türkiye-İran-Pakistan parkurunda işletileceği ve trenle, konteyner ve konvansiyonel yükler taşınabileceği belirtilmektedir. Yüklerin, hat farklılığından dolayı İran ın Zahedan kentinde aktarmaya tabi tutulacağı ifade edilmektedir. ITI Yük Treni ne, Türkiye ve Pakistan da farklı noktalardan yük verilmesinin mümkün olacağı, Türkiye (Köseköy) (1850 km) - İran (2603 km) - Pakistan (İslamabad) (1990 km) arasında toplam taşıma süresinin 14 gün olarak hesaplandığı kaydedilmektedir. İstanbul-Tahran-İslamabad (ITI) Yük Treni Ulusal Forwarder Şirketleri: Türkiye: MFA Lojistik A. Ş. (+90 531 779 29 90; +90 312 557 56 81; info@mfalojistik.com) İran: Rassan Rail Pars (+98 912 140 27 00) Pakistan: Haroon Brothers & Co. (+92 332 94 66 135) Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Talep ve Şikayetler
Sayın Üyemiz, Zonguldak Ticaret ve Sanayi Odası ndan alınan 03.03.2021 tarih ve 6754 sayılı; Zonguldak Çaycuma Tarıma Dayalı İhtisas (SERA) Organize Sanayi Bölgesi projesi konulu yazı ekte gönderilmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Mahsul Buğday Satışı
Sayın Üyemiz, 25.03.2021 Gunu saat 10.00 da Şanlıurfa Ticaret Borsasında işletmeye aıt 2020 yılı ıstıhsalı 981,41 ton mahsul buğday içinpazarlık usulü satış ihalesi yapılacaktır. ıhale ıle ılgılı evraklarwww.tigem.gov.trelektronık adresının ıhaleler bolumunde yayınlanmıştır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yapay Zeka Eğitim ve Farkındalık Projesi - Makine Öğrenmesine Giriş Eğitimi
Sayın Üyemiz, TOBB, TOBB ETÜ ve Global Al Hub iş birliğinde gerçekleştirilen Yapay Zeka Eğitim ve Farkındalık Projesikapsamında "Makine Öğrenmesine Giriş Eğitimi" gerçekleştirilecektir. Söz konusu eğitimde, Python ile Machine Learning projeleri oluşturmak için gerekli becerilerinkazandırılması hedeflenmekte olup eğitimde uygulamalı bir şekilde Denetimli ve Denetimsiz MakineÖğrenimi algoritmaları ele alınacaktır. "Makine Öğrenmesine Giriş Eğitimi" 22-26 Mart 2021 tarihleri arasında 19:00 - 21:00 saatlerinde onlineolarak gerçekleştirilecektir. Ücretsiz olacak eğitim sonrasında katılımcılara sertifika verilecektir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Et ve Süt Kurumu İhaleli Satışlar
Sayın Üyemiz, Et ve Süt Kurumu na bağlı Sincan,Adana, Ağrı, Bingöl, Denizli, Diyarbakır,Erzurum, Sivas Vanve Yozgat Et Kombinaları nda 2021 Mayıs-Haziran-Temmuz-Ağustos aylarında yapılması muhtemelolan büyükbaş hayvan kesimlerinden üretilecek derilerin (kelle derisi dahil), büyükbaş hayvansakatatları (işkembe hariç); küçükbaş hayvan derisi , küçükbaş hayvan bağırsak ile küçükbaş hayvansakatatları online satış usulü ile satılacaktır. 2021 Kurban Bayramı döneminde (20-23 Temmuz 2021 tarihleri arasında) kurbanlık olarakkesimi yapılması muhtemel olan büyükbaş hayvanların deri ve sakatatlarının satışı bu ihale kapsamıdışındadır. İhale başvurusu için gerekli koşullar ve ayrıntılı bilgiler Et ve Süt Kurumu Genel Müdürlüğü nüninternet Web sitesinde yayımlanmıştır. Söz konusu ihale ile ilgili aytıntılı bilgi Et ve Süt Kurumu GenelMüdürlüğü nden alınabilir. İhaleye başvuru için gerekli belgeler 31.03.2021 tarihi saat 14.00 kadar Et ve Süt Kurumu GenelMüdürlüğü Genel Evrak ve Arşiv İşleri Şube Müdürlüğü ne teslim edilecektir. Ön teklifler 06.04.2021 saat 10:00 ile 08.04.2021 saat 16:00 a tarihleri arasında verilecektir. Online Satış Tarihleri: Büyükbaş hayvan derisi (kelle derisi dahil) satış ihalesi:13.04.2021 saat 10:00 da Küçükbaş hayvan derisi satış ihalesi: 13.04.2021 saat:13.04.2021 saat:14:00 da Küçükbaş hayvan bağırsak ihalesi:13.04.2021 saat 16:00 da Büyükbaş hayvan sakatat satış ihalesi (hayvansal yağlar ve işkembe hariç):14.04.2021 saat:10.00 da Küçükbaş hayvan sakatat satışı ihalesi saat:14:00 da yapılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO İhale İlanı (Kuru Kayısı Paketleme)
Sayın Üyemiz, TMO Adıyaman Şube Müdürlüğüne bağlı Malatya Ajans Amirliği TMO-TOBB LİDAŞ(+,- % 20 Ofis opsiyonlu) 4422, 4423 kodlu depolarında stoklu bulunan 22 ton (G3) Kükürtlenmemiş(Naturel) çekirdekleri çıkarılmış bütün kuru kayısıların ofis depolarından nakliyesi dahil imalataverilmesi ve 500 gramlık kavak kutu paketlere ambalajlanması ile 10 (on) kilogramlık çift oluklu dopelkutularda paketlenmesi amacıyla, "Toprak Mahsulleri Ofisi Genel Müdürlüğü 4734 sayılı Kamuİhale Kanunun 3. Maddesinin (g) Bendi Kapsamında Yapacağı Mal ve Hizmet Alımı İhalelerindeUygulanacak Usul ve Esaslar Hakkında Yönetmelik" kapsamında 26.1. Maddesi Teklif Alma Usulüile 18.03.2021 Perşembe günü saat 14.00 de Malatya Ajans Amirliğinde ihaleye çıkılacaktır. İlkihalede istekli çıkmaması halinde 2. kez 19.03.2021 Cuma günü aynı saatte ve aynı yerde yeniden ihaleyapılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Avrupa Çevre Ajansı-Avrupa Konu Merkezleri
Sayın Üyemiz, Avrupa Çevre Ajansı, Avrupa seviyesinde topluma çevreyi korumak için gerekli önlemleri aldıran, alınan önlemlerin sonuçlarını değerlendiren ve çevrenin durumu hakkında kamuyu düzenli olarak bilgilendiren bir Avrupa Birliği kurumudur. Diğer yandan, AÇA, yıllık olarak hazırlanan çalışma programlarında tanımlanan faaliyetlerin yerine getirilmesi için, AÇA dışında oluşturulan "European Topic Centers (ETC)/ Avrupa Konu Merkezlerinden (AKM)" hizmet alımı yapmaktadır. AKM ler, üye ülkelerin kurum ve kuruluşlarından oluşan konsorsiyumlardır. 2022-2026 yılları arası için AÇA tarafından Proje Teklif Çağrısına çıkılmış olup, duyurusu AÇA nın websayfasında (https://www.eea.europa.eu/about-us/tenders/calls-for-proposals/open) ve Çevre ve Şehircilik Bakanlığının websayfasında (https://aca.csb.gov.tr/avrupa-konu-merkezleri-ihale-teklif-cagrisihaber-260127) yayınlanmıştır. Proje çağrısı çerçevesinde, AÇA tarafından, aşağıda belirtilen konularda, söz konusu "Avrupa Konu Merkezlerinden" hizmet alınacaktır. -Biyoçeşitlilik ve Ekosistemler, İklim Değişikliğine Uyum ile Arazi Kullanımı, Arazi Kullanım Değişikliği ve Ormancılık (AKAKDO) -İklim Değişikliğinin Azaltılması -Veri Entegrasyonu ve Dijitalleşme -İnsan Sağlığı ve Çevre -Döngüsel Ekonomi ve Kaynak Kullanımı -Sürdürülebilirlik Eğilimleri, Beklentileri ve Yanıtları Çağrılara ilişkin son teklif sunma tarihi, 29 Nisan 2021 saat 14:00 olarak belirlenmiştir. AKM lerin önemi düşünüldüğünde, Türkiye den de yukarıda bahsi geçen konularda çalışan Oda/Borsalarımız, kamu kurumu, üniversite, araştırma kuruluşu, sivil toplum kuruluşu, danışmanlık şirketi vb. kuruluşların çağrıya yönelik hazırlık yapmaları ve konsorsiyumlarda yer almasına ilişkin girişimlerin başlatılması faydalı görülmektedir. Bu çerçevede, 17 Mart 2021 tarihinde 14:30-16:00 saatleri arasında çevrimiçi olarak bir bilgilendirme toplantısı gerçekleştirilecektir. Toplantı "Cisco Meeting App" üzerinden düzenlenecek olup, bağlantı detayları ve toplantı gündemi ekte yer almaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB Türkiye 100
Sayın Üyemiz, Birliğimiz öncülüğünde Türkiye Ekonomi Politikaları Araştırma Vakfı (TEPAV) ve TOBB Ekonomi ve Teknoloji Üniversitesi (TOBB ETÜ) işbirliğinde, 2011 yılından bu yana Türkiye nin en hızlı büyüyen şirketlerini belirlemek üzere, "TOBB Türkiye 100" programı düzenlenmektedir. 2021 yılı TOBB Türkiye 100, TOBB ve Vodafone işbirliğinde, TEPAV ve TOBB ETÜ nün katkılarıyla düzenlenecektir. Türkiye 100 ile Türkiye nin hızlı büyüyen şirketlerinin başarılarına küresel ölçekte dikkat çekerek küresel bağlantılarını kuvvetlendirmek başarı hikayelerinin ulusal ve uluslararası yazılı ve görsel basında yer almasını sağlayarak doğru iş ortaklarına, yeni müşterilere ve yatırımcılara erişimlerini kolaylaştırmak hedeflenmektedir. Türkiye 100 programında dereceye giren şirketler tamamen objektif kriterlere dayanılarak tespit edilmektedir. Satış gelirleri artış hızının temel performans kriteri olduğu olduğu değerlendirmelerde, en yüksek satış gelirleri artış hızını yakalayan şirket birinciliği almaktadır. 2020 yılında TOBB Türkiye 100 ödül töreni TOBB Başkanı M. Rifat HİSARCIKLIOĞLU ve Ticaret Bakanı Ruhsar PEKCAN ın katılımlarıyla, pandemi koşulları sebebi ile online olarak düzenlendi ve Türkiye nin en hızlı büyüyen ilk 100 şirketi ödüllerini aldı. 2021 yılında Vodafone un katkıları ile düzenlenecek TOBB Türkiye 100 programında şirketlerin 2017 - 2019 dönemindeki yıllık ortalama satış gelirlerinin artış hızı dikkate alınacaktır. Başvuru kriterini sağlayan şirketler büyüme hızlarına göre sıralanacak, en hızlı büyüyen şirket birinciliği alacaktır. Türk özel sektörünün dünyayla olan bağlantılarının kuvvetlendirilmesine imkan sağlayacak olan TOBB Türkiye 100 e başvuru şartları ekte yer almakta olup, başvuruların en geç 31 Mart 2021 tarihine kadar https://turkiye100.tobb.org.tr üzerinden yapılması gerekmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
"Kadingirisimcilikgunu" Türkiye Odalar ve Borsalar Birliği ile Hepsiburada Girişimci Kadınlara Teknoloji Gücü Programı
Sayın Üyemiz, TOBB Girişimcilik Müdürlüğünden 12.03.2021 tarihli yazıda; 8 Mart Dünya Kadınlar Günü’nde Türkiye Odalar ve Borsalar Birliği ve Hepsiburada işbirliğinde gerçekleştirilen “Girişimci Kadınlara Teknoloji Gücü Programı” kapsamında, Mart ayı boyuncasağlanacak birçok fayda ile kadın girişimcilerin e-ticarete katılmalarını amaçladık. İşbirliği kapsamında başvurular 12 - 31 Mart 2021 tarihleri arasında Türkiye Odalar ve Borsalar Birliği web sitesi üzerinden kabul edilmektedir. İşbirliğinden sadece TOBB Kadın Girişimci Kurulları na ve TOBB Genç Girişimci Kurulları na üye vergi mükellefi kadın girişimciler ve daha önce Hepsiburada Girişimci Kadınlara Teknoloji Gücü Programına veya Hepsiburada pazaryerine başvurmamış kadın girişimciler faydalanabilirler. Detaylı bilgi ve başvuru için:http://bilgisistemi.tobbgirisimcilik.org.tr/kadingirisimci ve0850 214 09 15 Hepsiburada Satıcı Destek Hattına ulaşabilirsiniz. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
VERBİS e Kayıt Sürelerinin Uzatılması Hakkında
Sayın Üyemiz, Üyelerimizden gelen talep doğrultusunda üst birliğimiz Türkiye Odalar ve Borsalar Birliği ne(TOBB)iletmiş olduğumuzVERBİS e kayıt sürelerinin uzatılması hakkındaki istemimiz olumlu sonuçlanarak, Kişisel Verileri Koruma Kurulu tarafından konuya ilişkin bir karar yayımlanmıştır. Buna göre; Yıllık çalışan sayısı 50 den çok veya yıllık mali bilanço toplamı 25 milyon liradan çok olan gerçek ve tüzel kişi veri sorumluları ile yurt dışında yerleşik gerçek ve tüzel kişi veri sorumlularının, yıllık çalışan sayısı 50 den az ve yıllık mali bilançosu 25 milyon liradan az olup ana faaliyet konusu özel nitelikli kişisel veri işleme olan gerçek ve tüzel kişi veri sorumlularının, kamu kurum ve kuruluşları ile kamu kurumu niteliğindeki meslek kuruluşu veri sorumlularının VERBİS e kayıt sürelerinin 31 Aralık 2021 e kadar uzatıldığı kaydedildi. Ayrıntılı bilgi için tıklayınız. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-Almanya II. Dönem Ortak Ekonomi ve Ticaret Komitesi (JETCO) Toplantısı
Sayın Üyemiz, Türkiye-Almanya II. Dönem Ortak Ekonomi ve Ticaret Komitesi (JETCO) Toplantısının 21 Nisan 2021 tarihinde video konferans yöntemiyle gerçekleştirileceği bildirilmekte ve söz konusu toplantıya yönelik hazırlık çalışmalarında yararlanılmak ve Mutabakat Zaptında yer almak üzere Türkiye-Almanya ticari ve ekonomik ilişkileri hakkında ele alınmasında fayda görülen konulara ilişkin bilgi notu talep edilmektedir. Bu itibarla, hazırlanacak Birliğimiz görüşünde yer almak üzere, Almanya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin görüşlerinizi içeren bir bilgi notunun en geç 15 Mart 2021 Pazartesi günü mesai saati bitimine kadar Birliğimize (E-posta: damla.tufan@tobb.og.tr) iletilmesi gerekmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Python Programlamaya Giriş Eğitimi
Sayın Üyemiz, "Yapay Zeka Eğitim ve Farkındalık Projesi" kapsamında 8-12 Mart 2021 tarihleri arasında 19:00 – 21:00 saatlerinde "Python Programlamaya Giriş Eğitimi" internet üzerinden gerçekleştirilecektir. Eğitime ilişkin davet ekte sunulmaktadır. TOBB, TOBB ETÜ ve Global AI Hub işbirliğinde Yapay Zeka Eğitim ve Farkındalık Projesi kapsamında gerçekleştirilen Python Programlamaya Giriş Eğitimi nde Python da sözdizimi (syntax), veri türleri (data types), operatörler (operators), kontrol akışı (control flows), fonksiyonlar (functions) ve kütüphaneler (libraries) gibi temel konular anlatılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kanada Montreal Liman İdaresi Tarafından Yapılan Bildirim
Sayın Üyemiz, Ottava Ticaret Müşavirliğinden alınan bir yazıya atfen, Kanada nın ikinci büyük limanı olan Montreal Liman İdaresi tarafından 17.02.2021 tarihinde yapılan bildirimde Denizcilik İşverenleri Birliği ile Kanada Kamu Çalışanları Birliği arasındaki müzakere sürecinin askıya alındığı ve iki taraf arasında daha önce yapılan "grev yapmama" yönündeki Anlaşmanın 21.03.2021 tarihinde sona ereceği belirtilerek, Montreal Limanı üzerinden Kanada ile ticaret yapan firmalarımızın Limandaki iş ve işlemlerdeki olası gecikmeleri dikkate almasında fayda olacağı hatırlatılmaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Okul Gıdası Onay Prosedürü
Sayın Üyemiz, Tarım ve Orman Bakanlığı ndan alınan ilgi yazıda; Okul Gıdası Hakkında Tebliğ uyarınca, Okul Gıdası Onay Prosedürü hazırlandığı bildirilmektedir. Söz konusu Prosedür ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bitki Sağlık Sertifikası
Sayın Üyemiz, Tarım ve Orman Bakanlığı Gıda ve Kontrol Genel Müdürlüğünün ülkemize karayoluyla girişi yapılmak istenen bitki, bitkisel ürün ve diğer maddeler için, her taşıma aracına bir Bitki Sağlık Sertifikasının düzenlenmiş olması gerektiği; diğer taraftan, ülkemize demiryolu ve denizyolu aracılığıyla girişi yapılmak istenen ürün sevkiyatlarında, ürün miktarının fazla olması nedeniyle ürünün ayrı vagon/ambar/konteynerlerde bulunması durumunda 1 (bir) Bitki Sağlık Sertifikası düzenlenmesinin sadece; gönderici ve alıcının aynı olması şartıyla, ihracatçı ülke tarafından her bir taşıma aracıyla ilgili (tren, gemi vb.) sevkiyatı tanımlayacak gerekli bilgilerin (vagon/konteyner sayısı, numarası, vb. bilgiler) Bitki Sağlık Sertifikası/konşimento/özet beyan/fatura vb. belgelerde belirtilmiş ve giriş kontrolleri aşamasında doğrulanmasının mümkün olması kaydıyla kabul edileceği belirtilmektedir. Ayrıntılar ekte bilginize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TÜBİTAK Patent ve Ar-Ge Destekleme Çağrıları Bilgilendirme Semineri
Sayın Üyemiz, TÜBİTAK tarafından KOBİ lerin, proje esaslı araştırma faaliyetlerinin desteklenmesi; teknoloji ve yenilik kapasitelerinin geliştirilerek daha rekabetçi olmaları, sistematik proje yapabilmeleri, katma değeri yüksek ürün geliştirebilmeleri, kurumsal araştırma teknoloji geliştirme kültürüne sahip olmaları, ulusal ve uluslararası destek programlarında daha etkin yer almaları amacıyla; - 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı, - 1707 Siparişe Dayalı Ar-Ge Projeleri için KOBİ Destekleme Çağrısı, faaliyete geçirilmiştir. Bu kapsamda TÜBİTAK ve Birliğimiz işbirliğinde 16 Mart 2021 Salı günü Saat 14:00 te ekli program çerçevesinde internet üzerinden bilgilendirme semineri gerçekleştirilecek olup seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Macaristan Hak.
Sayın Üyemiz, Macaristan ın Ankara Büyükelçiliğinin TOBB a ilettiği ilgide kayıtlı yazısında, Macaristan da salgın nedeniyle 1 Mart 2021 tarihinden itibaren yeni kısıtlamaların devreye girdiğini, şimdiye kadar olan seyahat kısıtlamalarının daha da katılaştırıldığı ifade edilmektedir. Yazıda devamla, Macaristan Dışişleri ve Dış Ticaret Bakanı Peter Szijjarto nun kararı çerçevesinde, Türkiye vatandaşlarının da aralarında bulunduğu bazı ülke vatandaşlarının bahsi geçen kısıtlamalardan muaf tutulduğu ve gerçekten iş amaçlı seyahatlerin bundan sonra da şimdiye kadar olan kurallar kapsamında tutulacağı, Macaristan ın 408/2020, (VIII.30.) sayılı Hükümet Kararnamesi ile, Macar vatandaşı olmayan kişilerin, belgelemek koşuluyla, ticaret veya iş amacıyla Macaristan a kısıtlama olmaksızın giriş yapabileceği bildirilmektedir. Ayrıca Macar-Türk ikili ekonomik ilişkilerin geliştirilmesi, mevcut olan veya planlanmış yatırımlara destek için Macaristan Büyükelçiliği ve İstanbul Başkonsolosluğu nun gerekli tüm yardımı sunmakta olduğu ve firmalarımızın dış ticaret ataşelerine başvurabileceği ifade edilmektedir. Macaristan ekonomisine ve Türkiye-Macaristan ikili iktisadi ilişkilere yönelik, basılı olarak da satın alınabilen, Dünya Gazetesi nin özel sayısına Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Macaristan" sayfasından ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Öncelikli Ürün Listesi Tebliği
Sayın Üyemiz, Sanayi ve Teknoloji Bakanlığı nın, yıllık ithalat tutarı 30 milyar doları bulan ürünlerin Türkiye de üretilmesi amacıyla başlattığı Teknoloji Odaklı Sanayi Hamlesi Programı kapsamında, Türkiye nin katma değerli üretiminin artırılması amacıyla 11 nci Kalkınma Planında belirlenen orta-yüksek ve yüksek teknoloji seviyesindeki odak sektörlerde yerli üretimin artırılması için özel destekler verildiği malumunuzdur. 27 Şubat 2021 tarih ve 31408 sayılı Resmi Gazete de yayınlanan "Öncelikli Ürün Listesi Tebliğinde Değişiklik Yapılmasına Dair Tebliğ" ile Teknoloji Odaklı Sanayi Hamlesi Programı nın kapsamı genişletilmiş olup, ilgili tebliğ ekte sunulmaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Staj Seferberliği
Sayın Üyemiz, Cumhurbaşkanlığı İnsan Kaynakları Ofisi ve Birliğimiz arasında 8 Haziran 2020 tarihinde Yetenek Kapısı İş Birliği Protokolü imzalanmış olup bu kapsamda, Cumhurbaşkanlığı İnsan Kaynakları Ofisi tarafından "Staj Seferberliği" programı başlatılmıştır. Cumhurbaşkanlığı İnsan Kaynakları Ofisi tarafından oluşturulan stajyer havuzu aracılığıyla firmalar; adayların kişisel bilgilerini görmeden akademik, sosyal ve sportif başarılarından oluşan yetkinlik puanlarını baz alarak, liyakat esaslı ve şeffaf bir yöntemle staj teklifi sunabilmektedirler. Stajyer adayları, 22 Şubat - 22 Mart 2021 tarihleri arasında kariyerkapisi.cbiko.gov.tr linki üzerinden staj başvurularını yapabileceklerdir. Stajyer havuzu aracılığıyla adaylara ulaşmak isteyen firmaların, kariyerkapisi.cbiko.gov.tr linkinde yer alan "Stajyer Havuzu" bağlantısından stajyer kontenjanlarını güncellemesi önem arz etmektedir. Ayrıntılar ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
1707 Siparişe Dayalı Ar-Ge Projeleri için KOBİ Destekleme Çağrısı 2021-1
Sayın Üyemiz, Müşteri Kuruluş ortaklı Ar-Ge projelerinin desteklenmesi projesi kapsamında 1707 Sipariş Ar-Ge – 2021-1 çağrısı yapılmıştır. KOBİ lerin Ar-Ge ile geliştireceği ve potansiyel müşterisi hazır olan yenilikçi ürünlerin/süreçlerin, bir Müşteri Kuruluş eşliğinde ortaya çıkarılacağı ortaklı projelerin desteklenmesi sağlanabilecektir. Proje desteği ile ilgili detaylı bilgiye ekli bilgi notundan ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yeni Avrupa Bauhausu Girişimi
Sayın Üyemiz, Ticaret Bakanlığından alınan ilgide kayıtlı yazıda, Avrupa için Yeşil Mutabakatın ardından Avrupa Birliği tarafından "Yeni Avrupa Bauhausu - YAB" başlıklı bir girişim başlatıldığı ve bu girişimin, kamu alımlarını etkilemek dahil olmak üzere, yeni yaşama ve inşa etme yolları etrafında düşünceleri, davranışları ve yeni pazar oluşumlarının yeniden şekillendirilmesini amaçladığı belirtilmektedir. Ülkemiz açısından da önem taşıdığı ve takibinin yararlı olacağının değerlendirildiği Yeni Avrupa Bauhausu Girişimine dair özet bir not ekte paylaşılmaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hayvan Pazarının Açılması
Sayın Üyemiz, Covid-19 salgını ile mücadele önlemleri gereği kapatılan İlimiz Tepebaşı İlçesiMuttalip Mahallesinde bulunan Hayvan Pazarı ,Tepebaşı İlçe Hıfzısıhha Kurulunun 02.03.2021 tarih ve64 numaralı kararı ile yeniden açılmış olup kurul kararı ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ücretlendirme uygulamasına tabi plastik poşetlerde yer alacak çevreci sloganlar ve Sıfır Atık Logosu Hk.
Sayın Üyemiz, Çevre ve Şehircilik Bakanlığının ilgide kayıtlı yazısında, 22/12/2020 tarih ve 274510 sayılı Bakan Oluru ile Plastik Poşetlerin Ücretlendirilmesine İlişkin Usul ve Esaslar da güncelleme yapıldığı hatırlatılmaktadır. Bahse konu Usul ve Esaslar ın 5. maddesi 10. fıkrasında yer alan; "Ücrete tabi plastik poşetlerin bir yüzeyinde sadece Bakanlıkça belirlenen çevreci slogan ve Sıfır Atık logosu bulunur, diğer yüzeylerde ise satış noktalarının marka ve logoları bulunabilir. Çevreci slogan ve Bakanlık Sıfır Atık Logosu Bakanlık web sayfasından temin edilen haliyle veya poşet rengine bağlı olarak görünür olması şartıyla tek renk olarak kullanılır." hükmü gereği Çevre ve Şehircilik Bakanlığı tarafından belirlenen çevreci sloganlar ve Sıfır Atık logosu https://cygm.csb.gov.tr/ adresi Duyurular kısmında yayımlanmış olup, ayrıca yazımız ekinde yer almaktadır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Sonrası İnsan Kaynakları Yönetimi Uygulamaları Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden Kısa Çalışma Sonrası İnsan Kaynakları Yönetimi Uygulamaları Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Kısa Çalışma Sonrası İnsan Kaynakları Yönetimi Uygulamaları" başlıklı eğitimde insan kaynakları çerçevesinde kısa çalışma sonrası işyerinde alınması gereken tedbirler, kısa çalışma sonrası insan kaynakları yönetimi süreçleri ve kısa çalışma sonrasındaki prim teşvikleri konuları anlatılacak, eğitim sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin % 70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Eğitime ait ayrıntılar ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Arjantin ve Paraguay İhaleleri Hak.
Sayın Üyemiz, Arjantin ve Paraguay da gerçekleşecek olan ihaleler ilgili linkte yer verilmektedir. Söz konusu ihaleler hakkında detaylı bilgilere Arjantin için, Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Arjantin" bölümünden; Paraguay için, Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Paraguay" bölümünden ulaşılabilmektedir. Yazıda devamla, bahsi geçen ihalelere ilgi duyan firmalarımızın Buenos Aires Ticaret Müşavirliği ile (buenosaires@ticaret.gov.tr; Tel: +54 11 5032 4133 / 4134 Fax: +54 11 4311 6655) temas kurarak destek alabileceği bildirilmektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TOBB UYUM Açılış Töreni
Sayın Üyemiz, Birliğimiz girişimleri ile hukuk uyuşmazlıklarında alternatif uyuşmazlık çözümleri alanında ulusal ve uluslararası hizmet vermek amacıyla kurulan TOBB UYUM Arabuluculuk ve Uyuşmazlık Çözüm Merkezi nin açılış törenine ilişkin borsamıza bilgi verilmişti. Ancak bahsi geçen program gerçekleştirilemediği için ileri bir tarihe ertelenmiş ve Birliğimiz webinar.tobb.org.tr adresinde ertelemeye ilişkin duyuru yayınlanmıştı. Bu kapsamda TOBB UYUM Arabuluculuk ve Uyuşmazlık Çözüm Merkezi nin açılış töreni 11 Mart 2021 Perşembe günü ekli program çerçevesinde Adalet Bakanı Abdülhamit Gül ve Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu nun katılımlarıyla internet üzerinden gerçekleştirilecektir. Açılış töreninin ardından "Arabuluculukta Güncel Gelişmeler Paneli" düzenlenecektir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
AVM ler ve Zincir Marketlerde Sıfır Atık Bilgilendirme Semineri
Sayın Üyemiz, Alışveriş merkezleri ve zincir marketlerde sıfır atık uygulaması hakkında 9 Mart 2021 Salı günü saat 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Çevre ve Şehircilik Bakanlığı ile Birliğimiz işbirliğinde gerçekleştirilecek olan seminerde ekli program çerçevesinde AVM ler ve zincir marketlerde sıfır atık yaklaşımı ve sıfır atık sistemi kurulumu ile sıfır atık bilgi sistemi ve belgelendirme süreci anlatılacak olup, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tekstil, Deri, Hazır Giyim ve Ayakkabı (TDGA) Sektörlerinde Faaliyet Gösteren KOBİ’ler ve Teknoloji Sağlayıcılar Arasında Ortaklıkların Desteklenmesi ELIIT Çağrısı Eğitim Programı
Sayın Üyemiz, Türkiye ve Avrupa Komisyonu arasında İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı (COSME) anlaşması çerçevesinde, COSME Programına ilişkin ulusal koordinatör kuruluş olarak yetkilendirilmiş olan KOSGEB tarafından ülkemizin COSME Programından etkin ve verimli bir şekilde yararlanabilmesi ve sağlanacak faydanın en üst düzeye çıkarılmasını teminen, farkındalık oluşturma ve bilgilendirme çalışmaları yürütülmekte ve duyurular yapılmaktadır. COSME Programı kapsamında; Tekstil, Deri, Hazır Giyim ve Ayakkabı (TDGA) Sektörlerinde Faaliyet Gösteren KOBİ ler ve Teknoloji Sağlayıcılar Arasında Ortaklıkların Desteklenmesi ELIIT Çağrısı Eğitim Programı duyurusu ekte yer almaktadır. 03-04 Mart 2021 tarihlerinde, yazı ekinde duyurulan söz konusu online eğitime cosme.kosgeb.gov.tr adresinden erişilebilecektir. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-Birleşik Krallık STA Bilgilendirme Toplantısı
Sayın Üyemiz, 1 Ocak 2021 tarihinde yürürlüğe giren Türkiye-Birleşik Krallık Serbest Ticaret Anlaşması hakkında üyelerimizin bilgilendirilmesi amacıyla, 11 Mart 2021 tarihinde "Türkiye-Birleşik Krallık Serbest Ticaret Anlaşması Bilgilendirme Toplantısı"nın gerçekleştirileceği bildirilmişti. Toplantıya Birliğimiz Başkanı Sn. Mr. Rifat Hisarcıklıoğlu ve Birleşik Krallık Ankara Büyükelçisi Sn. Dominick Chilcott iştirak edecektir. Taslak programı ekte sunulan bilgilendirme toplantısına katılmak isteyenlerin https://tobborg.zoom.us/webinar/register/WN_4ULSdEdASIGXRvLKzT_liw linki üzerinden kayıt yaptırması gerekmektedir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Bakliyat Peşin Satışlar
Sayın Üyemiz, TMO tarafından toplamda 15 bin ton natürel nohut stoku (14 bin ton ELÜS ve bin ton TMOdeposu) 4,00TL/Kg fiyatla peşin bedel mukabili kişi ve kuruluş ayrımı yapılmaksızın toptan olaraksatışa açılmıştır. ELÜS nohut satışlarından TMO Elektronik Satış Platformuna ve TÜRİB e üye olan tüm kesimlerfaydalanabilecektir. Söz konu stoklar için 03 Mart – 10 Mart 2021 tarihleri arasında TMO ElektronikSatış Platformu üzerinden talep toplanacak, 12 Mart 2021 tarihinde ilgili kişi ve kuruluşlarca Platformüzerinden tahsis miktarları görüntülenebilecektir. 15 Mart - 25 Mart 2021 (dahil) tarihleri arasındaher gün ELÜS tahsis miktarları takas için TÜRİB de işlem görecektir. Kuruluşun depolarında stoklu nohutların satışı Şube Müdürlükleri kanalıyla serbest olarakyapılacaktır. TMO depolarından satışı yapılan nohutlar için para yatırma süresi 25 Mart 2021 tarihinde(mesai bitiminde) sona erecektir. Satışlar stoklarla sınırlı olup güncel stok ve satış fiyatlarımıza ait bilgilere internetsitesinden (www.tmo.gov.tr) ve Şube Müdürlüklerinden ulaşabilirsiniz. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sulama Suyu Yetersizliği
Sayın Üyemiz/Üreticimiz, Eskişehir Sulama Birliğinin 22.02.2021 tarihli ve 44183651-152-78/77 sayılı "Sulama SuyuYetersizliği" konulu yazısı ekte gönderilmiş olup, su sıkıntısı nedeniyle mağduriyet yaşanmaması için gerekenlerin yapılmasını, Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2020Yılında Yapılacak Tarımsal Desteklemelere İlişkin Kararda Değişiklik Yapılmasına Dair Karar
Sayın Üyemiz, Çiftçilere 2020 yılına ilişkin tarımsal destekleme ödemeleri daha yapılmadan, gübre desteği iki katına çıkarıldı. Cumhurbaşkanı Recep Tayyip Erdoğan’ın kabine toplantısının ardından duyurduğu, gübre desteğindeki artışa ilişkin düzenleme Resmi Gazete’de yayınlanarak yürürlüğe girdi. Karar ile birlikte 2020 yılında ilişkin tarımsal desteklerin gübre kalemi, ilk açıklanan rakamın iki katına çıkarıldı. Mazot desteği ise değiştirilmedi. 2020 yılı tarımsal destekleri henüz ödenmedi. 2020 yılı Kasım ayında ilk açıklandığında, buğday, arpa, çavdar, yulaf ve tritikale için dekar başına 8 lira olan gübre desteği 16 liraya çıkarıldı. Diğer tüm ürünlerde 4 lira olan gübre desteği ise 8 liraya yükseltildi. Gübre desteği artışına ilişkin Cumhurbaşkanlığı Kararı 1 Ocak 2020 tarihinden itibaren geçerli olacak. İlgili karar içintıklayınız. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bireysel Sulama Sistemleri Desteği
Sayın Üyemiz, Tarım ve Orman Bakanlığı tarafından uygulanmakta olan Kırsal Kalkınma Destekleri kapsamında , Bireysel Sulama Sistemlerine %50 hibe desteği sağlanacaktır. Başvurulara ilişkin ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO stoklarında bulunan ve ekli listede yer alan hububat (Ek-1) ve bakliyat aşağıdabelirtilen esaslar ve ekte (Ek-2) yer alan fiyatlarla 03 Mart 2021 tarihinden itibaren arpa için peşin veya90 güne kadar vadeli ve vade farksız, diğerleri için ise peşin bedel mukabilinde satılacaktır. Ayrıntılar eklerde bilginize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Kıymetli Yan Ürün Satış İlanı
Sayın Üyemiz, TMO Derince Şube Müdürlüğünce gerçekleştirilen fındık imalatı sonucunda elde edilen kıymetli yan ürünlerin satışı için TMO ihale kanununca pazarlık yöntemine göre 04.03.2021 Perşembe günü saat 14.00 da Derince Şube Müdürlüğünde ihale yapılacaktır. Konu ile ilgili ayrıntılar ekte bilgilerinize sunulmuştur. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Afyonkarahisar TSO - Yeşil Bina Sertifikası Hk.
Sayın Üyemiz, Afyonkarahisar Ticaret ve Sanayi Odası ndan Birliğimize intikal eden 23.02.2021 tarih ve 207 sayılı yazıda, Afyon Ticaret ve Sanayi Odası nın 03 Haziran 2020 tarihinde merkezi İngiltere de bulunan ve yeşil binalar için sertifikalandırma sürecini yöneten BREEAM tarafından (Building Research Establishment Enviroiunental Assessment Method) Outstanding (OIağanüstü) seviyede "Yeşil Bina Sertifikası" aldığı belirtilmektedir. Aynı yazıda, BREEAM kurumunun "Yeşil Bina Sertifikası" alan tüm binalar arasında en iyisini seçmek için çevrimiçi oylama süreci başlattığı ve 23 - 25 Mart 2021 tarihleri arasında çevrimiçi ödül töreni yapılacağı belirtilmiştir. Bu kapsamda, 22 Mart 2021 tarihine kadar devam edecek olan çevrimiçi oylama sürecine katılarak Afyon Ticaret ve Sanayi Odası nın projesini desteklemenizden memnuniyet duyulacaktır. https://www.breeam.com/awards/vote/your-breeam-2021/ Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Pakistan a İhracatta Karşılaşılan Tarife Dışı Engeller
Sayın Üyemiz, Türkiye-Pakistan Yüksek Düzeyli Stratejik İşbirliği Konseyi (YDSK) 6. Dönem Toplantısı nın, Cumhurbaşkanımız Recep Tayyip Erdoğan eş başkanlığında, 13-14 Şubat 2020 tarihlerinde İslamabad da gerçekleştirildiği ve söz konusu toplantıda, iki ülke ilişkilerinin geliştirilmesine yönelik olarak "Stratejik ve Ekonomik Çerçeve (SEÇ) ve Eylem Planı nın imzalandığı bildirilmektedir. Toplam 71 maddeden oluşan eylem planı kapsamında yer alan "Ticaret ve Yatırımlar"a ilişkin eylemler Ticaret Bakanlığı koordinasyonunda takip edilmektedir. Türkiye-Pakistan Yüksek Düzeyli Stratejik İşbirliği Konseyi (YDSK) 7. Dönem Toplantısı nın, bu kez, iki ülke devlet başkanlarının katılımıyla 2021 yılı içerisinde ülkemizde gerçekleştirilmesi planlanmaktadır. SEÇ Eylem Planı nın Ticaret alt başlığının 2. maddesi; "Elimination of Non-Tariff Barriers and strengthening cooperation on TBT and SPS measures: Both sides have agreed in principle to eliminate Non-Tariff Barriers and strengthening cooperation on Technical Barriers to Trade (TBT) and Sanitary and Phytosanitary Measures (SPS) including collaboration between national accreditation bodies, accredited and/or authorized certification bodies, testing laboratories and centers." şeklindedir. Pakistan a ihracat işlemleri sırasında karşılaşılan "Tarife Dışı Engel" olarak bildirilebilecek hususları eskisehirtb@tobb.org.tr e-posta adresine iletilmesi rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşbirliği Talebi - Bangladeş
Sayın Üyemiz, Bangladeş te uzun yıllardır faaliyet gösterdiği belirtilen Globe Janakantha Shilpa Paribar Ltd. firmasının, başta kırmızı mercimek olmak üzere diğer sebze ve baharatlar için Türkiye den ihracatçılarla iletişim kurmak istediği bildirilmektedir. Firmanın temas kişisi ve almak istediği ürünlerin listesi ekte iletilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs ile Mücadelede Kontrollü Normalleşme Süreci
Sayın Üyemiz, 1 Mart 2021 günü Sayın Cumhurbaşkanımız Başkanlığında gerçekleştirilen Kabine Toplantısında; Yeni Kontrollü Normalleşme Sürecine dair temel usul ve esaslar, Sağlık Bakanlığı ve Koronavirüs Bilim Kurulu nun tavsiyeleri göz önünde bulundurularak belirlenmiştir. Cumhurbaşkanlığı Kabinesi nde alınan kararlar çerçevesinde; 1.Sağlık Bakanlığı ve Koronavirüs Bilim Kurulu tarafından tespit edilen kriterlere göreiller 4 ayrı risk grubuna (düşük, orta, yüksek, çok yüksek) ayrılaraksalgınla mücadeledeki tedbir seviyeleri risk gruplarına göre belirlenecektir. 2. Yeni bir karar alınıncaya kadar ise illerimizin risk grupları aşağıdaki şekilde belirlenmiştir: Düşük Risk Grubunda Yer Alan İller Ağrı, Batman, Bingöl, Bitlis, Diyarbakır, Hakkari, Iğdır, Mardin, Muş, Siirt, Şanlıurfa, Şırnak, Uşak, Van. (14 İl) Orta Risk Grubunda Yer Alan İller Adana, Afyonkarahisar, Ankara, Aydın, Bartın, Bayburt, Bursa, Çankırı, Çorum, Denizli, Elazığ, Erzincan, Erzurum, Eskişehir, Gaziantep, Hatay, Isparta, Kahramanmaraş, Karabük, Kars, Kastamonu, Kırşehir, Malatya, Manisa, Nevşehir, Sivas, Tunceli, Yozgat. (28 İl) Yüksek Risk Grubunda Yer Alan İller Antalya, Ardahan, Artvin, Bilecik, Bolu, Çanakkale, Düzce, İstanbul, İzmir, Karaman, Kayseri, Kırıkkale, Kırklareli, Kilis, Kocaeli, Kütahya, Mersin, Muğla, Niğde, Tekirdağ, Yalova, Zonguldak. (22 İl) Çok Yüksek Risk Grubunda Yer Alan İller Adıyaman, Aksaray, Amasya, Balıkesir, Burdur, Edirne, Giresun, Gümüşhane, Konya, Ordu, Osmaniye, Rize, Sakarya, Samsun, Sinop, Tokat, Trabzon. (17 İl) 3.Koronavirüs salgınıyla mücadele kapsamında il bazında alınması gereken tedbirler ile uyulacak kurallar, risk gruplarına göre belirlenmiştir. İlin hangi risk grubunda bulunduğuna göre Vali tarafından Hıfzıssıhha Kurul kararlarının alınması ve 02.03.2021 tarihinden itibaren uygulamaya geçirilmesi sağlanacaktır. 4.Risk gruplarına göre uygulaması değişkenlik gösterecek olan sokağa çıkma kısıtlamaları sırasında 30.11.2020 tarih ve 20076 sayılı Bakanlık Genelgemizle belirlenen“Sokağa Çıkma Kısıtlamasından Muaf Yerler ve Kişiler Listesinde”yer alan istisna/muafiyetler (sonraki Genelgelerle yapılan eklemeler dahil şekilde) ile sokağa çıkma kısıtlaması uygulanan süre ve günlerde şehirlerarası seyahat edilmesine dair usul ve esasların uygulanmasına aynı şekilde devam edilecektir. Sokağa çıkma kısıtlaması kapsamında; - Hafta içi günlerde 21.00-05.00 saatleri arasında tüm Türkiye’de sokağa çıkma kısıtlaması uygulanacaktır. - Hafta sonlarında ise; Düşük ve orta risk grubunda yer alan illerimizde hafta sonu sokağa çıkma kısıtlaması, hafta içinde olduğu gibi 21.00-05.00 saatleri arasında uygulanacaktır. Yüksek ve çok yüksek risk grubunda yer alan illerimizde hafta sonu sokağa çıkma kısıtlaması, Cuma 21.00-Cumartesi 05.00 saatleri arasıyla Cumartesi 21.00’den başlayıp Pazar gününün tamamını kapsayıp Pazartesi günü saat 05.00’de bitecek şekilde uygulanacak olup bu illerimizde Cumartesi günleri 05.00-21.00 saatleri arasında sokağa çıkma kısıtlaması uygulanmayacaktır. 5.Düşük ve orta risk grubunda yer alan illerimizde; 65 yaş ve üzeri vatandaşlarımız ile 20 yaş altı genç ve çocukların sokağa çıkma kısıtlaması kaldırılacaktır. Yüksek ve çok yüksek risk grubunda yer alan illerimizde; 65 yaş ve üzeri ile 20 yaş altıvatandaşlarımız için getirilen sokağa çıkma süreleri 3 saatten 4 saate yükseltilecek, 65 yaş ve üzeri vatandaşlarımız10.00-14.00 saatleri arasında, 20 yaş altı çocuklarımız ve gençlerimizise 14.00-18.00 saatleri arasında sokağa çıkabilecektir. Yüksek ve çok yüksek risk grubunda yer alan illerimizde; Milli Eğitim Bakanlığınca yüz yüze eğitim/sınav yapması uygun görülen eğitim kurumlarının öğrenci/öğretmen/çalışanlarının durumlarını eğitim kurumlarınca verilecek kurum adresi ile çalışma/ders programını ihtiva eden belge ile belgelendirmeleri şartıyla, güzergah ve ilgili saatlerle sınırlı olacak şekilde sokağa çıkma kısıtlamasından muaf tutulacaktır. 6.Düşük, orta ve yüksek risk gruplarında belirlenen kapasite oranlarına göre 07.00-19.00 saatleri arasında faaliyet gösterecek olan yeme-içme yerleri (lokanta, restoran, kafeterya, pastane, tatlıcı vb.) ile kıraathane ve çay bahçesi gibi işyerleri için Sağlık Bakanlığı Covid-19 Salgın Yönetimi ve Çalışma Rehberinde yer alan mesafe koşulları (masalar ve koltuklar arası) göz önünde bulundurularak açık ve kapalı alanlar için ayrı ayrı olacak şekilde % 50 kapasite sınırlaması oranı uygulanarak mekanda bulunabilecek masa-koltuk sayısı ve aynı anda bulunabilecek azami kişi sayısı tespit edilecektir. Bu risk gruplarındaki yeme-içme yerleri 19:00-21.00 saatleri arasında paket servisi veya gel-al şeklinde, 21.00-24.00 saatleri arasında ise sadece paket servis şeklinde hizmet verebileceklerdir. Çok yüksek risk grubunda yer alan illerimizde bulunan yeme içme yerleri, 10.00-20.00 saatleri arasında paket servisi veya gel-al şeklinde, 20.00-24.00 saatleri arasında ise sadece paket servis şeklinde hizmet verebilecek olup ayrıca işyeri içerisinde hizmet sunamayacaklardır. Covid-19 Salgın Yönetimi ve Çalışma Rehberindeki mesafe kuralları ile Ek-1’de yer alan tabloda belirtilen kapasite kullanım oranlarına göre her bir yeme-içme yeri için oturma düzeni planı hazırlanacak ve içeride aynı anda bulunacak müşteri sayısı müşterilerin içeriden ve dışarıdan rahatlıkla görebileceği şekilde ilan edilecektir. HES kodu kontrol edilmeksizin müşteri kabul edemeyecek olan yeme-içme yerlerinde onaylanan oturma düzeninde belirtilen şeklin dışında mekanda kesinlikle fazladan masa-koltuk bulundurulmasına müsaade edilmeyecektir. 7.Düşük ve orta risk grubunda yer alan illerimizde; girişlerde HES kodu kullanılması ve seyirci/refakatçi/misafir alınmaması kaydıyla halı saha, yüzme havuzu vb. tesisler 09.00-19.00 saatleri arasında çalışabilecektir. Halı saha, yüzme havuzu ve benzeri tesisler yüksek ve çok yüksek risk grubunda yer alan illerimizde yeni bir karar alınıncaya kadar kapalı kalmaya devam edecektir. 8.Düşük ve orta risk grubunda yer alan illerimizde; nikah ve nikah merasimi şeklindeki düğünler, kişi başına minimum 8m² alan ayırmak, katılımcı sayısı 100’ü geçmemek ve 1 saatle sınırlı olmak üzere yapılabilecektir. Yüksek ve çok risk grubunda yer alan illerimizde; nikah ve nikah merasimi şeklindeki düğünler, kişi başına minimum 8m² alan ayırmak, katılımcı sayısı 50’yi geçmemek ve 1 saatle sınırlı olmak üzere yapılabilecektir. 9.Sivil toplum kuruluşları, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üst kuruluşları ile birlikler ve kooperatifler tarafından düzenlenecek genel kurul dahil kişilerin bir araya gelmesine neden olan her türlü etkinlikleri düşük, orta ve yüksek risk gruplarında; kişi başına 8 m² alan bırakma ve aynı anda bulunabilecek azami kişi sayısı 300’ü geçmemek üzere ilgili kurum/kuruluşların yetkililerince her türlü tedbir alınarak yapılabilecektir. Çok yüksek risk grubunda yer alan illerimizde ise yeni bir karar alınıncaya kadar, sivil toplum kuruluşları, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üst kuruluşları ile birlikler ve kooperatifler tarafından düzenlenecek genel kurul dahil kişilerin bir araya gelmesine neden olan her türlü etkinlik ertelenecektir. Ayrıca denetim faaliyetlerinin kesintisiz yürütülmesi amacıyla yukarıda belirtildiği şekilde kişilerin bir araya gelmesine neden olacak her türlü etkinliğin Valilik/Kaymakamlıklara (ilgili mevzuatında başkaca bir hüküm bulunmadığı takdirde en az üç gün öncesinden) bildirilmesi sağlanarak bu kurum/kuruluşlarca yapılacak etkinliklerde belirlenen kurallara ve kişi ve alan sınırlamalarına riayet edilip edilmediğinin denetim ekiplerince kontrol edilmesi sağlanacaktır. 10.Benzer şekilde nikah veya nikah merasimi şeklindeki düğünlerde de kişi ve alan sınırlamalarının kontrolünün sağlanması için nikah ve/veya düğün salonu işletmelerince yapacakları her türlü organizasyon öncesinde kişisel verilere yer verilmeksizin hangi günde hangi saat aralıklarında nikah veya nikah merasimi şeklindeki düğün organizasyonu yapacaklarının en az üç gün öncesinden Valilik/Kaymakamlıklara e-Devlet kapısından İçişleri Bakanlığı e-başvuru sistemi üzerinden ya da doğrudan dilekçe ile bildirilmesi sağlanacaktır. 11.2021/5 sayılı Cumhurbaşkanlığı Genelgesiyle kamudaki çalışma saatleri tüm Türkiye’de normale döndürülmüş olup Valiliklerce gerek görülmesi halinde Hıfzıssıhha Kurulu kararıyla kademelendirilmiş mesai başlama ve bitiş saatleri tespit edilebilecektir. 12.Salgınla mücadelede kalıcı başarının sağlanması için temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanını kapsayacak şekilde belirlenen kurallara/tedbirlere toplumun tüm kesimlerince azami düzeyde uyulması büyük önem taşımaktadır. Bu çerçevede yürütülecek denetim faaliyetlerinin etkinliği ve sürekliliği kadar aziz milletimizin bu güne kadar sergilediği sağduyulu ve fedakârca yaklaşımını sürdürmesi de sürecin bir an evvel neticelenmesini doğrudan etkileyecektir.
İstihdam teşvikleri
Sayın Üyemiz, 7256 Sayılı Bazı Alacakların Yeniden Yapılandırılması İle Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun ile 4447 Sayılı Kanun a eklenen maddeler ile yeni istihdam teşvikleri getirilmiş ve mevcut maddelere yapılan düzenlemeler ile bir kısım istihdam teşviklerinin ise süresi uzatılmıştır. Buna göre ülkemizde halihazırda uygulaması devam eden; - 5510 sayılı Sosyal Sigortalar ve Genel Sağlık Sigortası Kanununda 7, - 4447 sayılı İşsizlik Sigortası Kanununda 8, - 4857 sayılı İş Kanununda 1, - 5746 sayılı Araştırma, Geliştirme ve Tasarım Faaliyetlerinin Desteklenmesi Hakkındaki Kanunda 1, - 5225 sayılı Kültür Yatırımları ve Girişimlerini Teşvik Kanununda 1, - 2828 sayılı Sosyal Hizmetler Kanununda 1, - 3294 sayılı Sosyal Yardımlaşma ve Dayanışmayı Teşvik Kanununda 1, - 6331 sayılı İş Sağlığı ve Güvenliği Kanununda 1, olmak üzere toplamda 21 prim teşvik, destek ve indirim uygulaması bulunmaktadır. Söz konusu teşvik, destek ve indirim uygulamalarının yasal dayanaklarına, açıklamalarına, başlangıç ve bitiş tarihlerine, yararlanma şartlarına ve teşvik tutarlarına, SGK tarafından hazırlanarak web sitesinde yayımlanan ve ekte bulunan sunumdan erişebilirsiniz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Cezayirli Sorunlu İthalatçı Firmalar
Sayın Üyemiz, Cezayir Ticaret Müşavirliği nden iletilen bir yazıya atfen, ihracatçı firmalarımızın ticari ilişkilerinde haksız şekilde sorun yaşadıkları aşağıda isimleri belirtilen Cezayirli ithalatçı kişi ve firmalar ile ticari münasebette bulunacak ve/veya bulunma ihtimali olan firmalarımızın ihtiyatlı olmaları istenmektedir. Cezayir e ihracat yapan firmaların sorun yaşadığı kişi ve firmalar: - SARL RK INTERNATIONAL - SARL SARL UFMATP AZIEZ ET ASSOCIES - SARL AGRO ALIMENTAIRE INTERNATIONAL GAFS IMPORT EXPORT - SARL SENIA ELECTRIQUE - BENHADDOU BOUCIF (Şahıs), (Adres: 14 ILOT 07 ZONE OUED TLELAT/ORAN) Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşveren ve İşveren Vekilinin İSG Eğitim Rehberi
Sayın Üyemiz, Aile, Çalışma ve Sosyal Hizmetler Bakanlığı İş Sağlığı ve Güvenliği Genel Müdürlüğünce 29.06.2015 tarihli ve 29401 sayılı Resmi Gazete de yayımlanarak yürürlüğe giren "İşyerlerinde İşveren veya İşveren Vekili Tarafından Yürütülecek İş Sağlığı ve Güvenliği Hizmetlerine İlişkin Yönetmelik"in 2 nci maddesi kapsamındaki işveren veya işveren vekillerine yönelik yapılacak iş sağlığı ve güvenliği eğitim programları için kaynak olarak "İşveren veya İşveren Vekilinin İş Sağlığı ve Güvenliği Eğitim Rehberi" hazırlanmıştır. Söz konusu Rehber ile Yönetmelik kapsamında eğitimi tamamlayarak işyerlerinde iş sağlığı ve güvenliği hizmetlerini üstlenecek işveren ve işveren vekillerine, bu hizmetleri işyerinde yürütmeleri sırasında yol göstermesi amaçlanmıştır. Sınırlı sayıda basılan söz konusu rehberin PDF haline İş Sağlığı ve Güvenliği Genel Müdürlüğünün internet sitesinden (https://www.ailevecalisma.gov.tr/media/65124/isverenvevekiliisgegitimrehberi.pdf) ulaşılabileceği bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Mesleki Eğitim Merkezleri Webinarı
Sayın Üyemiz, Mesleki Eğitim Merkezleri hakkında 2 Mart 2021 Salı günü saat 14:00 te internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin davet ekte dikkatinize sunulmaktadır. Milli Eğitim Bakanlığı, Birliğimiz ve Organize Sanayi Bölgeleri Üst Kuruluşu iş birliğinde gerçekleştirilecek olan seminerde ekli program çerçevesinde Mesleki Eğitim Merkezlerinde uygulanan çıraklık, kalfalık, ustalık ve usta öğreticilik eğitimleri ile işletmelere yönelik devlet katkısı vb. konular anlatılacak olup seminer sonunda konu hakkındaki sorular cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede yapılan “Bankalarca Ticari Müşterilerden Alınabilecek Ücretlere ilişkin yapılan değişiklik” Hk.
Sayın Üyemiz, Resmî Gazete’de yayımlanan Bankalarca Ticari Müşterilerden Alınabilecek Ücretlere İlişkin Usul ve Esaslar Hakkında Tebliğ (Sayı: 2020/4)’in 9 uncu maddesinin birinci fıkrasında yer alan “birini” ibaresi “1,10’unu” olarak değiştirilmiştir. MADDE 2 –Aynı Tebliğin 11 inci maddesine aşağıdaki fıkra eklenmiştir. 1/3/2021tarihinden itibaren kullandırılan kredilerde ticari müşterinin kredinin tamamı için erken ödeme talebinde bulunması halinde banka bu talebi kabul etmek zorundadır.Bu müşteriden Türk lirası krediler için gerekli faiz ve diğer maliyet unsurlarına ilişkin indirimler yapılarak hesaplanan ve müşteri tarafından bankaya erken ödenen tutarın, kalan vadesi yirmi dört ayı aşmayan kredilerde yüzde ikisine, kalan vadesi yirmi dört ayı aşan kredilerde ise yüzde ikinin üzerine kalan vadenin yirmi dört ayı aşan kısmındaki her bir yıl için yüzde bir eklenerek hesaplanan tutara kadar erken ödeme ücreti alınabilir.Söz konusu hesaplamada kalan vadenin yirmi dört ayı aşan kısmındaki süreler yıla tamamlanır. Döviz cinsi veya dövize endeksli kredilerde ise Türk lirası krediler için uygulanacak azami ücretin bir puan artırımlı hali uygulanabilir.” Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TÜRİB Elüs Piyasası Maksimum Emir Miktarı Değişikliği Hk.
Sayın Üyemiz, TÜRİB ELÜS Piyasasında işlem gören tüm ELÜS türleri için normal seansta limit fiyatlı emir olarak bir seferde iletilebilecek azami (maksimum) emir miktarında değişikliğe gidilmiştir. Buna göre; ·Tüm ELÜS türleri için limit fiyatlı emirlerde, bir seferde girilebilecek azami (maksimum) emir miktarı 100.000 kg’ den 200.000 kg’ye çıkarılmıştır. Değişiklik 01/03/2021 tarihli seanstan itibaren geçerlidir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat Satışları
Sayın Üyemiz, TMO Edirne Şube Müdürlüğüne bağlı Gelibolu Ajans Amirliği stoklarında bulunan 1222 kodlu 2.715 ton yerli buğday talep toplamak suretiyle satışa sunulmuştur. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kırsal Kalkınma Destekleri Kapsamında Bireysel Sulama Sistemlerinin Desteklenmesi Hakkında Tebliğ
Sayın Üyemiz, Tarımsal faaliyetler için geliştirilen modern basınçlı bireysel sulama sistemlerinin üreticiler tarafından kullanımının yaygınlaştırılarak; daha kaliteli ve pazar isteklerine uygun üretim yapılmasını sağlamak, kırsal alanda üreticilerin gelir düzeyinin yükseltilmesi için bireysel sulama sistemlerinin desteklenmesine ilişkin usul ve esasların belirlendiği tebliğ Resmi Gazetede yayınlanarak uygulamaya girdi. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Brezilya Yatırım Forumu-2021
Sayın Üyemiz, Brezilya Hükümeti, Interamerican Kalkınma Bankası (Interamerican Development Bank-IDB) ve Brezilya Yatırım Teşvik Ajansı (APEXBrasil) tarafından 31 Mayıs-1 Haziran 2021 tarihlerinde Brezilya nın Sao Paulo şehrinde, Transamerica Oteli nde "Brezilya Yatırım Forumu-2021 (BIF2021)"in gerçekleştirileceği bildirilmektedir. Yazıda devamla, söz konusu Forum un, Brezilya nın federal ve yerel düzeyde üst düzey hükümet yetkilileri, büyük şirket yöneticileri, akademi ve basın yayın temsilcileri ile karar alıcıları bir araya getiren, yabancı yatırım alanında Latin Amerika daki en büyük organizasyon olduğu belirtilmektedir. Forum da bu yıl, tarım, enerji, altyapı, inovasyon, sağlık ve teknoloji sektörlerinde yatırım fırsatlarının değerlendirileceği ifade edilmektedir. Ayrıca, bu yıl Forum un, hem yüzyüze hem de online olarak hibrid şekilde olacağı bildirilmekte olup, Forum da hükümet yetkilileri, çok uluslu şirketlerin CEO ları, üst düzey panellere ve Brezilya daki yatırıma açık kamu-özel sektör proje sunumlarına yer verileceği belirtilmektedir. Bahsi geçen Brezilya Yatırım Forumu-2021 e ilişkin detaylı bilgilere www.brasilinvestment.com adresinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2021 yılı Hayvan Hastalıkları ile Mücadele ve Hayvan Hareketleri Kontrolü Genelgesi
Sayın Üyemiz, Hayvan ve hayvansal ürünlerden insanlara geçen (zoonoz) hastalıkları nedeniyle toplum sağlığıciddi olarak tehdit altında kalabilmektedir. Hayvan sağlığının güvence altına alınmadığı bir ortamdainsan sağlığını korumak ve gıda güvenilirliğini temin etmek mümkün değildir. "Sağlıklı İnsan içinSağlıklı Hayvan" yaklaşımında, hayvan sağlığı ve refahı, gıda güvenilirliği ve halk sağlığı konularındaveteriner hekimlerin önemli sorumlulukları bulunmaktadır. Hayvan hastalıkları ile mücadele yanında, hayvanların kimliklerindirilmesi ve kayıt altınaalınması, hayvan hareketlerinin konrolü, halk sağlığı ve hayvan refahının sağlanması, hastalıkların teşhisve tedavi hizmetleri ile sağlıklı hayvansal ürün elde edilmesine yönelik çalışmalar dagerçekleştirilmektedir. Bu çerçevede 19.02.2020 tarih ve 2020/01 Sayılı Genelge yürürlükten kaldırılmış olup 2021/05sayılı Hayvan Hastalıkları ile Mücadele ve Hayvan Hareketleri Kontrolü Genelgesi 18.02.2021 tarihiitibariyle yürürlüğe girmiştir. Genelge ve eklerine http://eskisehir.tarimorman.gov.tr/ webadresindeki duyurular bölümünden ulaşılabilir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Şirket Kuruluş Sözleşmesinin Ticaret Sicili Müdürlüklerinde İmzalanması Hakkında Tebliğde Değişiklik Yapılmasına Dair Tebliğ
Sayın Üyemiz, Resmî Gazete’de yayımlanan Şirket Kuruluş Sözleşmesinin Ticaret Sicili Müdürlüklerinde İmzalanması Hakkında Tebliğin 1 inci maddesinin birinci fıkrasında yer alan “müdürlüklerinde yetkilendirilmiş personel huzurunda” ibaresi “müdürlüklerine” olarak değiştirilmiştir. Tebliğ hakkında ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Mesleki Eğitim Merkezleri Hk.
Sayın Üyemiz, Mesleki Eğitim Merkezleri, siz üyelerimizin ihtiyaç duyduğu insan kaynağının temin edilmesinde önemli bir misyonu üstlenmektedir. Üyelerimizin Mesleki Eğitim Merkezlerinden insan kaynağı temininde yaşanan sıkıntıların tespit edilerek giderilmesi, sürecin sağlıklı ilerlemesi açısından önem arz etmektedir. Bilindiği üzere 2 Şubat 2021 tarihinde Oda ve Borsa personellerine yönelik Mesleki Eğitim Merkezleri hakkında bilgilendirme semineri düzenlenmiş olup Oda ve Borsa üyelerine yönelik ayrı bir bilgilendirme seminerinin daha düzenlenmesi planlanmaktadır. Söz konusu seminer öncesinde siz üyelerimizin, Mesleki Eğitim Merkezleri ve buradan temin edilen insan kaynağının (çırak, kalfa, usta, vb.) çalışma sürecinde yaşadığı sorunları, mevzuatla ve konuyla ilgili ortaya çıkan diğer sorunların 25 Şubat 2021 tarihine kadar eskisehirtb@tobb.org.tr adresine iletilmesini rica ederiz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Mali Güçlük İçerisindeki Firmalar için Hizmetlerin Geliştirilmesi" İhale Çağrısı
Sayın Üyemiz, Türkiye ve Avrupa Komisyonu arasında İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı (COSME) anlaşması çerçevesinde, COSME Programına ilişkin ulusal koordinatör kuruluş olarak yetkilendirilmiş olan KOSGEB tarafından ülkemizin COSME Programından etkin ve verimli bir şekilde yararlanabilmesi ve sağlanacak faydanın en üst düzeye çıkarılmasını teminen, farkındalık oluşturma ve bilgilendirme çalışmaları yürütülmekte ve duyurular yapılmaktadır. COSME Programı kapsamında "Mali Güçlük İçerisindeki Firmalar için Hizmetlerin Geliştirilmesi" ihale çağrısı yayımlanmış olup, söz konusu çağrıya ilişkin bilgiler ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İzmir Tarıma Dayalı İhtisas Organize Sanayi Bölgeleri Projelerinin Tanıtımı Hakkında
Sayın Üyemiz, İzmir Ticaret Odası nın; İzmir Tarıma Dayalı İhtisas Organize Sanayi Bölgeleri projeleri hakkındaki yazısı ve bilgi notu ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye-AB İş Dünyası Diyaloğu Projesi Yüksek Düzeyli İş Dünyası Diyaloğu Etkinliği
Sayın Üyemiz, Avrupa Birliği nin sağladığı mali destekle Birliğimiz ve "Avrupa Ticaret ve Sanayi Odaları Birliği" (EUROCHAMBRES) işbirliğinde yürütülmekte olan "Türkiye-AB İş Dünyası Diyaloğu (TEBD)" projesi kapsamında, 10-11 Mart 2021 tarihlerinde, "Türkiye-AB Yüksek Düzeyli İş Dünyası Diyaloğu" etkinliği, online toplantı platformunda gerçekleştirilecektir. Bakanlarımız, Avrupa Komisyonu Üyeleri, Türk ve Avrupa iş dünyasının önemli temsilcileri ve Uluslararası Finans Kuruluşlarının üst düzey yetkililerinin katılım sağlayacağı, "Türkiye-AB Yüksek Düzeyli İş Dünyası Diyaloğu" etkinliğinde, "Yüksek Düzeyli Açılış Oturumu", "AB Yeşil Mutabakatı çerçevesinde AB-Türkiye Ekonomik ve Ticari İlişkileri ve Ortak Zorluklar", "AB Yeşil Düzenine Geçişte Mesleki Beceriler", "Toparlanma, Yatırım ve Sürdürülebilir Finansman", "Döngüsel Ekonomi" başlıklarında dört tematik alan ile genel kapanış oturumları yer almaktadır. Etkinlik 10 Mart 2021 tarihinde, 10:30-12:00 saatleri arasındaki yüksek düzeyli açılış oturumu ile başlayacak olup, etkinlik boyunca Türkçe ve İngilizce simültane çeviri sağlanacaktır. Etkinliğe katılmak için gündemin de yer aldığı http://events.tebd.eu/event/high-level-business-dialogue internet adresinden kayıt yaptırılması gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
XIII. Kurumsal Yönetim Zirvesi
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği ve Türkiye Kurumsal Yönetim Derneğinin iş birliğinde 24 - 25 Şubat 2021 tarihlerinde ekli program çerçevesinde "Sürdürülebilir İş Dünyasının Pusulası: Kurumsal Yönetim" konulu XIII. Kurumsal Yönetim Zirvesi gerçekleştirilecektir. Başkanımız M. Rifat HİSARCIKLIOĞLU nun da katılımlarıyla internet üzerinden gerçekleştirilecek olan zirvede XI. Kurumsal Yönetim Ödülleri de sahiplerini bulacaktır. Zirveye ilişkin davet ekte sunulmaktadır Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler, Belarus ve Slovakya
Sayın Üyemiz, Ticaret Bakanlığı ndan alınan ilgide kayıtlı yazıda, 23 Şubat 2021 Salı günü 14.00-15.30 saatleri arasında Belarus ta; 25 Şubat 2021 Perşembe günü 14.00-15.30 saatleri arasında Slovakya da görev yapmakta olan Ticaret Müşavirlerimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak söz konusu ülkelerde ticaret ve yatırım fırsatları ile tecrübelerini paylaşacağı bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu toplantılara katılmak isteyen firmalarımız detaylı bilgilere Belarus için; Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Belarus" ve Slovakya için; Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Slovakya" bölümlerinden ulaşabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hırvatistan Yatırım Fırsatları Kataloğu
Sayın Üyemiz, Zagrep Ticaret Müşavirliğimizden alınan bir yazıya atfen, Hırvatistan Ekonomi ve Sürdürülebilir Kalkınma Bakanlığı tarafından hazırlanan Yatırım Fırsatları Kataloğunun güncellendiği, konuyla ilgili detaylara http://investcroatia.gov.hr/en/ecatalog/ sayfasından ulaşılabileceği bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Sayın Üyemiz, Her yıl Almanya nın Hannover şehrinde düzenlenen dünyanın en önemli ve kapsamlı sanayi fuarı olarak kabul edilen Hannover Messe Fuarı Türkiye milli iştirak organizasyonunun, 1992 yılından itibaren İstanbul Ticaret Odası (İTO) tarafından düzenlendiği belirtilmekte ve Fuarın bu yıl sağlık koşulları nedeni ile 12-16 Nisan 2021 tarihleri arasında sanal olarak düzenleneceği ve İTO nun da "Dijital Pavilyon" organizasyonu ile katılım sağlayacağı aktarılmaktadır. Hannover Messe 2021 Sanal Fuarına, Akışkan Gücü, Hidrolik ve Pnömatik, Basınçlı Hava ve Vakum Teknolojisi, Dijital Ekosistemler, Enerji, Lojistik ve Yan Sanayi ihtisas konularında faaliyet gösteren firmalarımız iştirak edebileceklerdir. Fuar katılım bedeli 12.000 TL olup, detaylı bilgiler ve sözleşme örneği ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İş Sağlığı Güvenliği (İSG) eğitimi
Sayın Üyemiz, Fırat Üniversitesi Rektörlüğünden Borsamıza gönderilen yazıda, Kurumunbünyesinde açılacak olan İş Sağlığı Güvenliği (İSG) eğitimi için hazırlanmış ilan ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Erişilebilirlik Farkındalık Sertifikası
Sayın Üyemiz, Engelli ve Yaşlı Hizmetleri Genel Müdürlüğünce Ülkemizde erişilebilirliğin yaygınlaştırılmasıiçin sertifika düzenlenerek paylaşılması, her vatandaşın bu konuda farkındalığının arttırılarak sosyalmedya hesapları üzerinden paylaşım yapmasının engelli ve yaşlı bireylere yönelik erişilebilirlikfaaliyetleri açısından farkındalık yaratılmasını planlamaktadır. Erişilebilirlik bütün hizmetlerin kapısıdırdiyerek, bu kapsamda sizler tarafından ilgili adres ziyaret ederek sertifikanızı https://erisilebilirsertifika.ailevecalisma.gov.tr/ düzenleyebilir,sosyal medya hesaplarınızdan paylaşabilir " Erişilebilir Türkiye Engelsiz Yaşam İçin Burdayım" diyerekİlimiz adına desteğinizi sunabilirsiniz. Ülkemizde erişilebilirliğin yaygınlaştırılmasına adına farkındalıkoluşturmak amacıyla düzenlenmiş olan projeye ilimiz adına gerekli desteğin verilmesi amaçlanmıştır. Eskişehir Ticaret Borsası
Yapay Zeka Eğitim ve Farkındalık Projesi Lansmanı
Sayın Üyemiz, Bilindiği üzere yapay zeka teknolojileri, iş dünyasını hızlı bir şekilde dönüştürmekle birlikte önümüzdeki yıllarda etkisinin daha da artması beklenmektedir. Bu kapsamda; özellikle KOBİ yöneticileri ile çalışanlarının, üniversite öğretim görevlilerinin, üniversite öğrencilerinin, meslek lisesi öğretmenlerinin ve öğrencilerinin hem yapay zeka konusunda farkındalıklarını artırmaya hem de bu alanda teknik eğitim almalarına yönelik kapsamlı bir çalışmaya ihtiyaç duyulmaktadır. Bu kapsamda Birliğimiz ile Global Al Hub iş birliğiyle "Yapay Zeka Eğitim ve Farkındalık" projesi gerçekleştirilecek olup projenin lansmanı Başkanımız Sn. M.Rifat Hisarcıklıoğlu nun katılımlarıyla 23 Şubat 2021 Salı günü saat 14:00 te çevrimiçi olarak yapılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Ödeneği Süresi Uzatıldı
Sayın Üyemiz, Yeni tipkoronavirüs(Kovid-19) nedeniylekısa çalışma başvurusunda bulunan iş yerleri içinkısa çalışma ödeneğinin süresinin31 Mart 2021 e kadar uzatıldığına ilişkinCumhurbaşkanı KararıResmi Gazete de yayımlandı. TürkiyeCumhurbaşkanı Recep Tayyip Erdoğanimzalı "Yeni Koronavirüs (Covid-19) Nedeniyle Dışsal Etkilerden Kaynaklanan Dönemsel Durumlar Kapsamındaki Zorlayıcı Sebep Gerekçesiyle Kısa Çalışma Uygulanan İş Yerleri İçin Kısa Çalışma Ödeneğinin Süresinin Uzatılması Hakkında Karar"Resmi Gazete de yayımlanarak yürürlüğe girdi. Karara göre, 4447 sayılı "İşsizlik Sigortası Kanunu"nun geçici 23 üncü maddesinde belirtilen esaslar çerçevesinde, yeni tip koronavirüs (Kovid-19) nedeniyle dışsal etkilerden kaynaklanan dönemsel durumlar kapsamında zorlayıcı sebep gerekçesiyle 31 Ocak 2021 e kadar (bu tarih dahil) kısaçalışma başvurusunda bulunan iş yerleri için kısa çalışma ödeneğinin süresi, anılan Kanun un ek 2 nci maddesi kapsamındaki uzatma süresiyle sınırlı kalmaksızın, 29 Haziran 2020 tarihli ve 2706 sayılı Cumhurbaşkanı Kararı nda belirtilen esaslar çerçevesinde ve 22 Aralık 2020 tarihli ve 3317 sayılıCumhurbaşkanı Kararı ile uzatılan 2 aylık süreden sonra başlamak üzere 31 Mart 2021 e kadar uzatıldı. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gübre Destekleri Yüzde Yüz Oranında Artırıldı
Sayın Üyemiz, Tarım ve Orman Bakanlığı ndan yapılan açıklamada, Artan gübre fiyatları karşında çiftçilerimizin olumsuz etkilenmemesi ve tarımsal üretimin kesintisiz devam etmesi için mevcut gübre destekleri yüzde yüz artırıldı. Hububatta (buğday, arpa, çavdar, yulaf, tiritikale) dekara 8 TL olan gübre desteği 16 TL ye, diğer ürünlerde dekara 4 TL olan gübre desteği 8 TL ye yükseltildi. Ayrıca organik ve organomineral gübre kullanan üreticilerimize ilave olarak dekara 10 TL olan destekleme ödemesi de dekara 20 TL yeçıkarılmıştır. Gübre desteklerinde yapılan yüzde yüz artış sonrası ödemeler, 2020 yılı üretimini kapsayacak şekilde hesaplanacak ve çiftçimizin kaynağa en fazla ihtiyaç duyduğu bu ilkbahar döneminde hesaplarına yatırılacaktır. Artan gidi maliyetleri karşısında çiftçilerimizi koruyacak ve kollayacak, her türlü tedbir uygulamaya geçirilmektedir. Çiftçimiz üretmeye devam ettiği sürece desteklemeye devam edilecektir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
17.02.2021 Tarihli Resmi Gazete de Yayımlanan Kırsal Kalkınma Destekleri Hakkında Tebliğ
TOBB UYUM Eğitimleri
Sayın Üyemiz, Birliğimiz girişimleri ile hukuk uyuşmazlıklarında alternatif uyuşmazlık çözümleri alanında ulusal ve uluslararası hizmet vermek amacıyla kurulan TOBB UYUM Arabuluculuk ve Uyuşmazlık Çözüm Merkezi ekte tanıtımları yer alan "İş Dünyasında Müzakere ve Arabuluculukta Uzmanlık" ile "Taraf Vekilliği" konularında eğitim düzenlemektedir. Bahsi geçen eğitimler internet üzerinden gerçekleştirilecek olup, eğitim programı hakkında detaylı bilgiye tanıtım metninden ulaşılabilmektedir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Damızlık manda düvesi yetiştiricilerine yüzde 50 hibe desteği sağlanacak
Sayın Üyemiz, Bakanlık tarafından hazırlanan "Damızlık Manda Düvesi Yetiştiriciliğinin Desteklenmesine İlişkin Uygulama Esasları Tebliği", Resmi Gazete de yayımlanarak yürürlüğe girdi. Tebliğle, damızlık manda yetiştiriciliği yapan modern büyükbaş hayvancılık işletmelerinin kurulmasını, ülkenin bu alandaki ihtiyacının karşılanmasını, manda sayısının artırılmasını, et-süt üretiminde verimliliğin ve kalitenin yükseltilmesini, kırsal alanlarda istihdamın geliştirilmesini sağlayacak yatırımların desteklenmesine ilişkin usul ve esaslar belirlendi. Buna göre, tebliğ kapsamındaki desteklerden, yeni yatırım projelerinde inşaat yapımı, hayvan alımı ile makine, alet ve ekipman alımı olarak belirlenen projelerin üçüyle birlikte başvuran damızlık manda yetiştiricileri birliği üyelerine, rehabilitasyon veya kapasite artırımı projelerinde konuya ilişkin Cumhurbaşkanı Kararı kapsamındaki manda yetiştiriciliği yatırım konularından en az birini ihtiva eden projeyle başvuran yatırımcılara destek verilecek. Damızlık manda yetiştiricileri birliklerinin başvurularında, birliğe üyelik şartı aranmayacak. Başvuru yeri, istenecek belgeler ve zamanı Desteklemeden yararlanmak isteyen yatırımcılar, Bakanlıkça belirlenen ve internet sayfasında duyurulan süre içinde yatırımı yapacağı yerdeki il müdürlüğüne müracaat edecek. Başvurular, yapıldığı yıl için geçerli olacak. İstenecek belgeler, Hayvancılık Genel Müdürlüğü tarafından uygulama rehberinde belirtilecek. Aynı konudaki yatırımlarda, diğer kamu kurum ve kuruluşlarının faiz indirimi ve hibe desteği niteliğindeki desteklerinden faydalanan yatırımcıların başvuruları değerlendirilmeyecek. Başvuru sahibi, damızlık manda yetiştiriciliği ve ahır yapımı konularında Bakanlık veya diğer kamu kurum ve kuruluşlarınca uygulanan faiz indirimi veya hibe desteği programlarından yararlanmadığına, yararlanmış ise konuya ilişkin Cumhurbaşkanı Kararı kapsamındaki hibe desteğinin iptal edileceğini kabul ettiğine dair noter tasdikli taahhütname verecek. Yatırım konuları ve hibe oranları Tebliğ kapsamında yeni inşaat yapımı veya kapasite artırımı/rehabilitasyon konusunu kapsayan inşaat yatırımına hibeye esas gerçekleşme tutarının yüzde 50 si oranında destek verilecek. Ayrıca, damızlık dişi manda ve manda boğası, yem karma ve dağıtma makinesi ile gübre sıyırıcı alımlarına hibeye esas alım tutarlarının yüzde 50 si oranında hibe desteği sağlanacak. Konuya ilişkin Cumhurbaşkanı Kararı kapsamında, gerçek veya tüzel kişiler hibe desteğinden bir kez yararlandırılacak. Hibeye esas yatırım konularına ait tutarların üst sınırı, bütçe imkanları dikkate alınarak merkez proje değerlendirme komisyonu tarafından belirlenecek ve il müdürlüklerine bildirilecek. Onaylanan yatırım tutarının üst sınırını aşan kısmı, ayni veya nakdi katkı olarak yatırımcı tarafından karşılanacak. Destekten, projesi onaylanan ve yatırımını tamamlayanlar yararlanacak Konuya ilişkin karar kapsamında uygulanacak hibe desteğinden, projesi onaylanan ve burada belirtilen süre içinde yatırımını tamamlayanlar yararlanacak. Yatırımcılar, kredi veya vergi teşviklerinden faydalanabilecek. Hibe, kapasite artırımı/rehabilitasyon projesi inşaatı, hayvan alımı ile makine ve alet-ekipman alımı konularından en az birini kapsayacak. Yatırım, yer tespit tutanağının düzenlendiği tarih itibarıyla başlayacak ve aynı takvim yılı içinde tamamlanacak. Yatırımların son tamamlanma tarihi ilgili takvim yılının kasım ayının son iş günü olacak. Termin planına göre yükümlülüklerini yerine getirmeyen, süresi içinde yatırımını tamamlamayan veya yatırım yapmaktan vazgeçen yatırımcının projesi iptal edilecek ve bunlar hibe desteğinden yararlandırılmayacak. Cumhurbaşkanı Kararı uyarınca yapılacak ödemeler, Bakanlığın ilgili yıl bütçesine tahsis edilen ödeneklerden karşılanacak. Ödemeler, banka aracılığıyla yapılacak. Uygulama için bankaya destekleme tutarının yüzde 0,2 si oranında hizmet komisyonu ödenecek. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TÜRİB Kayıtlarının Yenilenmesi
Sayın Üreticimiz; Tarımsal faaliyetlerinizi Eskişehir ili sınırları içerisinde yürütmeniz, Ürün teslimlerinizi Eskişehir ili sınırları içerisindeki Lisanslı Depo İşletmelerine yapmanız nedeniyle, ürün teslimi ile ilgili tahsilat süreçlerinde karşılaşacağınız sorunların en kısa sürede çözüme kavuşturularak hızlı sonuç elde edilebilmesi adına, kayıtlı olduğunuz TÜRİB Acentesi hesabınızı (Eskişehir ili dışında faaliyette bulunan Acente ise) T.C. Eskişehir Ticaret Borsası Türib Acentesine kayıt ettirmeniz sizlerin menfaatine olacaktır. Bilgi için İrtibat Kişisi; SİNAN ÖZCAN / Tel: 0222 237 27 83 Başvuru dilekçe örneği ekte bilginize sunulmuştur. ESKİŞEHİR TİCARET BORSASI
Promosyon Kampanyalarında Dikkat Edilmesi Gereken Hususlar
Sayın Üyemiz, Promosyon kampanyalarında dikkat edilmesi gereken hususlara ilişkin Ticaret Bakanlığı Tüketicinin Korunması ve Piyasa Gözetimi Genel Müdürlüğü nden alınan E-93327413-402-00060972003 sayılı yazı ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yeni açılan Ro-Ro hatları
Sayın Üyemiz, Ülkemiz ihracatının değer bazında % 30 unun gerçekleştirildiği uluslararası karayolu taşımacılık sektörü, yurtdışında yetersiz geçiş belgesi kotaları, mod ve güzergah dayatmaları, geçiş ücretleri gibi engellerle karşılaşmaktadır. Ayrıca, Avrupa ya yönelik ihraç taşımalarımızda en önemli çıkış noktası durumundaki Kapıkule de araç yoğunluğu nedeniyle yaşanan beklemeler ve gecikmeler taşımacılık ve dış ticaretimizde zaman kayıplarına ve maliyet artışlarına yol açmakta, ihraç ürünlerimizin uluslararası alanda rekabet gücünü zayıflatmaktadır. Dolayısıyla, karayolu taşımacılığında kullanılacak alternatif güzergah ve rotalar her geçen gün önem kazanmaktadır. Bu kapsamda, 03.02.2021 tarihinde faaliyete başlayan Karasu-Köstence (Romanya) ve 07.02.2021 tarihinde seferlerine başlanan Alsancak-Tarragona (İspanya) Ro-Ro hatlarının karayolu taşımacılığında yaşanan sorunlara önemli çözüm alternatifleri oluşturacağı öngörülmektedir. Bu sayede, özellikle Avrupa ya yönelik ihracatımızda bazı dönemlerde yaşanan sıkıntılarda azalma yaşanacağı düşünülmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Cosme ELIIT Projesi 2. Çağrısı
Sayın Üyemiz, Türkiye ve Avrupa Komisyonu arasında İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı (COSME) anlaşması çerçevesinde, COSME Programına ilişkin ulusal koordinatör kuruluş olarak yetkilendirilmiş olan KOSGEB tarafından ülkemizin COSME Programından etkin ve verimli bir şekilde yararlanabilmesi ve sağlanacak faydanın en üst düzeye çıkarılmasını teminen, farkındalık oluşturma ve bilgilendirme çalışmaları yürütülmekte ve duyurular yapılmaktadır. COSME kapsamında yer alan "ELIIT Projesi (European Light Industries Innovation and Technology Project)" çağrısı yayınlanmış olup, söz konusu çağrıya ilişkin bilgiler ekteki dokümanda yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COVID-19 Salgını Kapsamında Çalışma Yaşamına Getirilen Yeni Düzenlemeler Eğitimi
Sayın Üyemiz, KOBİ lere ve KOBİ çalışanlarına yönelik olarak internet üzerinden, COVID-19 Salgını Kapsamında Çalışma Yaşamına Getirilen Yeni Düzenlemeler Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim Araştırma ve Uygulama Merkezi (TOBB ETÜ SEM) tarafından gerçekleştirilen eğitimde COVID-19 salgını kapsamında çalışma yaşamına getirilen yeni düzenlemeler çerçevesinde TOBB ETÜ Öğretim Üyesi Prof. Dr. Cem Kılıç tarafından kısa çalışma ödeneği, ücretsiz izin, fesih yasağı ve uzaktan çalışma uygulamaları anlatılacak, eğitim sonunda katılımcılara sorucevap imkanı verilecektir. Eğitimin %70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler- Peru ve Ekvator
Sayın Üyemiz, Ticaret Bakanlığı ndan alınan yazıda, 9 Şubat 2021 Salı günü 16.30-18.00 saatleri arasında Peru da ve 11 Şubat 2021 Perşembe günü 16.30-18.00 saatleri arasında Ekvator da görev yapmakta olan Ticaret Müşavirlerimiz ve Ataşelerimiz ile bu ülkelerde iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini Türk iş insanlarıyla paylaşacağı e-sohbet toplantılarının gerçekleştirileceği bildirilmektedir. Bahsekonu toplantılara ilişkin detaylı bilgilere Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkanları/Ülke duyuruları/Peru" ve "Uluslararası İş İmkanları/Ülke duyuruları/Ekvator" bölümlerinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Alışveriş Merkezi ve Zincir Marketlerin Açılış ve Faaliyete Geçiş Kriterlerinin Belirlenmesi Hakkında Yönetmelik Taslağı
Sayın Üyemiz, Ticaret Bakanlığı Hukuk Hizmetleri Genel Müdürlüğü nden Birliğimize intikal eden E-27299683-010.03- 00061242638 sayılı yazıda; alışveriş merkezleri ile gıda perakende sektöründe faaliyet gösteren zincir marketlerin açılış ve faaliyete geçişinde gözetilecek kriterlerin belirlenmesine yönelik düzenleme yapılması ihtiyacı hâsıl olduğu belirtilmiş olup, yazımız ekinde sunulan söz konusu taslağa ilişkin görüş ve önerilerinizin Mevzuat Hazırlama Usul ve Esasları Hakkında Yönetmelikte yer alan ve ekte gönderilen içerikler dikkate alınarak hazırlanması ve en geç 10.02.2021 tarihi mesai bitimine kadar Borsamız eskisehirtb@tobb.org.tr adresinden iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Perakende Ticaretin Düzenlenmesine İlişkin Mevzuat Değişikliği
Sayın Üyemiz, Ticaret Bakanlığı Hukuk Hizmetleri GenelMüdürlüğü nden TOBB a intikal eden E-27299683-010.01- 00061242635 sayılı yazıda; perakende ticaretin düzenlenmesine ilişkin mevzuatta değişiklik yapılması ihtiyacı hâsıl olduğu belirtilmiş olup, yazımız ekinde sunulan söz konusu taslağa ilişkin görüş ve önerilerinizin Mevzuat Hazırlama Usul ve Esasları Hakkında Yönetmelikte yer alan ve ekte gönderilen içerikler dikkate alınarak hazırlanması ve en geç 10.02.2021 tarihi mesai bitimine kadar Borsamızeskisehirtb@tobb.org.tr adresinden iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yiyecek ve İçecek Hizmeti Faaliyetlerinde Bulunan İşletmelere Yapılacak Destek
Sayın Üyemiz, Yiyecek ve içecek hizmeti faaliyetlerinde bulunan işletmelere koronavirüs salgını nedeniyle verilecek ciro kaybı desteği hakkında karar Resmi Gazetede yayınlanarak yürürlüğe girmiştir. Ayrıntılar linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Yan Ürün Satışı İhale İlanı
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gelen yazıda, TMO Yerköy Şube Müdürlüğünce gerçekleştirilen yeşil mercimek eleme ve kalibrasyon işleri neticesinde oluşan 33.730 kg Fotosel iadesi 17.518 kg kalburaltı, 12.352 kg Hafif Tane ve 1.636 kg Kaba Yab. Mad. sap saman için TMO İhale yönetmeliğinin (22/4) göre 08.02.2021 Pazartesi günü saat 14:00 da satış ihalesi yapılacaktır, bilgisi yer almaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kredi Borçlarının Ertelenmesi
Sayın Üyemiz, Resmi Gazetede yayınlanan, Covid-19 Salgını nedeniyle zarar gören esnaf ve sanatkarın, Türkiye Halk Bankası Anonim Şirketince düşük faizli kullandırılmasına ilişkin kararlar kapsamındaki kredi borçlarının ertelenmesi dair ekli Karar ile yürürlüğe konmuştur. Kanunun ayrıntıları ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KKB Bilgilendirme Semineri
Sayın Üyemiz, Findeks Kredi Notu, kredi notu yükseltme yöntemleri, Risk Raporu, Çek Raporu, Findeks Karekodlu Çek Sistemi ve Elektronik Teminat Mektubu hakkında 11 Şubat 2021 Perşembe günü saat 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Kredi Kayıt Bürosu (KKB) ile Birliğimiz işbirliğinde gerçekleştirilecek olan seminerde ekli program çerçevesinde işletmelere yönelik olarak KKB nin ürün ve hizmetleri anlatılacak olup, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşbirliği Talebi-Bangladeş
Sayın Üyemiz, Ticaret Bakanlığının ilgide kayıtlı yazısı ile, Dakka Ticaret Müşavirliğinden alınan bir yazıya atfen, Bangladeş te boya, mürekkep ve toz boya sanayiinde faaliyet gösteren Noorjahan International Indentor and Machinary&Chemicals firmasının bu alanlarda ve farmasötik sektöründeki çeşitli makine ve aletler ile sıvı dolum makineleri veya Bangladeş te satılabilecek diğer makineler için (tarım ve tekstil makineleri gibi) Türk firmalarının yerel acentesi olarak işbirliği yapma talebi bildirilmektedir. Bahsi geçen Noorjan International Indentor and Machinary&Chemicals firmasına ait sertifika ve detaylı bilgilere https://www.tobb2b.org.tr/ihaleyatirimprojeleri.php adresinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TÜBİTAK 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı
Sayın Üyemiz, Üniversitelerde, araştırma kurumlarında ve teknoloji geliştirme bölgelerinde geliştirilen patentli teknolojilerin sanayiye aktarılmasını sağlamak için Yenilik Destek Programı kapsamında TÜBİTAK tarafından 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı açılmış olup, konu ile ilgili detaylı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Bakliyat Peşin Satışları
Sayın Üyemiz, TMO Stoklarında toplamda 7 bin 647 ton natürel nohut stoku (6.304 ton ELÜS ve 1.343 ton TMOdeposu) 4,00TL/Kg fiyatla peşin bedel mukabili kişi ve kuruluş ayrımı yapılmaksızın toptan olaraksatışa açılmıştır. ELÜS nohut satışlarından TMO Elektronik Satış Platformuna ve TÜRİBE üye olan tüm kesimlerfaydalanabilecektir. Söz konu stoklar için 01 Şubat – 09 Şubat 2021 tarihleri arasında TMO ElektronikSatış Platformu üzerinden talep toplanacak, 12 Şubat 2021 tarihinde ilgili kişi ve kuruluşlarca Platformüzerinden tahsis miktarları görüntülenebilecektir. 15 Şubat - 24 Şubat 2021 (dahil) tarihleri arasındaher gün ELÜS tahsis miktarları takas için TÜRİB de işlem görecektir. Kuruluşumuz depolarında stoklu nohutların satışı Şube Müdürlüklerimiz kanalıyla serbest olarakyapılacaktır. TMO depolarından satışı yapılan nohutlar için para yatırma süresi 24 Şubat 2021 tarihinde(mesai bitiminde) sona erecektir. Ayrıntılar için TIKLAYINIZ. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat Satışları (Genel ve Sözleşme Bazında)
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, TMO Stoklarında bulunan ve ekli listede yer alan hububat ve bakliyat ekte yer alan esas ve fiyatlarla 01 Şubat 2021 tarihinden itibaren buğday,mısır ve nohut için peşin bedel mukabilinde arpa için peşin veya 90 güne kadar vadeli ve vade farksız olarak satılacağı belirtilmektedir. Konu ile ilgili ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İŞKUR Genelgesi
Sayın Üyemiz, Dünyayı etkisi altına alan koronavirüs (Covid-19) salgınının istihdam üzerindeki olumsuz etkilerinin azaltılması, salgın nedeniyle işçi ve işverenler üzerinde oluşan yükün sosyal devlet ilkesi gereğince paylaşılması ve giderilmesi, normalleşme sürecinde hareketlenecek ekonomik aktivitenin istihdamla desteklenmesi ve istihdamda devamlılığın sağlanabilmesi amacıyla destek tedbirlerinin düzenlendiği 7256 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun 17 Kasım 2020 tarihli ve 31307 sayılı Resmi Gazete de yayımlanmıştır. 7256 sayılı Kanunun 14 üncü maddesi ile 4447 sayılı İşsizlik Sigortası Kanununa eklenen geçici 29 uncu maddesinde; "Yeni Koronavirüs (Covid-19) sebebiyle işverenlerin yaptıkları zorlayıcı sebep gerekçeli kısa çalışma başvurularının alınması, değerlendirilmesi ve ödenmesine ilişkin işlemler hakkında Bakanlık ve Kurum personeline herhangi bir sorumluluk yüklenemez. Bu kapsamda 2020 Ekim ayı ve öncesi döneme ait işverenlerin hatalı işlemlerinden kaynaklanan fazla ve yersiz ödemelerden bu maddenin yürürlük tarihi itibarıyla tahsil edilmemiş olanlar terkin edilir. Tahsil edilenler iade veya mahsup edilemez." hükmüne yer verilmiştir. 17/11/2020 tarihi itibarıyla yürürlüğe girmiş olan 4447 sayılı Kanunun geçici 29 uncu maddesi ile 2020 Ekim ayı ve öncesi dönemlere ait işverenlerin hatalı işlemlerinden kaynaklanan fazla ve yersiz ödemelerin terkin işleminin nasıl yapılacağına dair usul ve esaslar Türkiye İş Kurumu Genel Müdürlüğü tarafından çıkartılan 2020/5 sayılı Genelge ile açıklığa kavuşturulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Vergi mükellefleri için mücbir sebep
Sayın Üyemiz, 25/1/2021 tarihli Resmi Gazete de yayımlanan 524 Sıra No.lu Vergi Usul Kanunu Genel Tebliği ile geçici süreliğine faaliyetlerine tamamen ara verilmesine/faaliyetlerinin tamamen durdurulmasına karar verilen sinema salonu, kahvehane, kıraathane, kır bahçesi, internet kafe/salonu, elektronik oyun salonu, bilardo salonu, lokal, çay bahçesi, halı saha, yüzme havuzu, hamam, sauna, masaj salonu ve lunapark gibi faaliyetlere yönelik sektörlerde faaliyet gösteren mükelleflerin mücbir sebep halinde olduğu kabul edilmiştir. Bahsi geçen ana faaliyet alanlarının tespit edilmesinde Tebliğin yayımı tarihi itibarıyla vergi dairesi kayıtlarındaki ana faaliyet kodu dikkate alınır. Bununla birlikte mükellefin, vergi dairesi kayıtlarındaki ana faaliyet kodu itibarıyla kapsamdaki sektörler arasında bulunmamasına rağmen, ana faaliyet alanı olarak bu sektörlerden herhangi birisinde fiilen iştigal ettiğini ispat ve tevsik etmesi halinde, mücbir sebep kapsamında olup olmadığının tespitinde fiilen iştigal edilen ana faaliyet alanı dikkate alınacaktır. Söz konusu sektörlerde faaliyet gösteren mükelleflerin mücbir sebep hali 1/12/2020 tarihinde (bu tarih dâhil) başlayıp, alınan karar kapsamında faaliyetlerine tekrar başlamaları uygun görülen tarihe kadar devam edecektir. Bahse konu mükellefler tarafından mücbir sebep döneminde verilmesi gereken katma değer vergisi ve muhtasar beyannameler ile Ba-Bs bildirimlerinin verilme, e-Defterlerin oluşturma, imzalanma, e-Defter beratları ile e-Defter ve beratların ikincil kopyalarının Gelir İdaresi Başkanlığı sistemlerine yüklenme süresi mücbir sebep halinin sona ereceği tarihi izleyen ayın 26 ncı günü sonuna kadar ve bu beyannamelere istinaden tahakkuk eden vergilerin ödeme süreleri ise beyanname verme süresi uzatılan ilk dönemden başlamak üzere beyannamenin verilmesi gerektiği ayı izleyen aydan itibaren sırasıyla her bir dönem için takip eden ilgili ayın sonuna kadar uzatılmıştır. Sosyal güvenlik mevzuatı gereğince sigortalıların mücbir sebep dönemine ilişkin prime esas kazanç ve hizmet bilgilerinin Muhtasar ve Prim Hizmet Beyannamesi ile bildirilmesinin zorunlu olması durumunda mücbir sebep, bu beyannamelerin vergi kesintilerine ilişkin kısmının beyan ve ödeme sürelerinin ertelenmesi için geçerli olacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bireysel sulama sistemleri yatırımları da kırsal kalkınma desteklerinden yararlandırılacak
Sayın Üyemiz, Bireysel sulama sistemlerine yönelik yatırımlar dakırsal kalkınma desteklerikapsamında desteklenecek yatırımlar arasına eklendi. Kırsal Kalkınma Destekleri Kapsamında Tarıma Dayalı Ekonomik Yatırımlar ve Kırsal Ekonomik Altyapı Yatırımlarının Desteklenmesine İlişkin Kararda Değişiklik Yapılmasına Dair Cumhurbaşkanı Kararı, Resmi Gazete de yayımlanarak yürürlüğe girdi. Değişiklikle, karar kapsamına bireysel sulama sistemlerine yönelik yatırımlar da eklendi. Böylece, bu yatırımlar da kırsal kalkınma desteklerinden yararlandırılacak. Bireysel sulama sistemlerine yönelik yatırımlara da hibeye esas proje tutarı üst limitininyüzde 50 sine kadar hibeyoluyla destek verilecek. Karara göre, yatırım konularına ilişkin usul ve esaslar, bireysel sulama sistemlerine yönelik yatırımlar hakkında çıkarılan tebliğlerle belirlenecek. Söz konusu yatırım konusunun uygulanacağı iller de tebliğle tespit edilecek. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Arazi toplulaştırması ve tarla içi geliştirme hizmetlerine ilişkin usul ve esaslar değiştirildi
Sayın Üyemiz, Arazi toplulaştırması ve tarla içi geliştirme hizmetlerine ilişkin usul ve esaslarda değişiklik yapıldı. Tarım ve Orman Bakanlığının "Arazi Toplulaştırması ve Tarla İçi Geliştirme Hizmetleri Uygulama Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmeliği" Resmi Gazete de yayımlanarak yürürlüğe girdi. Buna göre, isteğe bağlı toplulaştırma, proje alanı içerisinde sayıca ve sahip oldukları arazilerin alansal olarak yüzde 50 den fazlasına malik bulunan arazi sahiplerinin veya kanuni mirasçılarının yazılı muvafakati ile gerçekleştirilecek. Köy tüzel kişilikleri, belediyeler, kooperatifler, birlikler gibi tüzel kişilikler veya kamu kuruluşları, gerekçe raporları ile başvurarak toplulaştırma talebinde bulunabilecek. Gerekçe raporunun yeterli görülmesi durumunda, isteğe bağlı yapılacak arazi toplulaştırması projeleri için proje alanı içerisinde sayıca ve sahip oldukları arazilerin alansal olarak yüzde 50 den fazlasına malik bulunan arazi sahiplerinin veya kanuni mirasçılarının yazılı muvafakati alınacak. Toplulaştırma yapılacak alanda, uygulamayı geciktirmemek için 3 yılı geçmemek üzere, yapılacak bitkisel üretimin tür ve çeşidi, kapsayacağı alan çiftçilerin de katılımıyla Devlet Su İşleri Genel Müdürlüğü (DSİ) veya proje idaresince kararlaştırılacak ve tutanak altına alınacak. Alınan bu karar, gerekçeleriyle DSİ veya proje idaresinin internet sitesinde ve mahallindeki muhtarlık binası, köy konağı ve camisinden birinde ve yerleşim biriminin bağlı olduğu kaymakamlığın ilan tahtalarında duyurulacak. Karara uyulmaması uygulamayı geciktirmeyecek. Arazi toplulaştırma projesinin uygulama çalışmalarına başlanacağı da yerel ekim mevsiminden en az 30 gün önce aynı yöntemlerle duyurulacak. İlgili yönetmeliğe ulaşmak için tılayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirleri ile Elektronik Sohbetler - İngiltere
Sayın Üyemiz, Ticaret Bakanlığı ndan alınan yazıda, 2 Şubat 2021 Salı günü 14:00 - 15:30 saatleri arasında İngiltere de görev yapmakta olan Ticaret Müşavirlerimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak Brexit sonrası dönemde İngiltere ile ticaret ve yatırım fırsatları ile tecrübelerini paylaşacağı bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu etkinliğin programı ve kayıt linki ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Organize Sanayi Bölgeleri ve Sanayi İşletmelerinde Sıfır Atık Yönetim Sistemi Süreci
Sayın Üyemiz, Çevre ve Şehircilik Bakanlığı tarafından Birliğimize iletilen ilgide kayıtlı yazıya göre, 12 Temmuz 2019 tarih ve 30829 sayılı Resmi Gazete de yayımlanarak yürürlüğe giren Sıfır Atık Yönetmeliği nin Ek 1-B sinde yer alan "Bina ve Yerleşkeler İçin Uygulama Takvimi" kapsamında Organize Sanayi Bölgelerinin (OSB) ve içerisinde bulunan tüm işletmelerin 31 Aralık 2020 tarihine kadar Sıfır Atık Yönetim Sistemi kurması ve Sıfır Atık Bilgi Sistemi (SABS) üzerinden sıfır atık belgesi alması gerekmektedir. İlgi yazıda; sıfır atık kapsamındaki tüm iş ve işlemlerin OSB yönetimi tarafından yerine getirilebileceği gibi OSB yönetimi koordinasyonunda da yapılabileceği belirtilerek, süreç ve yapılması gereken çalışmalar hakkında bilgi verilmektedir Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Yapılandırma Başvurularında İşbirliği Talebi
Sayın Üyemiz, Sosyal Güvenlik Kurumu Başkanlığı (Sigorta Primleri Genel Müdürlüğü) tarafından 17.11.2020 tarihli ve 31307 sayılı Resmi Gazete de yayımlanarak yürürlüğe giren 7256 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun kapsamında prim borçlarının yapılandırılmasına ilişkin TOBB a gönderilen ilgi yazıda, yapılandırma başvurularında işbirliği yapılması talep edilmiştir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler- Çin/TMALL
Sayın Üyemiz, Ticaret Bakanlığına bağlı olarak dünyanın dört bir yanında ihracatımızın geliştirilmesi için çalışmakta olan Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere Bakanlığımız tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" toplantılarının düzenlendiği, bu çerçevede, Guangzhou Ticaret Ataşeliğimiz organizasyonunda, Çin in en büyük e-ticaret platformlarından TMALL temsilcisinin konuşmacı olarak katılarak, gıda ve içecek ürünlerine yönelik Çin pazarına sınır ötesi e-ticaret yoluyla nasıl girileceği hususunda bilgi paylaşacağı e-sohbet toplantısının 27 Ocak 2021 Çarşamba günü Türkiye saati ile 14.00 te, İngilizce olarak gerçekleştirileceği bildirilmektedir. Söz konusu toplantının detaylarına Birliğimiz web sayfası "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Çin" kısmından ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
"Akkuyu Nükleer Santral Projesi’nde İhalelerin Takibi ve Tedarikçi Olmak İçin Yapılması Gerekenler" konulu seminer
Sayın Üyemiz, "Akkuyu Nükleer Santral Projesi nde İhalelerin Takibi ve Tedarikçi Olmak İçin Yapılması Gerekenler" konulu seminer, 26 Ocak 2021 Salı günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Enerji ve Tabii Kaynaklar Bakanlığı, Türkiye Odalar ve Borsalar Birliği ve Akkuyu Nükleer Santrali A.Ş. işbirliğinde gerçekleştirilecek olan; "Akkuyu Nükleer Santral Projesi nde İhalelerin Takibi ve Tedarikçi Olmak İçin Yapılması Gerekenler" konulu seminerde, yerli katkının artırılması açısından potansiyel Türk tedarikçilerin Akkuyu NGS Projesi ve ihale kurallarıyla ilgili bilgilendirilmesi, ana yüklenici ile bir araya getirilmesi ve ihalelerin http://www.tobb2b.org.tr adresinde yayınlanması konuları ele alınacaktır. Seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Eskişehir Ticaret Borsası
TOBB Gelenekselden Yeni Normale Yolculuk
Sayın Üyemiz, TOBB; Firmaları dijitalleşen yeni dünyaya hazırlamak için 26-27 Ocak’ta TOBB Dijitalleşme Sanal Fuarı düzenleyerek, Teknoloji şirketleri ve KOBİ’leri bir araya getiriyor. Sorularınız ve işbirliği için davetlisiniz. Bilgi: http://tobb.org.tr/sanalfuar Kayıt: http://sanalfuar.tobb.org.tr Eskişehir Ticaret Borsası
TOBB ve Oda/Borsalar Coğrafi İşaretlere Sahip Çıktı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği (TOBB) ile oda-borsalar coğrafi işaret konusuna sahip çıktı. 2020 yılı itibariyle; Türkiye’de 627 coğrafi işaret koruma altına alındı. Bunların 261’i oda ve borsalar tarafından tescil ettirildi. Tescilde ilk 4 il; Gaziantep, Şanlıurfa, İzmir, Kastamonu oldu. Yine 675 coğrafi işaretli ürün tescili başvurusunun 236 sı oda-borsalarca gerçekleştirildi. Başvuruda ilk 4 il ise; Diyarbakır, Konya, Gaziantep ve Ankara olarak sıralandı. Duyuruya ait detaylar ekte bilgilerinize sunulmuştur. Eskişehir Ticaret Borsası
Sebze ve Meyvelerin Toptan ve Perakende Ticareti Tebliğ Değişiklik Taslağı
Sayın Üyemiz, İlgi : Ticaret Bakanlığı İç Ticaret Genel Müdürlüğü nden alınan 18.01.2021 tarih ve 60681940 sayılı yazı. Ticaret Bakanlığı İç Ticaret Genel Müdürlüğü nden alınan ilgi yazıda; Sebze ve Meyvelerin Toptan ve Perakende Ticaretinde Uyulması Gereken Standart Uygulamalara İlişkin Usul ve Esaslar Hakkında Tebliğ de değişiklik yapılacağı bildirilerek, söz konusu Tebliğ de yapılması düşünülen hususlar hakkında görüş talebinde bulunulmaktadır. Sebze ve Meyvelerin Toptan ve Perakende Ticaretinde Uyulması Gereken Standart Uygulamalara İlişkin Usul ve Esaslar Hakkında Tebliğ de yapılmasını istediğiniz görüşünüz var ise 26.01.2020 tarihi mesai bitimine kadar eskisehirtb@tobb.org.tr e-posta adresine, ekte gönderilen formatta iletilmesini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
“AB Kırsal Kalkınma Politikası”KOBİ Çalıştayı
Sayın Üyemiz, Borsamız, TEBD Projesi kapsamında 30 Ekim 2020 tarihinde düzenlemiş olduğu “AB Kırsal Kalkınma Politikası” konusunda interaktif KOBİ Çalıştayı na ait sunum notları ekte bilgilerinize sunulmuştur. Habere ulaşmak için tıklayınız. Eskişehir Ticaret Borsası
IPARD Kırsal Kalkınma Destekleri Bilgilendirme Semineri
Sayın Üyemiz, TKDK Başkanı Dr. Muhammed Adak’ın katılımıyla TOBB ve TKDK işbirliğinde 21 Ocak 2021 Perşembe saat 14:00’te gerçekleştirilecek olan “IPARD Kırsal Kalkınma Destekleri Bilgilendirme Webinarı”na katılımınızı bekliyoruz. Detaylarhttp://webinar.tobb.org.tr Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Belarus Ekonomi Bakanlığı Girişimcilik Departmanı KOBİ istatistikleri ve 2021 yılı fuar/sergi listesi
Sayın Üyemiz, Dışişleri Bakanlığı nın ilgide kayıtlı yazısı ile, Belarus un Ankara Büyükelçiliği nden alınan bir notaya atfen, Belarus Cumhuriyeti Ekonomi Bakanlığı Girişimcilik Departmanı tarafından hazırlanan, Belarustaki küçük ve orta büyüklükteki işletmelerin gelişimini gösteren bilgiler ile 2021 yılı içerisinde gerçekleştirilmesi planlanan ulusal ve uluslararası fuar/sergi organizasyonlarının listesi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Müşavire Danışın Uygulaması
Sayın Üyemiz, Ticaret Bakanlığına bağlı olarak dünyanın dört bir yanında görev yapmakta olan Ticaret Müşavirlerimiz ve Ataşelerimizin, ihracatımızın ve ülke ekonomimizin daha da gelişmesi için tüm iş insanlarımızın yurtdışındaki ilk temas noktası, en temel bilgi kaynağı ve her zaman başvurabilecekleri temsilciler olduğu belirtilerek, dış temsilciliklerimizin ihracatımızın gelişimine yönelik çalışmalarını desteklemek ve daha etkin hale getirmek amacıyla Ticaret Bakanlığımızca "Dış Temsilcilikler Yönetim Bilgi Sistemi (DTYBS)"nin hayata geçirildiği bildirilmektedir. Yazıda devamla, sistem ile dış temsilciliklerimizin ihtiyaç duydukları bilgi ve belgelere tek ekrandan, daha çabuk bir şekilde ulaşmalarına ve temsilcilik faaliyetleri ile ekonomik ve ticari gündeme dair önemli gelişmeleri anlık olarak Bakanlığımıza bildirmelerine imkân sağlandığı, dış temsilciliklerimize ulaşan firma taleplerinin, başvuru ve cevaplanma süreçlerinin merkezi bir sistemde tutulmasını sağlamak amacıyla oluşturulan "Müşavire Danışın" uygulamasının da geliştirilerek DTYBS nin kapsamına alındığı ve 2 Ocak 2020 tarihinde ihracatçılarımız ile iş dünyamızın hizmetine sunulduğu belirtilmektedir. "Müşavire Danışın" uygulamasının iş dünyamızın Ticaret Müşavir ve Ataşelerimiz ile iletişimini kolaylaştırmayı ve etkinleştirmeyi amaçladığı, söz konusu uygulama kullanılarak, Ticaret Müşavir ve Ataşelerimizden görev yaptıkları ülkelerle ilgili bilgi talep edilmesi, sorular yöneltilmesi ve Müşavirlerimiz tarafından verilen cevapların ve sağlanan bilgilerin uygulama üzerinden takip edilmesinin mümkün olduğu ifade edilmektedir. Ayrıca, "Müşavire Danışın" uygulaması kapsamında iş insanlarımızın doğru bilgiye zamanında erişimini sağlamak amacıyla bir "karar ağacının" da kurgulandığı, ulaşılmak istenen bilginin Ticaret Müşavirlerimiz ve Ataşelerimizle ilgili olmaması durumunda, doğru bilgiye ulaşılabilecek kaynaklara veya temas noktalarına gerekli yönlendirmelerin yapılacağı belirtilmektedir. Bu çerçevede, dış temsilciliklerimize yönelik bilgi taleplerinin 1 Şubat 2021 tarihinden geçerli olmak üzere yalnızca "Müşavire Danışın" uygulaması üzerinden yapılabileceği, firmalarımızın bilgi taleplerini "Müşavire Danışın" uygulamasını kullanarak dış temsilciliklerimize iletmesinin önem arz ettiği ifade edilmektedir. "Müşavire Danışın" uygulamasına Ticaret Bakanlığımız web sayfasından (www.ticaret.gov.tr) ve (https://musaviredanisin.ticaret.gov.tr) adresinden ulaşılabileceği bildirilmektedir. Söz konusu uygulamanın tanıtım videosuna (https://dtuegm.ticaret.gov.tr/haberler/musavire-danisin) linkinden ulaşılabilmektedir. Ticaret Bakanlığı nın ilgi (b) de kayıtlı yazısı ile ayrıca, (DTYBS) girişi yapılan ve ihracatçılarımızın pazara giriş çalışmalarına önemli katkı sağlayacağı değerlendirilen bilgilerin Türk iş dünyası ile paylaşılmasına imkan sağlamak amacıyla "Ticaret Müşavirliklerimizden-Dış Temsilcilikler Bloğu"nun 6 Ocak 2021 tarihi itibarıyle https://dtybs.ticaret.gov.tr/blog/ adresinden yayına başladığı bildirilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
IPARD II. 10. Başvuru Çağrısı
Sayın Üyemiz, IPARD II. 10. Başvuru Çağrısı hakkında 21 Ocak 2020 Perşembe günü saat 14:00 te internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Seminere ilişkin duyuru metni ekte yer almaktadır. Türkiye Odalar ve Borsalar Birliği ile Tarım ve Kırsal Kalkınmayı Destekleme Kurumu işbirliğinde TKDK Başkanı Dr. Muhammed Adak ın katılımı ile gerçekleştirilecek olan seminerde proje başına %40 ile %70 destek oranı bulunan 125 Milyon Avro bütçeli IPARD II 10. Başvuru Çağrısı anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Tüm üyelerimize katılım ücretsizdir. Ayrıntılar Ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
DigiKamp-Digital Dönüşüm Yarışması
Sayın Üyemiz, Ticaret Bakanlığı İhracat Genel Müdürlüğü tarafından TOBB a iletilen; "DigiKamp Dijital Dönüşüm Yarışması" ve "DigiKamp Buluşmaları" hakkındaki yazı ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2021 Tmall Global Sanal Zirvesi
Sayın Üyemiz, Ticaret Bakanlığı nın ilgide kayıtlı yazısında, Pekin Ticaret Müşavirliği nin duyurusuna atfen, Çin pazarının en büyük ve dünyanın en önemli e-ticaret platformlarından biri olan Tmall Global ın 19-21 Ocak 2021 tarihlerinde "2021 Tmall Global New Seller Virtual Summit - Gateway to China on Jan 19 to 21" adlı bir online etkinlik gerçekleştireceği belirtilmektedir. Katılımın ücretsiz olacağı söz konusu etkinlikte, özetle, Çin deki sınır ötesi iş fırsatlarının ve özellikle küçük ve orta ölçekli markaların Tmall da sergilenmesi ve satılmasına ilişkin geliştirilen yeni iş modelinin anlatılacağı ve ayrıca sorusu olan katılımcıların sorularının oluşturulacak ayrı ayrı sanal görüşme odalarında birebir cevaplanacağı belirtilmektedir. Yazıda devamla, anılan etkinliğin Alibaba Grup ve söz konusu grup bünyesindeki Tmall Global firmasının merkezinin bulunduğu Hangzhou nun yanısıra ABD, AB, Güneydoğu Asya, Japonya, Kore, Avustralya ve Yeni Zelanda için ayrı saat dilimlerine göre düzenleneceği, katılımcıların bulundukları bölgeye göre bahsedilen 7 saat diliminden birini seçerek etkinliğe katılabileceği ve faaliyet kapsamında diğer bilgilerin yanısıra 60 ın üzerinde başarı hikayesine ilişkin örnekler de sunulacağı ifade edilmektedir. Kayıt sırasında login detaylarının ve zirve programının iletilebilmesi için aktif bir e-posta adresinin girilmesinin gerektiği ve söz konusu e-postanın zirveden önce gönderileceği belirtilerek ilgilenen firmalarımızın söz konusu etkinlik için "https://lnkd.in/gwAZGSU" adresinden kayıt yaptırmaları gerektiği kaydedilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Teknoloji’de Yerli Üretim ve KOBİ’lerin Gücü Webinarı ve B2B Etkinliği
Sayın Üyemiz, Sanayi ve Teknoloji Bakanı Sn. Mustafa Varank ve TOBB Başkanı Sn. M. Rifat Hisarcıklıoğlu’nun katılımıyla telekomünikasyon sektöründe yerli ürün kullanımını artırmak, Vodafone Türkiye’nin tedarik zincirine katılabilecek KOBİ’ler ile etkin iletişim ve işbirliğinde bulunmak ve potansiyellerini hayata geçirmek amacıyla 20 Ocak 2021 Çarşamba günü Saat 14:00’te ekli program çerçevesindeTeknoloji’de Yerli Üretim ve KOBİ’lerin Gücü Webinarı ve B2B Etkinliğiinternet üzerinden gerçekleştirilecektir. TOBB ve Vodafone Türkiye işbirliğinde internet üzerinden gerçekleştirilecek olan etkinlikte telekomünikasyon sektörü ekosisteminin ihtiyaçları, yerli malı belgesinin faydaları, Ar-Ge, teknoloji ve yerlileştirme alanlarındaki KOSGEB destekleri ile Vodafone Türkiye satın alma politikaları anlatılacaktır. Webinar sonunda kayıt esnasında seçilen ürün grubuna göre KOBİ’ler ile online işbirliği görüşmeleri gerçekleştirilecektir. Kayıt formunahttp://yerlikobi.atolye.tvadresinden erişilebilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14. Asya Finans Forumu
Sayın Üyemiz, Ticaret Bakanlığı nın ilgide kayıtlı yazısında, Hong Kong Ticaret Ataşeliği nden alınan yazıya atfen, Hong Kong un uluslararası bir finans merkezi olduğundan bahisle, Bölge de tertip edilen önemli organizasyonlardan biri olan 14. Asya Finans Forumu nun, 18-19 Ocak 2021 tarihlerinde sanal platform üzerinden düzenleneceği bildirilmektedir. Yazıda devamla, 2021 yılı Asya Finans Forumu program içeriğinin incelenmesinden, etkinlik kapsamında finansal teknolojiler, siber güvenlik, dijital varlıklar, yeşil finansman gibi güncel başlıkların ele alınacağı forumlara katılım mümkün olduğu, buna ilaveten, yatırım projeleri ile finans kuruluşları arasında ticari eşleştirme programlarının organize edileceği belirtilerek Ticari Eşleştirme Programlarında hedeflenen sektörlerin sırası ile temiz enerji üretimi, dijital teknolojiler, eğitim, çevre ve enerji, finansal teknolojiler, gıda ve tarım, sağlık teknolojileri, altyapı ve gayrimenkul hizmetleri olduğu ifade edilmekte, https://www.affdealflow.hk/marketplace?types=Marketplace%3A%3AHktdc2 bağlantısında, programa katılım sağlayan yatırım projeleri / ülke bilgilerine yer verildiği ifade edilmektedir. Ülkemizden her iki kategoride de katılımcının bulunmadığı bahse konu programa, özellikle proje finansmanı ihtiyacı bulunan yatırımcılarımızın kayıt yaptırmalarında ve projeleri ile ilgili detayları etkinliğin resmi web portalı üzerinde yayımlamalarında yarar görüldüğü belirtilmektedir. Asya Finans Forumu na ait bilgilere, www.asianfinancialforum.com bağlantısı üzerinden erişilmesi mümkün olup, ana organizatör HKTDC tarafından katılım ücreti 1.400 ABD Doları olarak belirlenmiştir. Programa dair daha detayda bilgi talep edilmesi halinde ana organizatör HKTDC nin yetkilendirdiği irtibat kişisi ile ülkemizden katılımcıların temas etmesi mümkün olup, ilgili e-posta adresi christopher.sk.lai@hktdc.org olarak bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2021 Tmall Global Sanal Zirvesi
Sayın Üyemiz, Ticaret Bakanlığı nın ilgide kayıtlı yazısında, Pekin Ticaret Müşavirliği nin duyurusuna atfen, Çin pazarının en büyük ve dünyanın en önemli e-ticaret platformlarından biri olan Tmall Global ın 19-21 Ocak 2021 tarihlerinde "2021 Tmall Global New Seller Virtual Summit - Gateway to China on Jan 19 to 21" adlı bir online etkinlik gerçekleştireceği belirtilmektedir. Katılımın ücretsiz olacağı söz konusu etkinlikte, özetle, Çin deki sınır ötesi iş fırsatlarının ve özellikle küçük ve orta ölçekli markaların Tmall da sergilenmesi ve satılmasına ilişkin geliştirilen yeni iş modelinin anlatılacağı ve ayrıca sorusu olan katılımcıların sorularının oluşturulacak ayrı ayrı sanal görüşme odalarında birebir cevaplanacağı belirtilmektedir. Yazıda devamla, anılan etkinliğin Alibaba Grup ve söz konusu grup bünyesindeki Tmall Global firmasının merkezinin bulunduğu Hangzhou nun yanısıra ABD, AB, Güneydoğu Asya, Japonya, Kore, Avustralya ve Yeni Zelanda için ayrı saat dilimlerine göre düzenleneceği, katılımcıların bulundukları bölgeye göre bahsedilen 7 saat diliminden birini seçerek etkinliğe katılabileceği ve faaliyet kapsamında diğer bilgilerin yanısıra 60 ın üzerinde başarı hikayesine ilişkin örnekler de sunulacağı ifade edilmektedir. Kayıt sırasında login detaylarının ve zirve programının iletilebilmesi için aktif bir e-posta adresinin girilmesinin gerektiği ve söz konusu e-postanın zirveden önce gönderileceği belirtilerek ilgilenen firmalarımızın söz konusu etkinlik için "https://lnkd.in/gwAZGSU" adresinden kayıt yaptırmaları gerektiği kaydedilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
AB COSME Programı Çağrı Duyurusu
Sayın Üyemiz, KOSGEB-Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı ndan alınan ilgi yazıda; KOSGEB in Avrupa Birliği İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programının (COSME) ulusal koordinasyonundan sorumlu kurum olarak yetkilendirildiği, ülkemizin COSME Programından etkin ve verimli bir şekilde yararlanabilmesi ve sağlanacak faydanın en üst düzeye çıkarılmasını teminen; proje kapsamında açılan çağrılara ilişkin teklif yazma potansiyeline sahip kurum/kuruluşlara yönelik eğitim ve çalıştayların düzenlendiği ve bu etkinliklerin takibinin cosme.kosgeb.gov.tr adresinden yapılabildiği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Ürün Satışı
Sayın Üyemiz, 19.01.2021 günü saat 10.00 da Şanlıurfa Ticaret Borsasında TİGEM’e ait 2020 yılı istihsali 13.200 ton mahsul 2.ürün dane mısır için açık artırma usulü satış ihalesi yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7256 sayılı Kanun hakkında
Sayın Üyemiz, 7256 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun ile muhtelif kamu alacaklarının yapılandırılması hakkında bilgi notu iletilmiş idi. 30/12/2020 tarihli ve 31350 sayılı Resmi Gazete de yayımlanan 3343 sayılı Cumhurbaşkanı Kararı ile 7256 sayılı Kanunda belirtilen "başvuru" ve "ilk taksit" ödeme sürelerinin anılan maddelerde belirtilen sürelerin bitiminden itibaren bir ay uzatılmasına karar verilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOBİ ler için Ar-Ge destekleri semineri
Sayın Üyemiz, TÜBİTAK tarafından KOBİ lerin, proje esaslı araştırma faaliyetlerinin desteklenmesi; teknoloji ve yenilik kapasitelerinin geliştirilerek daha rekabetçi olmaları, sistematik proje yapabilmeleri, katma değeri yüksek ürün geliştirebilmeleri, kurumsal araştırma teknoloji geliştirme kültürüne sahip olmaları, ulusal ve uluslararası destek programlarında daha etkin yer almaları amacıyla; - 1501 - TÜBİTAK Sanayi Ar-Ge Projeleri Destekleme Programı, - 1507 - TÜBİTAK KOBİ Ar-Ge Başlangıç Destek Programı faaliyete geçirilmiştir. Bu kapsamda TÜBİTAK ve Birliğimiz işbirliğinde 12 Ocak 2021 tarihinde ekli program çerçevesinde bilgilendirme semineri gerçekleştirilecek olup seminer sonunda katılımcıların soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Devlet Destekli Tarım Sigortaları
Sayın Üyemiz, Bilindiği üzere, 24.11.2020 tarihli ve 3205 sayılı Cumhurbaşkanı Kararı ile "Tarım Sigortaları Havuzu Tarafından 2021 Yılında Kapsama Alınacak Riskler, Ürünler ve Bölgeler ile Prim Desteği Oranlarına İlişkin Karar" 25.11.2020 tarihinde Resmi Gazetede yayımlanmış olup, 01.01.2021 tarihinde yürürlüğe gimiştir. Bu çerçevede, söz konusu düzenleme kapsamında gerçekleştirilecek olan yeni uygulamalara ilişkin TARSİM tarafından hazırlanan bilgi notu ekte iletilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
S.S. Eskişehir Pancar Ekicileri Kooperatifinden Çeşitli Hububat Satışı
Sayın Üyemiz, S.S. Eskişehir Pancar Ekicileri Kooperatifinden Borsamıza gönderilen yazıda, eklerde ayrıntıları bulunan çeşitli hububat satışı yapılacağı bildirilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat ve Bakliyat Satışları
Sayın Üyemiz, TMO stoklarında bulunan ekte ayrıntıları bulunan hububat ve bakliyat ekte yer alan fiyatlarla satışa sunulacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Suriye Hibe Un Temini İhalesi
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda, Suriye de yaşayan ve bu ülkedeki olaylardan zarar gören sivil halka yardım amacıyla ekmeklikbuğday karşılığı 17.500 ton (± %20 TMO opsiyonunda) çuvallı unun temin ihalesi, 07.01.2021 tarihi saat10.30 da Genel Müdürlüğümüzde yapılacaktır, bilgisi yer almaktadır. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7256 sayılı Kanun hakkında
Sayın Üyemiz, 7256 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun ile muhtelif kamu alacaklarının yapılandırılması hakkında bilgi notu iletilmiş idi. 30/12/2020 tarihli ve 31350 sayılı Resmi Gazete de yayımlanan 3343 sayılı Cumhurbaşkanı Kararı ile 7256 sayılı Kanunda belirtilen "başvuru" ve "ilk taksit" ödeme sürelerinin anılan maddelerde belirtilen sürelerin bitiminden itibaren bir ay uzatılmasına karar verilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Mal ve Hizmet Tedarikinde Geç Ödemelerde Uygulanacak Temerrüt Faiz Oranı ve Alacağın Tahsili Masrafları İçin Talep Edilebilecek Asgari Giderim Tutarı Hakkında Tebliğ
Sayın Üyemiz, Mal ve Hizmet Tedarikinde Geç Ödemelerde Uygulanacak Temerrüt Faiz Oranı ve Alacağın Tahsili Masrafları İçin Talep Edilebilecek Asgari Giderim Tutarı Hakkında Tebliğ Resmi Gazetede yayınlanmıştır. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Esnaf ve Sanatkarlar ile Gerçek Kişi Tacirlere Yönelik Verilecek Destekler
Sayın Üyemiz, Esnaf ve Sanatkarlar ile Gerçek Kişi Tacirlere Yönelik Verilecek Desteklerde Başvurular 30 Aralık İtibariyle Başlıyor Bilindiği üzereKovid-19 pandemisi nedeniyle ticari faaliyetleri olumsuz etkilenen esnaf ve sanatkârlar ile gerçek kişi tacirlere yönelikGelir Kaybı DesteğiveKira Desteğiverilecektir. Desteklerden 22/12/2020 tarihli ve 3323 sayılı Cumhurbaşkanı Kararı gereği yürürlüğe konulan, 24/12/2020 tarihli ve 31344 sayılı Resmi Gazete’de yayımlanan “Koronavirüs Salgını Nedeniyle Verilecek Hibe Desteği Programı ve Uygulama Esasları Hakkında Tebliğ” kapsamında belirlenen şartları taşıdığı tespit edilen başvuru sahipleri faydalanacaktır. Başvurular yanlızca e-Devlet (turkiye.gov.tr) üzerinden alınacaktır. Destek başvuruları 30 Aralık 2020 Çarşamba günü başlayacak olup 10 gün süre ile (8 Ocak 2021 Cuma gününe kadar) devam edecektir. Online başvuruda yaşanabilecek yoğunluğun, hizmete erişime engel olmasını önlemek için, TC Kimlik Numarasının son hanesine göre aşağıdaki gibi başvuru alınacaktır; Kimlik numarasının son hanesi 0 olan vatandaşlar 30 Aralık 2020 Çarşamba, 2 olan vatandaşlar 31 Aralık 2020 Perşembe, 4 olan vatandaşlar 1 Ocak 2021 Cuma, 6 olan vatandaşlar 2 Ocak 2021 Cumartesi, 8 olan vatandaşlar 3 Ocak 2021 Pazar günü başvurabilecektir. 4-8 Ocak 2021 tarihleri arasında da tüm vatandaşlar başvuruda bulunabilecektir. Başvuru sonuçları destek başvuruları tamamlandıktan sonra www.turkiye.gov.tr adresinden açıklanacaktır. Başvuru süreci sonrası yapılacak değerlendirme sonrasında hak sahiplerine yapılacak ödemeler Ticaret Bakanlığı tarafından açıklanacak tarihte başvuru esnasında verilen banka hesap numaralarına otomatik olarak aktarılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
ELÜS ve Ürün İhtisas Borsası Yönetmeliği`nde Değişiklik Yapıldı
Sayın Üyemiz, ELÜS ve Ürün İhtisas Borsası Yönetmeliği nde değişiklik yapılarak resmi gazetede yayımlandı. Elektronik Ürün Senedi Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelikiçintıklayınız. Ürün İhtisas Borsasının Kuruluş, Faaliyet, İşleyiş ve Denetim Usul ve Esasları Hakkında Yönetmelikte Değişiklik Yapılmasına Dair Yönetmelikte Değişiklik Yapılması Hakkında Yönetmelikiçintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Hayvancılık Desteklemeleri Uygulama Tebliği’nde değişiklik yapıldı
Sayın Üyemiz, Hayvancılık Desteklemeleri Uygulama Tebliği (Tebliğ No: 2020/32)’nde Değişiklik Yapılmasına Dair Tebliğ Resmi Gazete’de yayımlanarak yürürlüğe girdi. Tebliğ içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
U-ETDS Veri Gönderimi
Sayın Üyemiz, Ulaştırma ve Altyapı Bakanlığı tarafında 29.12.2020 tarihinde yayımlanan bir yazıda; yetki belgesi sahiplerinin U-ETDS ye veri gönderme zorunluluğu ile ilgili olarak yapılacak denetimlerin 01.07.2021 tarihinden sonra başlanmasına karar verildiği bilgisine ulaşılmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs Tedbirleri (Geçici/Süreli Düzenlemeler, Karayolu Taşımacılığı)
Sayın Üyemiz, Bilindiği üzere Karayolu Taşıma Yönetmeliği 40 ıncı maddesi 34 üncü fıkrasında "(34) Yetki belgesi sahipleri, ilk yetki belgesi aldıkları tarihten itibaren 6 ay içinde, mesleki yeterlilik ile ilgili aşağıdaki yükümlülüklerini yerine getirmek ve faaliyetleri süresince muhafaza etmekle yükümlüdürler. Buna göre; a) B1, C2, D1, L1, L2, M2, N2, P2, R1, R2 ve T1 yetki belgesi sahiplerinin, en az birer adet üst düzey yönetici ve orta düzey yönetici türü mesleki yeterlilik belgesine sahip olmaları veya bu nitelikleri haiz kişileri istihdam etmeleri, b) A türü ile B2, C3, D2, K3, M1, N1, P1, T2 ve T3 yetki belgesi sahipleri ile tüzel kişiliği haiz K1 yetki belgesi sahiplerinin, en az birer adet orta düzey yönetici türü mesleki yeterlilik belgesine sahip olmaları veya bu nitelikleri haiz kişiyi istihdam etmeleri, c) Adlarına birden fazla yetki belgesi düzenlenmiş gerçek veya tüzel kişilerin, ayrı ayrı yetki belgeleri için uygun mesleki yeterlilik belgesine sahip olması kaydıyla, aynı kişileri beyan edebilmesi, ç) Bu fıkranın (a), (b) ve (c) bentlerine göre istihdam edilen/edilecek mesleki yeterlilik belgesi sahibi kişilerin, yetki belgesi sahibinin çalışanı olduğuna dair Sosyal Güvenlik Kurumundan alınmış belge ile bunlardan yabancı uyruklu olanlar için ayrıca noter onaylı pasaport örneği ve oturma izninin bulunması, zorunludur. Ancak (a) ve (b) bentlerinde belirtilen şartın sağlanamaması veya sonradan kaybedilmesi halinde; yetki belgesi sahiplerinden kamu tüzel kişiliğine sahip olanların en geç bir yıl, diğerlerinin ise bu eksikliği otuz gün içinde ve son kırkbeş gününü herhangi bir yetki belgesi sahibi tarafından istihdam edilmemiş kişi/kişiler ile sağlamaları şarttır. Bu fıkranın (a) ve/veya (b) bentlerine muhalefet eden yetki belgesi sahiplerine, her yetki belgesi ve her bent için ayrı ayrı olmak üzere, Kanunun 26 ncı maddesinin birinci fıkrasının (k) bendinde belirtilen miktarda idari para cezası uygulanır." hükmü yer almaktadır. Bu defa Ulaştırma ve Altyapı Bakanlığından alınan 17.12.2020 tarihinde alınan yazıda; Ülkemizde yaşanan pandemi sürecinde yetki belgesi sahiplerinin mağduriyetlierinin giderilebilmesi adına, KTY nin 40 ncı maddesinin otuzdördüncü fıkrasında belirtilen mesleki yeterlilik belgesi şartının sağlanamaması ile anılan maddede belirtilen 30 günlük sürenin, mesleki yeterlilik şartının sağlanamamasına ilişkin sebeplerin ortadan kalkmasına müteakip, Bakanlıklarınca yeniden bir karar verilinceye kadar uzatılmasına karar verildiği bildirilmektedir. Konuya ilişkin yazının bir örneği ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşten Çıkarma Yasağı İki Ay Daha Uzatıldı
Sayın Üyemiz, Cumhurbaşkanlığının "4857 Sayılı İş Kanununun Geçici 10 uncuMaddesinin Birinci ve İkinci Fıkralarında Belirtilen Sürelerin 17/1/2021 Tarihinden İtibaren İki Ay Uzatılmasına Dair Karar"ı ResmiGazete de yayımlandı. Buna göre 4857 sayılı İş Kanunu uyarınca işverenin 3 aylık süre ile çalışanını işten çıkarma yasağı,17 Ocak 2021 ten itibaren 2 ay daha uzatıldı. Koronavirüs sebebiyle 16 Nisan 2020 tarihinde uygulanmaya başlanan kısa çalışma ödeneği ve işten çıkarma yasağı, 17 Kasım tarihinde iki ay uzatılmış, 17 Ocak tarihine ertelenmişti. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7256 Sayılı Kanun Kapsamında Geçerli Yapılandırmaların Sürelerinde Uzatma
Sayın Üyemiz, 7256 Sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanunun 3 üncü Maddesi ile 4 üncü Maddesinde (Onüçüncü ve Ondördüncü Fıkraları Hariç) Yer Alan Başvuru ve İlk Taksit Ödeme Sürelerinin, Anılan Maddelerde Belirtilen Sürelerin Bitiminden İtibaren Bir Ay Uzatılmasına Dair Cumhurbaşkanı Kararı Resmi Gazete nin 30 Aralık 2020 gün ve 31350 no lu sayısında yayımlanarak yürürlüğe girdi. Kararla birlikte, Vergi ve SGK Borçları Yapılandırma Başvuru Süresi 01.02.2021 Tarihine, Vergi İlk Taksit Ödemesi; 01.03.2021 Tarihine, SGK İlk Taksit Ödemesi; 31.03.2021 Tarihine Uzatılmış oldu. İlgili karar içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Tarımsal Desteklere İlişkin Kararda Değişiklik
Sayın Üyemiz, 2020 Yılında Yapılacak Tarımsal Desteklere İlişkin Kararda Değişiklik Yapılmasına Dair Karar Resmi Gazetede yayınlandı. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Esnafa Verilecek Hibe ve Kira Desteğinde Detaylar Belli Oldu
Sayın Üyemiz, Koronavirüs salgını nedeniyle ticari faaliyetleri olumsuz etkilenen esnaf ve sanatkarlar ile gerçek kişi tacirlere verilecek hibe destek programına ilişkin usul ve esaslar belirlendi. Destek başvuruları ve itirazlar elektronik ortamda www.turkiye.gov.tr internet adresi üzerinden yapılacak. Ticaret Bakanlığı nın Koronavirüs Salgını Nedeniyle Verilecek Hibe Desteği Programı ve Uygulama Esasları Hakkında Tebliğ i Resmi Gazete de yayımlanarak yürürlüğe girdi. Buna göre, destek programı kapsamında hibe, "gelir kaybı desteği" ve "kira desteği" olmak üzere iki şekilde sağlanacak. Destek programının süresi, Bakanlık internet sitesinden yapılan duyuruda belirtilen sürede başvuruların yapılması kaydıyla 2021 yılının ocak, şubat ve mart ayları olmak üzere üç ay olacak. Gelir kaybı desteği olarak, ticari kazançları basit usulde tespit edilenlere, vergiden muaf esnafa ve bunların dışında kalan esnaf ve sanatkarlar ile gerçek kişi tacirlere aylık 1000 lira olmak üzere toplamda 3 bin lira hibe desteği sağlanacak. Gelir kaybı desteğinden faydalanabilecek gerçek kişilerin vergi sicil kayıtlarına göre esas faaliyetlerini yürüttükleri iş yerlerinin kira olması halinde, bu kişilere büyükşehir belediyelerinin bulunduğu yerlerde aylık 750 lira olmak üzere üç aylık toplamda 2 bin 250 lira, diğer yerlerde aylık 500 lira olmak üzere toplamda 1500 lira kira desteği verilecek. İş yeri kira bedelinin kira desteği tutarının altında olması durumunda iş yeri kira tutarı kadar kira desteği ödenecek. Hibe ve kira desteğinden yararlanma koşulları Tebliğle, destek programından yararlanma koşulları da belirlendi. Buna göre, bu destek programından, 14 Aralık tan önce (bu tarih dahil) vergi mükellefiyetini tesis ettirmiş, ticari kazançları basit usulde tespit edilenler, Bakanlık tarafından belirlenen sektörlerde faaliyet gösteren esnaf ve sanatkarlar ve gerçek kişi tacirler ile yine bu tarih itibarıyla esnaf ve sanatkarlar siciline kayıtlı vergiden muaf esnaflar faydalanabilecek. Destek programına başvurabilecek esnaf ve sanatkarlar ile gerçek kişi tacirlerin ekonomik faaliyet tanımları başvuru tarihinden önce Bakanlık internet sitesinden duyurulacak, ayrıca yazılı duyuru yapılmayacak. Bakanlıkça yapılan duyurudan sonra ticari faaliyetine yönelik ekonomik faaliyet tanım değişikliği yapanlar hibe desteğinden yararlanamayacak. Ticari kazançları basit usulde tespit edilenler, esnaf ve sanatkarlar ve gerçek kişi tacirler, hibe desteğinden vergi sicil kayıtlarındaki esas faaliyet konusu üzerinden bir kez faydalanabilecek. Destek başvurusunda bulunanların faaliyetlerini sürdürdükleri ve kira ödemesi yaptığı birden fazla iş yeri bulunması halinde, başvuruda bulunanlar bir iş yeri için kira desteğinden faydalanabilecek. Hibe desteğinden faydalanılan dönemlerde vergi mükellefiyetinin faal olarak devam etmesi gerekecek. Destek başvurusu yapanın faal olmadığının anlaşılması durumunda bu kişilere ödeme yapılmayacak. Diğer kamu kurum ve kuruluşlarınca uygulanan benzer nitelikteki desteklerden faydalanılması, bu destek programından faydalanılmasına engel teşkil etmeyecek. Başvuru ve itirazlar elektronik ortamda yapılacak Bakanlık, destek programının uygulanmasına ilişkin başvuru, değerlendirme, kabul, ödeme, uygulama ve diğer süreçlerde protokol yapılan kurum ve kuruluşlar ile bunların taşra teşkilatına görev ve yetki verebilecek. Destek başvuruları ve itirazlar elektronik ortamda www.turkiye.gov.tr internet adresi üzerinden yapılacak. Başvuruda bulunan tarafından başvuru ve eki taahhütname, elektronik ortamda onaylanacak. Kira desteği başvurusunda bulunanlardan, söz konusu iş yerinin aylık kira bedeli, açık adresi ve iş yerini kiralayanın kimlik bilgilerini başvuru esnasında beyan etmesi istenecek. Beyanda bulunmayanlara kira desteği ödemesi yapılmayacak. Destek programı başvuru süresi, 10 günden az olmamak üzere Bakanlık tarafından belirlenecek. Reddedilen başvurular hakkında ret tarihinden itibaren 10 gün içinde Esnaf, Sanatkarlar ve Kooperatifçilik Genel Müdürlüğüne itiraz edilebilecek. Destek başvurusunun uygun bulunması halinde ilgilinin banka hesabına destek ödemesi yapılacak. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Türkiye’nin KOBİ’leri Bülteni yayımlandı
Sayın Üyemiz, Küçük ve Orta Ölçekli İşletmelerin (KOBİ) ülke ekonomisindeki payına dikkat çekmek ve KOBİ’lere ilişkin verilerin tek bir bülten altında derleyerek erişilmesini kolaylaştırmak amacıyla hazırlanan “Türkiye’nin KOBİ’leri Bülteni” Türkiye Odalar ve Borsalar Birliği (TOBB) tarafından yayımlandı.​ Bültende KOBİ’lerde girişim sayıları, istihdam, personel maliyeti, ciro, satın alışlar, üretim değeri, faktör maliyetiyle katma değer, dış ticaret istatistikleri, nakdi kredi tutarı ile bilişim teknolojileri kullanımı verileri yer aldı. Konu hakkında açıklama yapan TOBB Başkanı M. Rifat Hisarcıklıoğlu, KOBİ’lerin Türkiye ekonomisinin bel kemiğini oluşturduğunu, büyümenin motoru, istihdamın itici gücü, ekonomik ve sosyal kalkınmanın temel taşı olduğunu ifade etti. Hisarcıklıoğlu, 2020 yılının sonuna yaklaşırken, 2019 yılı verilerinin son halinin verildiğini ve bu verilerden yola çıkarak “Türkiye’nin KOBİ’leri Bülteni”ni yayımladıklarını belirtti. Hisarcıklıoğlu, KOBİ’lerin Türkiye ekonomisinde bu kadar önemli bir paya sahip olması sebebiyle ekonomi politikalarının KOBİ’leri önceleyerek hayata geçirilmesi gerektiğini söyledi. -Türkiye’deki tüm işletmelerin % 99,8’i KOBİ Türkiye’nin KOBİ’leri Bülteni’ne göre KOBİ’ler toplam girişimlerin % 99,8’ini oluştururken, KOBİ ölçeğinde girişim sayısı 2019 yılında bir önceki yıla göre % 2,2 artış gösterdi. 2019 yılında Türkiye’deki işletmelerin 8,9 trilyon TL yıllık cirosunun % 65,5’i KOBİ’ler tarafından gerçekleştirildi. KOBİ’lerin cirosunda 2018 yılına göre % 14,5 oranında artış olduğu görülüyor. 2019 yılında KOBİ’ler toplam istihdamın % 73,8’ini oluşturuyor. 2019 yılında ihracatın yüzde 56,3’ü KOBİ’ler tarafından gerçekleştirilirken, KOBİ’lerde toplam ihracat değeri 101,8 milyar dolar oldu. ESKİŞEHİR TİCARET BORSASI
Helal Teknik Eğitimleri
Sayın Üyemiz, Helal Akreditasyon Kurumu tarafından TOBB a intikal ettirilen E-32057160-770 sayılı ve Helal Teknik Eğitimleri konulu yazı ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Avrupa Birliği İşletmelerin ve KOBİ’lerin Rekabet Edebilirliği (COSME) Programı
Sayın Üyemiz, Avrupa Birliği İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programı (COSME) kapsamında, "İnovasyon Alımı Aracılığı: İnovatif Kamu Alımlarının Kolaylaştırılması için Bağlantılar Oluşturma- Creating Links for the Facilitation of Public Procurement of Innovation (COS-LINKPP-2020-2-05)" başlıklı proje teklif çağrısı yayınlanmıştır. Son başvuru tarihi 25 Şubat 2021 olan proje teklif çağrısına ait dokümanlara (başvuru prosedürleri ve rehber), Avrupa Komisyonunun "https://ec.europa.eu/research/participants/data/ref/other_eu_prog/cosme/wpcall/call-fiche_cos-linkpp-2020-2-05_en.pdf" internet sayfasından ulaşılabilmektedir. Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB, elektronik posta: abkoordinasyon@kosgeb.gov.tr), programın ulusal koordinasyonundan sorumlu kurum olarak yetkilendirilmiştir. Bu çerçevede, KOSGEB tarafından, COSME kapsamında açılan çağrılara ilişkin proje teklifi hazırlama konulu eğitim ve çalıştaylar düzenlenmektedir. Bu etkinliklerin takibi cosme.kosgeb.gov.tr adresinden yapılabilir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ölçü Ve Ölçü Aletlerinden Alınacak Muayene Ve Damgalama Ücret Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik
Sayın Üyemiz, Resmî Gazete’de yayımlanan Ölçü ve Ölçü Aletlerinden Alınacak Muayene ve Damgalama Ücret Yönetmeliğinin 1 inci maddesi değiştirilmiştir. Aytıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs Salgını Nedeniyle Verilecek Hibe Desteği Programı Ve Uygulama Esasları Hakkında Tebliğ
Sayın Üyemiz, Resmi Gazetede yayınlanan tebliğde, Koronavirüssalgını nedeniyle ticari faaliyetleri olumsuz etkilenen esnaf ve sanatkârlar ile gerçek kişi tacirlere verilecek hibe destek programına ilişkin usul ve esaslar belirlenmiştir. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
BREXIT Sonrası Ticaret
Sayın Üyemiz, Ticaret Bakanlığı tarafından 15 Aralık 2020 tarihinde gerçekleştirilen ve ilgide kayıtlı yazımızla duyurusuyapılan çevrim içi bilgilendirme toplantısında, üyelerimizin Birleşik Krallık ile ticarette değişen ortamahazırlıklı olmaları ve yeni döneme ilişkin kural/uygulamalar ile muhtemel serbest ticaret anlaşmasına yönelikgelişmeler hakkında bilgi verilmişti. Söz konusu toplantıda belirtildiği üzere, ilgili şirket/işletmelerimizin yeni dönemde Birleşik Krallık ileticarete ilişkin kurallar konusunda Ticaret Bakanlığı ndan görüş, öneri ve değerlendirme alabilmeleriniteminen sta@ticaret.gov.tr elektronik posta adresine soru(n)larını iletebilecekleri bilgisi verilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede, Sebze, Meyve ve Bazı Diğer Malların Ticaretinde Yapılan Düzenleme
Sayın Üyemiz, 5957 sayılı sebze ve meyveler ile yeterli arz ve talep derinliği bulunan diğer malların ticaretinin düzenlenmesi hakkında kanunun 10 uncu maddesinde yer alan parasal sınırların artırılmasına ilişkin tebliğin ayrıntıları linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gelir Vergisi Kanunu, Tevkifat Nispetleri Oranlarında Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede yapılan değişiklik ile Gelir Vergisi Kanunu Tevkifat Nispetleri oranları güncellenmiştir. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Pirinç ithalatında gümrük vergileri indirildi
Sayın Üyemiz, Farklı pirinç türlerine yönelik ithalatta gümrük vergilerinde değişen oranlarda indirime gidildi. Söz konusu gümrük vergisi indirimleri 30 Nisan 2021 tarihine kadar geçerli olacak Pirinç ithalatı gümrük vergilerinde 30 Nisan 2021 tarihine kadar geçerli olacak şekilde farklı oranlarda indirime gidildi. Resmi Gazete de yayımlanan Cumhurbaşkanlığı kararına göre halihazırda gümrük vergisi yüzde 7,5 ile yüzde 34 arasında uygulanan bazı pirinç türlerinde gümrük vergisi 30 Nisan 2021 tarihine kadar bu tarih de dahil olmak üzere yüzde 5 olarak uygulanacak. Halihazırda gümrük vergisi yüzde 36 olan bazı pirinç türlerinde gümrük vergisi 30 Nisan 2021 tarihine kadar bu tarih de dahil olmak üzere yüzde 10 olarak uygulanacak. Halihazırda gümrük vergisi yüzde 45 olan bazı pirinç türlerinde gümrük vergisi 30 Nisan 2021 tarihine kadar bu tarih de dahil olmak üzere yüzde 15 olarak uygulanacak. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa çalışma süresi uzatıldı
Sayın Üyemiz, Pandemi nedeniyle başlayan kısa çalışma ödeneği uygulaması için belirlenen sürede sona yaklaşırken, Resmi Gazete de yayımlanan kararla kısa çalışma ödeneği uygulamasının 28 Şubat 2021 tarihine kadar uzatılmasına karar verildi. Pandemi nedeniyle başlayan kısa çalışma ödeneği uygulaması için belirlenen sürede sona yaklaşırken, Resmi Gazete de yayımlanan kararla kısa çalışma ödeneği uygulamasının uzatılmasına karar verildi. COVID-19 nedeniyle dışsal etkilerden kaynaklanan dönemsel durumlar kapsamındaki zorlayıcı sebep gerekçesiyle kısa çalışma uygulanan işyerleri için kısa çalışma ödeneğinin süresinin uzatılmasına dair Cumhurbaşkanı kararı Resmi Gazete de yayımlandı. Kısa çalışma ödeneği kararında şu ifadelere yer verildi: "Türkiye Cumhurbaşkanı Recep Tayyip Erdoğan imzasıyla yayımlanan karara göre, 4447 sayılı İşsizlik Sigortası Kanununun geçici 23. maddesinde belirtilen esaslar çerçevesinde, COVID-19 nedeniyle dışsal etkilerden kaynaklanan dönemsel durumlar kapsamında zorlayıcı sebep gerekçesiyle 31 Aralık 2020 tarihine kadar (bu tarih dahil) kısa çalışma başvurusunda bulunan işyerleri için kısa çalışma ödeneğinin süresi, anılan Kanunun ek 2. maddesi kapsamındaki uzatma süresiyle sınırlı kalmaksızın 29 Haziran 2020 tarihli ve 2706 sayılı Cumhurbaşkanı kararında belirtilen esaslar çerçevesinde, 26 Ekim 2020 tarihli ve 3134 sayılı Cumhurbaşkanı Kararı ile uzatılan iki aylık süreden sonra başlamak üzere 28 Şubat 2021 tarihine kadar uzatıldı." Kısa çalışma ödeneği nedir? Genel ekonomik, sektörel, bölgesel kriz veya zorlayıcı sebeplerle işyerindeki haftalık çalışma sürelerinin geçici olarak en az üçte bir oranında azaltılması veya süreklilik koşulu aranmaksızın işyerinde faaliyetin tamamen veya kısmen en az dört hafta süreyle durdurulması hallerinde, işyerinde üç ayı aşmamak üzere sigortalılara çalışamadıkları dönem için gelir desteği sağlayan bir uygulamadır. İşçinin Kısa Çalışma Ödeneğinden Yararlanabilmesi İçin; - İşverenin kısa çalışma talebinin iş müfettişlerince yapılacak inceleme sonucu uygun bulunması, - Kısa çalışmaya tabi tutulan işçinin kısa çalışmanın başladığı tarihte çalışma sürelerini ve prim ödeme şartlarını sağlamış olması (Covid-19 etkisiyle yapılan kısa çalışma başvurularında, son 60 gün hizmet akdine tabi olmak kaydıyla son 3 yıl içinde 450 gün prim ödemiş olması), - İş müfettişlerince yapılacak inceleme sonucu kısa çalışmaya katılacaklar listesinde işçinin bilgilerinin bulunması gerekmektedir. Prim ödeme şartını sağlamadığı için kısa çalışma ödeneğine hak kazanamayanların daha önce çeşitli nedenlerle kesilmiş (yeni işe başlama vs.) son işsizlik ödeneği hak sahipliğinden varsa kalan süre kısa çalışma süresini geçmemek üzere kısa çalışma ödeneği olarak ödenir. ESKİŞEHİR TİCARET BORSASI
KKYDP 14. Etap Destekleri
Sayın Üyemiz, Kırsal Kalkınma Yatırımlarının Desteklenmesi Programı (KKYDP) kapsamındaki %50 hibe desteği sağlayan 14. etap kırsal ekonomik altyapı yatırımları ile tarıma dayalı ekonomik yatırımların desteklenmesine ilişkin 2020/24 ve 2020/25 no lu tebliğler yayımlanmıştır. Her iki tebliğe ilişkin bilgi notu ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bankkart Tedarik Zinciri Finansmanı Projesi
Birliğimiz ile Ziraat Bankası, tedarik zincirlerinde finansman kaynaklı yaşanan aksaklıkları ve tahsilat problemlerini gidermek üzere “Bankkart Başak Tedarik Zinciri Finansmanı Projesi” başlatmıştır. Projenin ana amacı tedarikçi ve alıcıların banka üzerinde oluşturulan kapalı devre bir sisteme tanımlanarak, alım-satım işlemlerinin Ziraat Bankası garantörlüğünde gerçekleştirilmesi olup böylece tahsilat konusunda her iki tarafın da riski sıfıra indirilmektedir. Ürünün satıcılar (tedarikçi) açısından faydaları: · Tahsilat riskinin sıfıra indirilmesi · Esnek vade ve taksit imkânları ile daha fazla satış yapabilme imkânı Ürünün alıcılar açısından faydaları: · Finansmana kolay erişim: Ödemeleri taksit ve vadeler ile yapma imkânı · Kredi/çek kullanmadan kendi tedarikçisi ile banka üzerinden ticaret yapması · Artan kredi limitleri Sistem: Alım-satım işlemleri POS cihazları üzerinden işlemektedir. - Tedarikçilerin (Satıcı), POS cihazlarına özel bir yazılım yüklenecektir. - Alıcılara ise, ticari kredi kartı tahsis edilecektir. Bu proje ile tedarikçiler mal teslim ettiği ve alacak kaydettiği firmaların ödemelerini POS cihazı aracılığıyla iki farklı seçenek ile alabilecektir. o Esnek vade seçeneği o Eşit taksit seçeneği · Örnek olarak; - Tedarikçi, 100.000 TL’lik bir mal sattığında, pos cihazına 18 aya kadar aylık ya da 3 aylık eşit taksitlerle ödeme alabilecek, - Aynı şekilde tedarikçi, 100.000 TL’lik mal satışını, tıpkı bir çek gibi maksimum 540 gün olmak üzere vadeli bir şekilde yapabilecektir. Bu durumda 540 gün sonra yapacağı tahsilatta herhangi bir problem yaşamayacaktır çünkü muhatabı artık banka olacaktır. Tahsilatı da bankadan yapacaktır. · Kart limiti tahsisatı bankacılık koşullarına firmanın risk durumuna göre banka tarafından belirlenecektir. Herhangi bir üst limit bulunmamaktadır. · Herhangi bir sektör kısıtlaması yoktur. Oda ve borsa ile sektör meclisi üyesi firmalarımız bu imkândan faydalanabilecektir. · Bu sistem sadece tedarik zincirinde birbirine entegre olmuş ticari işletmeler arasında uygulanacak olup, her satış bu kapsamda değerlendirilemeyecektir. · Örnek vermek gerekirse, bir otel işletmesine gıda tedariki sağlayan bir ticari işletme otel işletmesinin sahip olduğu Bankkart üzerinde vadeli satış yapabilecektir. Detaylı bilgi için sektorler@tobb.org.tr ve guvenliticaret@ziraatbank.com.tr adresiyle iletişime geçebilirsiniz.
Kısa Çalışma Ödeneği
Sayın Üyemiz, 1 Aralık 2020 tarihli ve 31321 sayılı Resmi Gazete de yayımlanarak yürürlüğe giren kısa çalışma ödeneği hakkındaki Cumhurbaşkanlığı Kararı na ilişkin bilgi notu ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Standartların gözden geçirilmesi
Sayın Üyemiz, Türk Standardları Ensitüsü nden TOBB a iletilen bilgilendirmede; uluslararası ve Avrupa Birliği standard hazırlama prosedürleri gereğince, basımı üzerinden 5 yıl geçmiş olan Standardların; revizyon, tadil, yürürlükten kaldırılma veya aynen kabul edilmesini sağlamak amacıyla sistematik olarak gözden geçirildiği, Türk Standardları Enstitüsü tarafından hazırlanmış olan ve 2016 yılında yayımlanmış bulunan Türk standardları ile bu uygulamaya paralel bir çalışmanın başlatıldığı ifade edilmektedir. Buna göre, uluslararası ve Avrupa Birliği prosedürleri ile uyumluluğu sağlamak açısından, Türk Standardlarının ilgili sektör, kurum ve kuruluşlarca gözden geçirilmesi gerekmektedir. Bu sistematik gözden geçirme işlemi, Türk standardlarının revizyonu, tadili, yürürlükten kaldırılması veya aynen kabul edilmesini sağlamak amacıyla yapılmaktadır. Bu standardları bizzat kullanan ve uygulayan tarafların görüşlerinin büyük önemi vardır. Bu bilgiler ışığında, sektörel bazda sınıflandırılmış olan Türk Standartları listesi ve bu standartların işletmeler tarafında gözden geçirilmesini müteakip doldurulması gereken "sistematik gözden geçirme oy formu" https://www.tobb.org.tr/KobiArastirma/Sayfalar/GoruseAcilanTSEStandartlari.php adresinde yer almaktadır. Oy formunun ilgili işletmeler tarafından listedeki faaliyet alanı ile ilgili her standart için ayrı ayrı doldurularak görüşlerin, her sektörel grup için karşılarında verilen e-posta adresine ulaştırılması gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşletme Değerlendirme Raporu (İDR)
Sayın Üyemiz, İşletmelerin mevcut durumlarını, sektörünün gelişimini, sektör içerisinde konumlarını görebilmeleri ve ekonomik faaliyetlerinin yürütülmesinde alacakları kararlarına yardımcı olması amacı ile 2015-2019 yıllarına ait idari kayıtlar esas alınarak Türkçe ve İngilizce olarak hazırlanan, İşletme Değerlendirme Raporu (İDR) edevlet üzerinden işletmelerin erişimine ücretsiz olarak açılmış bulunmaktadır. Konu ile ilgili detaylı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Buğday, arpa ve mısırda sıfır gümrük vergisi kararı uzatıldı
Sayın Üyemiz, Sıfır gümrükle ithal edilen buğday, arpa ve mısır için sıfır gümrük vergisi, 30 Nisan 2021 tarihine kadar uzatıldı. İthalat Rejimi Kararına Ek Karar’da değişiklik yapılarak 10’uncu fasılda bulunan ve halen sıfır gümrükle ithal edilen buğday, arpa ve mısır için sıfır gümrük vergisi, 30 Nisan 2021 tarihine kadar uzatıldı. Karar Resmi Gazete’de yayınlanarak yürürlüğe girdi. Kararda, İthalat Rejimi Kararının eki I sayılı listede yer alan 10.FASIL Başlıklı tablonun sonundaki 1 numaralı dipnot “Gümrük vergisi 30 Nisan 2021’e kadar (bu tarih dahil) yüzde 0 olarak uygulanır” ifadeleri yer aldı. 30 Ekim 2020’de yayınlanan İthalat Rejimi Kararına Ek Karar ile buğday, arpa ve mısırın gümrük vergisi 31 Aralık 2020’ye kadar sıfırlanmıştı. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
81 İle Koronavirüs Salgını Yeni Tedbirler Genelgesi
Sayın Üyemiz, İçişleri Bakanlığından 81 İl Valiliğine “Koranavirüs Salgını” konulu ek genelge gönderdi. Genelgede kontrollü sosyal hayat döneminin temel prensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemlerin Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun önerileri, Sayın Cumhurbaşkanımızıntalimatları doğrultusunda belirlenerek uygulamaya geçirildiği hatırlatıldı. Genelgede, 14 Aralık’ta Sayın Cumhurbaşkanımızınbaşkanlığında toplanan Cumhurbaşkanlığı Kabinesinde, Koronavirüs salgınıyla mücadelede gelinen aşamanın değerlendirilmesi sonucunda ek kararlar alındığı ifade edilerek, alınan ek kararlar şu şekilde sıralandı: 31 Aralık 2020 - 4 Ocak 2021 Tarihleri Arasında Uygulanacak Sokağa Çıkma Kısıtlaması Hafta sonları uygulanan sokağa çıkma kısıtlaması kapsamında, 1 Ocak 2021 Cuma gününün resmi tatil olması da göz önünde bulundurularak, 31 Aralık 2020 Perşembe günü saat 21.00’den başlayacak, 1 Ocak Cuma, 2 Ocak Cumartesi, 3 Ocak Pazar günlerinin tamamını kapsayacak ve 4 Ocak 2021 Pazartesi günü saat 05.00’te tamamlanacak şekilde sokağa çıkma kısıtlaması uygulanacak. 31 Aralık 2020 - 4 Ocak 2021 tarihleri arasında uygulanacak sokağa çıkma kısıtlaması sırasında, hafta sonlarında (Cumartesi ve Pazar günleri) uygulanan sokağa çıkma kısıtlamalarına dair daha önce illere gönderdiğimiz genelge kapsamında belirlenen usul ve esasların,1 Ocak Cuma, 2 Ocak Cumartesive3 Ocak Pazargünleri için de geçerli olacak. Hafta Sonları Balıkçı/Balık Tezgahları 10.00-17.00 Saatleri Arasında Açık Olabilecek Yeni bir karar alınıncaya kadar hafta sonları uygulanan sokağa kısıtlaması süresince balıkçı/balık tezgahı şeklindeki iş yerlerinin deCumartesivePazargünleri10.00-17.00saatleri arasında vatandaşlara hizmet sunabilecek. Sokağa çıkma kısıtlaması uygulanan süre ve günlerde müdafi/vekil, duruşma, ifade gibi yargısal görevlerin icrasıyla sınırlı kalmak kaydıyla avukatlar ve yaklaşan yılsonu işlemlerindeki yoğunluğun ticari hayatı olumsuz etkilememesi amacıyla noterler, belirtilen görevlere dair zaman ve güzergahla sınırlı olacak şekildeistisna kapsamındaki kişilerveyerlerarasına eklendi. Yargısal görevlerin icrası gereğiavukatlarınözel araçlarıyla şehirlerarası seyahatlerine de izin verilecek. Yeni bir karar alınıncaya kadar faaliyetlerine ara verilen ana sınıfları ile ilgiliuygulamanın devamısağlanacak.Tam gün hizmet veren resmi ve özel tüm anaokulları ise bugünden itibarenyüz yüze eğitimegeçebilecek. Sendikaların Yapacağı Genel Kurul ve Etkinlikler de Ertelendi Daha önce illere gönderilen genelge ile 1 Mart 2021 tarihine kadar sivil toplum kuruluşları, kamu kurumu niteliğindeki meslek kuruluşları ve üst kuruluşları, birlikler ve kooperatiflerdegenel kurul dahil etkinlikler ertelenmişti. Bu kapsamasendikaların yapacağı genel kurul dahil etkinlikler de eklendi. Şartlandırılmış havalandırma sistemi olmayan konaklama tesislerinde mekanik havalandırma/klima sistemlerineUV filtretakılacak, bakımlarınındüzenlivesıkyapılmasısağlanacak. Havalandırma/klima sistemi bulunmayan konaklama tesislerinin kapalı genel mahallerinde, mahallin metreküpüne uygun sayıda ve güçtemobil HEPAfiltrelerkullanılacak. Bakımları düzenli olarak yapılacak ve filtreleri sık sık değiştirilecek. Umumi Hıfzıssıhha Kanununun 27’nci ve 72’nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurullarınca bu kararlar ivedilikle alınacak. Uygulamada herhangi bir aksaklığa meydan verilmeyecek ve mağduriyete neden olunmayacak. Alınan kararlara uymayanlara Umumi Hıfzıssıhha Kanununun ilgili maddeleri gereğince idari işlem tesis edilecek. Konusu suç teşkil eden davranışlara ilişkin Türk Ceza Kanununun 195’inci maddesi kapsamında gerekli adli işlemler başlatılacak.
TMO Naturel Nohut ve Yeşil Mercimek Kalibrasyon ve İmalatı İhale İlanı
Sayın Üyemiz, TMO Kırşehir Şube Müdürlüğü stoklarında bulunan 200 ton Natürel Nohut ile Yerköy ve KonyaŞube Müdürlüğü stoklarında bulunan toplam 253 ton Natürel Yeşil Mercimeğin TMO işyerlerindenimalatın yapılacağı tesise taşınması Ofis e ait olmak üzere, gelen yeşil mercimeklerin tesis içerisindeboşaltılması, kalibrasyon ve imalata verilmesi, elde edilen temiz boylanmış nohut ve yeşil mercimeklerin50 kg lık polipropilen çuvallara konulması ve imalat sonucu elde edilen kıymetli yan ürünlerin 1 tonlukBigbag/50 kg çuvallara konulması, bunlara ait baskı, film, etiket vb. tüm masraflar ile kalibrasyon, imalatve paketleme sonucu elde edilen yeşil mercimek ve kıymetli çıkıntıların Ofis kamyonlarına yüklenmesiişlerinin yaptırılması amacıyla 16.12.2020 tarihinde saat 14.00 da Polatlı Şube Müdürlüğü hizmetbinasında 4734 Sayılı Kamu İhale Kanunun 3. Maddesinin (g) bendi kapsamında "Teklif İsteme Usulü vebilahare pazarlığa geçilmesi suretiyle (Madde26)" ihale yapılacak olup, ihale gerçekleşmediği takdirde17.12.2020 tarihinde aynı saatte ikinci kez ihale yapılacaktır. İhale hakkında ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İşyeri Tehlike Sınıfları
Sayın Üyemiz, 26/12/2012 tarihli ve 28509 sayılı Resmi Gazete de yayımlanan İş Sağlığı ve Güvenliğine İlişkin İşyeri Tehlike Sınıfları Tebliği gereğince Birliğimizin de üyesi bulunduğu iş sağlığı ve güvenliğine ilişkin işyeri tehlike sınıflarının belirlenmesinde görevli olan İşyeri Tehlike Sınıfları Komisyonu, "İşyeri Tehlike Sınıfına Yapılan İtirazların Değerlendirilmesi Prosedürü" çerçevesinde her yıl Ocak ayı içinde toplanarak çalışmalarını yürütmektedir. Anılan prosedür gereğince, işyeri tehlike sınıflarına ilişkin itiraz talepleri en geç Komisyon toplantısından 30 gün öncesine kadar bağlı oldukları üst işveren kuruluşları aracılığı ile Aile, Çalışma ve Sosyal Hizmetler Bakanlığı İş Sağlığı ve Güvenliği Genel Müdürlüğüne gönderilmektedir. http://www.mevzuat.gov.tr internet sitesinde yer alan "İş Sağlığı ve Güvenliğine İlişkin İşyeri Tehlike Sınıfları Tebliği" ekindeki İşyeri Tehlike Sınıfları Listesine ilişkin değişiklik taleplerinin İşyeri Tehlike Sınıflarına Yapılan İtirazların Değerlendirilmesi Prosedürüne uygun doldurulmuş Tehlike Sınıfı Değişikliğine İlişkin Başvuru Formu ile Borsamız (eskisehirtb@tobb.org.tr) vasıtasıyla TOBB a iletilmesi gerekmektedir. İşyeri Tehlike Sınıflarına Yapılan İtirazların Değerlendirilmesi Prosedürüne ve Tehlike Sınıfı Değişikliğine İlişkin Başvuru Formuna www.tobb.org.tr/MaliveSosyalPolitikalar/Sayfalar/AnaSayfa.php adresinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COSME Son Turizm Çağrısı
Sayın Üyemiz, KOSGEB AB Koordinasyon Müdürlüğünden alınan 27.11.2020 tarihli e-postada; AB COSME PROGRAMI Son Turizm Çağrısı duyurusu gönderilmiştir. İlgili doküman ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
İhale Hak. (Arnavutluk)
Sayın Üyemiz, İlgi : Arnavutluk un Ankara Büyükelçiliği nin 7.12.2020 tarihli elektronik postası. Arnavutluk un Ankara Büyükelçiliği nin ilgide kayıtlı elektronik postası ile, Arnavutluk hükümetinin, Arnavutluk un Durres şehrinde 100 MW lık bir fotovoltaik tesis projesini gerçekleştireceği, tesise ilişkin transfer, kurulum, dizayn, finans ve operasyonel gibi konuların uluslararası ihaleye açılacağı bildirilmektedir. Söz konusu ihalenin başvuru süresinin 1 Şubat 2021 tarihinde saat 16.00 (CET) da sona ereceği belirtilmektedir. İhaleye ilişkin detaylı bilgilere Birliğimiz web sayfası (www.tobb.org.tr) "Hizmetler" başlığı altındaki "Uluslararası İş İmkânları/Ülke Duyuruları/Arnavutluk" bölümünden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Akaryakıt sektöründe sıfır atık webinarı
Sayın Üyemiz, Akaryakıt sektöründe sıfır atık uygulaması hakkında 16 Aralık 2020 Çarşamba günü saat 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Çevre ve Şehircilik Bakanlığı ile Birliğimiz işbirliğinde gerçekleştirilecek olan seminerde ekli program çerçevesinde akaryakıt sektöründe faaliyet gösteren işletmelere yönelik olarak sıfır atık uygulaması anlatılacak olup, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14. Etap Ekonomik Yatırımlar Hibe Desteği
Sayın Üyemiz, Eskişehir Valiliği,Il Tarım ve Orman Müdürlügünden Borsamıza gönderilen yazıda, Tarım ve Orman Bakanlığımız tarafından yeni teknoloji içeren yatırımların desteklenmesineilişkin usul ve esasları belirleyen "14. Etap Kırsal Kalkınma Destekleri Kapsamında Tarıma DayalıEkonomik Yatırımların Desteklenmesi Tebliği (2020/24) 21 Kasım 2020 tarihli ve 301311 sayılı ResmiGazete de yayımlanmıştır. Program kapsamındaki konulara ilişkin proje başvurusunda bulunmak isteyen gerçek ve tüzelkişiler, başvurularını internet adresinden, Uygulama www.tarimorman.gov.tr Rehberinin yayımıtarihinden itibaren 90 (doksan) gün içerisinde, 06 Mart 2021 tarihi saat 23.59 a kadar yapacaklardır. Programa ait uygulama rehberi, başvuru formları ve bilgilendirici dokümanlar ile satın alma kitabı"www.tarimorman.gov.tr" ve İl Müdürlüğümüz internet adresinden temin edilebilir. Ayrıntılı bilgi içinKırsal Kalkınma ve Örgütlenme Şube Müdürlüğümüze müracaat edilmelidir. Program hakkında bilginotu hazırlanarak yazımız ekinde gönderilmiştir, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kuru Kayısı Paketleme İhale İlanı
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden Borsamıza gönderilen yazıda,TMO Adıyaman Şube Müdürlüğüne bağlı Malatya Ajans Amirliği hinterlandında faaliyet gösteren TMO-TOBB Tarım Ürünleri Lisanslı Depoculuk A.Ş. firması depolarında stoklu bulunan 20 ton (+,- % 20 Ofis opsiyonlu (K2) Kükürtlü ile 20 ton (+,- % 20 Ofis opsiyonlu) (G3) Kükürtlenmemiş (Naturel) çekirdekleri çıkarılmış bütün kuru kayısıların ofis depolarından nakliyesi dahil imalata verilmesi ve 500 gramlık doypack ile kavak kutu paketlere ambalajlanması ile 10 (on) kilogramlık çiftoluklu dopel kutularda paketlenmesi amacıyla, "Toprak Mahsulleri Ofisi Genel Müdürlüğü 4734 sayılı Kamu İhale Kanunun 3. Maddesinin (g) Bendi Kapsamında Yapacağı Mal ve Hizmet Alımı İhalelerinde Uygulanacak Usul ve Esaslar Hakkında Yönetmelik" kapsamında 26.1. Maddesi Teklif Alma Usulü ile 14.12.2020 Pazartesi günü saat 14.00 de ihaleye çıkılacaktır. İlk ihalede istekli çıkmaması halinde 2. kez 15.12.2020 Salı günü aynı saatte yeniden ihale yapılacaktır, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan Tarımsal Üretim Tebliğinde Değişiklik Hk.
Sayın Üyemiz, Resmi Gazetede Yayınlanan, pancar, patates ve sebze tohumluğu sertifikasyonu ve pazarlanması, tebliğinde yapılan değişiklik hakkında bilgiye aşağıdaki linklerden ulaşılabilecektir. Link1, Link2, Link3 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO Stoklarında bulunan ekli listede yer alan hububat ve bakliyat ekte belirtilen esaslarla ve fiyatlarla satışı yapılacağı belirtilmektedir. Satışlar hakkında ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ceylanpınar Tarım İşletmesi Müdürülüğü ne Ait 1.730 Ton Mahsul Buğday Ve 670 Ton Kırık Mercimek Pazarlık Usülü Satışı
Sayın Üyemiz, 09.12.2020 gunu saat 10.00 da sanlıurfa tıcaret borsasında TİGEM E ait 2020 yılı istihsalı 1.730 ton mahsul buğday ve 670 ton kırık mercimek için pazarlık usülüaçık artırma ile satış ihalesi yapılacaktır. ıhale ıle ılgılı evraklar www.tigem.gov.trelektronık adresının ıhaleler bolumunde yayınlanmıstır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Kısa Çalışma Ödeneği Yeni Başvuruları
Sayın Üyemiz, Kırsal Kalkınma Yatırımlarının Desteklenmesi Programı (KKYDP) 14. Etap Destekleri Kırsal Kalkınma Yatırımlarının Desteklenmesi Programı (KKYDP) kapsamındaki %50 hibe desteği sağlayan 14. etap kırsal ekonomik altyapı yatırımları ile tarıma dayalı ekonomik yatırımların desteklenmesine ilişkin 2020/24 ve 2020/25 no lu tebliğler yayımlanmıştır. Her iki tebliğe ilişkin bilgi notu ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
KOBİ’ler için Patent ve Marka Tescili Bilgilendirme Semineri (Webinar – İnternet Üzerinden)
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği Başkanı M. Rifat Hisarcıklıoğlu ile Türk Patent ve Marka Kurumu Başkanı Prof. Dr. Habip Asan’ın katılımı ile gerçekleştirilecek seminerde KOBİ’lere yönelik olarak patent, faydalı model, marka ve tasarım kavramları, bu kavramlar arasındaki farklar, avantajları, önemi ve başvuru süreçleri anlatılacak olup, seminer sonunda KOBİ’lerin konu hakkındaki soruları cevaplandırılacaktır.Detaylar ve program içinhttp://webinar.tobb.org.tradresini ziyaret edebilirsiniz. 10 Aralık 2020 Perşembe – Saat: 15:00 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ceylanpınar Tarım İşletmesi Müdürülüğü ne Ait 1.500 Ton Balyalı Buğday Sapı Satış (Pazarlık)
Sayın Üyemiz, 11.12.2020 gunu saat 11.00 da ısletmemızde, ısletmemıze aıt 2020 yılı ıstıhsalı1.500 ton balyalı bugday sapının pazarlık usulu acık artırma ıle satıs ıhalesı yapılacaktır. ıhale ıle ılgılı evraklar www.tigem.gov.trelektronık adresınde yayınlanmıstır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Ceylanpınar TİM 2.Üretim Mahsül Dane Mısır Satışı
Sayın Üyemiz, 10.12.2020 gunu saat 10.00 da sanlıurfa tıcaret borsasında işletmemize ait 2020 yılı istihsalı 6.000 ton mahsul ıı.ürün dane mısır için açık artırma pazarlık usulü satış ihalesi yapılacaktır. ıhale ıle ılgılı evraklarwww.tigem.gov.trelektronık adresının ıhaleler bolumunde yayınlanmıstır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
16. KOBİ Zirvesi "Pandemi Süreci ve İhracat" 08 - 09 Aralık 2020 ONLİNE
Sayın Üyemiz, Üretimin, ticaretin ve hizmetin tüm alanlarında KOBİ’lerinyaşadığı sorunlara çözüm bulmak; ülkemizin büyümesinde ve kalkınmasında kalıcı başarıyı yakalaması için KOBİ’lere sürdürülebilir rekabet gücü kazandıracak yol haritalarının çizildiği, geleneksel hale gelmiş olan KOBİ Zirveleri’nin XVI’si;TOSYÖV, TİM, TOBB ve KOSGEBişbirliği ile DenizBank Ana Sponsorluğunda sanal ortamdaONLİNEolarak gerçekleştirilecektir. TOSYÖV tarafından 08 - 09 Aralık 2020 tarihleri arasında ONLİNE düzenlenecekKOBİ Zirvemizin bu yıl ana teması “Pandemi Süreci ve İhracat”. İhracatın tüm alanlarında yaşanılan sorunlar irdelenecektir. Dünyada yaşanan Pandemi dolayısı ile ONLİNE olarak sanal ortamda gerçekleştirilecek, Ülkemiz ekonomisine katkısı tartışılamayacak kadar önemli olanXVI. KOBİ Zirvesi 8 Aralık 2020 Salı günü 09:30 – 10:30 saatleri arasında Açılış konuşmaları ile başlayacaktır. Zirve Programına ve oturumlara ilişkin ayrıntılar ekte bilgilerinize sunulmaktadır.(Katılım Ücretsizdir) Zirve Canlı olarak TOSYÖV Youtube kanalından izlenilebilinecektir.https://www.youtube.com/channel/UC4E9RSWvd1d-joRDU3weqmg Kayıt için:www.kobizirvesi.org.tr
Patent ve Marka Webinarı
Sayın Üyemiz, TOBB Başkanı Sayın M. Rifat Hisarcıklıoğlu ile Türk Patent ve Marka Kurumu Başkanı Prof. Dr. Sayın Habip Asan ın katılımı ile gerçekleştirilecek seminerde KOBİ lere yönelik olarak patent, faydalı model, marka ve tasarım kavramları, bu kavramlar arasındaki farklar, avantajları, önemi ve başvuru süreçleri anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan Hayvancılık Desteklemeleri Uygulama Tebliğinde Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede yayınlanan hayvancılık desteklemeleri uygulama tebliğinde yapılan değişiklik hakkında ayrıntılı bilgi linkte bilginize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan İşsizlik Sigortasında 3 Aylık Sürenin 6 Aya Uzatılması Hk.
Sayın Üyemiz, Resmi Gazetede yayınlanan işsizlik sigortasında 3 aylık sürenin uzatıldığı bildirilmektedir. Ayrıntılı bilgi linklerde bilgilerinize sunulmuştur. Link1, link2, link3 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan İlimizi İlgilendiren Kamulaştırma Kararı
Sayın Üyemiz, Resmi Gazetede yayınlanan İlimizi ilgilendiren bazı taşınmazların kamulaştırıldığını bildiren yazı linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Geçmiş Borçların Yapılandırması
Sayın Üyemiz; Sizlerden gelen talepleri ilettiğimiz TOBB’un girişimleri sonucunda Resmi Gazete nin 17 Kasım 2020 Salı tarih ve 31307 no lu sayısında yayımlanarak yürürlüğe giren ”BAZI ALACAKLARIN YENİDEN YAPILANDIRILMASI İLE BAZI KANUNLARDA DEĞİŞİKLİK YAPILMASI HAKKINDA 7256 SAYILI KANUN” uyarınca; Üyelerimizin 31 AĞUSTOS 2020 tarihi (bu tarih dâhil) itibarıyla ödenmesi gerektiği hâlde bu Kanunun yayımı tarihine kadar ödenmemiş olan; 2020 yılı 1. Taksit tutarları ile ödenmemiş olan 2019 - 2018 - 2017 - 2016 ve daha önceki yıllara ait Yıllık Aidat ve Borsa Tescil Ücretleri anapara borçlarına yönelik yapılandırma olanağı getirilmiştir. Söz konusu yapılandırmadan yararlanmak isteyen üyelerimizin, en geç 31 Ocak 2021 tarihine kadar Borsamıza şahsen gelerek ve/veya e-posta ile yapılandırma müracaatlarını ve ilk taksit ödemelerini gerçekleştirmeleri gerekmektedir. Yapılandırmaya başvuran üyelerimiz borçlarını peşin ve/veya 6 taksit şeklinde ödeyebilecektir. Belirtilen döneme isabet eden tutarlara ait tahakkuk etmiş olan gecikme zamları tahsil edilmeyecektir. Yapılandırmada taksitli ödeme seçeneğini talep eden üyelerimizin; İlk Taksitini 28 ŞUBAT 2021 tarihinde ödemek suretiyle aylık dönemler hâlinde ve azami toplam altı eşit taksitte 31 TEMMUZ 2021 tarihine kadar ödemesi gerekmektedir. Toplam anapara borç tutarı yukarıda belirtilen taksit sürelerini geçmemek üzere kredi kartı ile de taksitlendirilebilecektir. Yapılandırmadan faydalanacak üyelerimiz aşağıda belirtilen yöntemlerden birini kullanarak başvuruda bulunabilecektir: Aidat Yapılandırma Başvuru Dilekçesi doldurularak dilekçe ile Borsamıza şahsen, Aidat Yapılandırma Başvuru Dilekçesi doldurulup imzalanarak eskisehirtb@tobb.org.tr adresine e-posta yoluyla,(imza sirküsü eklemek koşuluyla) yapabilecektir. Başvurularda, yapılandırma kapsamında taksit talep etmek isteyen üyelerimizin taksit seçeneğini işaretlemesi gerekmektedir. Şahsen yapılacak başvurular için doldurulacak Aidat Yapılandırma Başvuru Dilekçesini indirmek için tıklayınız. E-Posta yoluyla yapılan başvurular yine e-posta yoluyla cevaplandırılacaktır. Bilgilerinize önemle duyurulur. GÜLTEKİN GÜLER GENEL SEKRETER
7256 sayılı Kanun Kapsamında İşletmeler İçin Kamu Alacaklarını Yapılandırma Bilgilendirme Semineri
Sayın Üyemiz, Gelir İdaresi Başkanlığı (GİB), Sosyal Güvenlik Kurumu (SGK) ve Türkiye Odalar ve Borsalar Birliği (TOBB) işbirliğinde gerçekleştirilecek olan seminerde 7256 sayılı Kanun Kapsamında işletmeler için kamu alacaklarının yapılandırılması anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Tarih: 4 Aralık 2020 Cuma – Saat: 14:30 Katılım için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Koronavirüs ile Mücadele Kapsamında Sokağa Çıkma Kısıtlamaları - Yeni Kısıtlama ve Tedbirler Genelgeleri
Sayın Üyemiz, Koronavirüs (Covid­19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme, sosyal izolasyonu temin, fiziki mesafeyi koruma ve hastalığın yayılım hızını kontrol altında tutma amacıyla, içerisinde bulunduğumuz kontrollü sosyal hayat döneminin temel prensipleri olantemizlik,maskevemesafekurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemler; Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun önerileri, Sayın Cumhurbaşkanımızın talimatları doğrultusunda belirlenerek uygulamaya geçirilmektedir. Gelinen aşamada son dönemde Koronavirüs salgınının yayılımında tüm Dünya’da ve özellikle Avrupa’da hızlı bir artış yaşandığı ve Ülkemizde de vaka ve hasta sayılarında yükseliş görüldüğü kamuoyunun malumudur. Bu çerçevede30.11.2020tarihinde Sayın Cumhurbaşkanımızın başkanlığında toplananCumhurbaşkanlığı Kabinesindealınan kararlar doğrultusunda; Sokağa Çıkma Kısıtlamaları Genelgesi 1.Yeni bir karar alınıncaya kadar ülke genelindehafta sonları;Cuma günleri saat 21.00’debaşlayacak, Cumartesi ve Pazar günlerinin tamamını kapsayacak vePazartesi günleri saat 05.00’detamamlanacak şekildesokağa çıkma kısıtlamasıuygulanacaktır. İlk uygulama olarak04.12.2020 Cuma günü saat 21.00’debaşlayıp07.12.2020 Pazartesi günü saat 05.00’debitecek şekilde tüm vatandaşlarımız için sokağa çıkma kısıtlaması getirilecek olupbundan sonraki hafta sonlarında dauygulama aynı şekilde devam edecektir. 1.1.Sokağa çıkma kısıtlaması süresinceüretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamakamacıylaEk’tebelirtilenyerler ve kişiler kısıtlamadan muaf tutulacaktır. 1.2.Kısıtlamanın olduğu Cumartesi ve Pazar günlerimarket, bakkal, manav, kasap ve kuruyemişçiler 10.00­17.00 saatleriarasında faaliyet gösterebilecek, vatandaşlarımız (65 yaş ve üzeri ile 20 yaş altında bulunanlar hariç) zorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine enyakın market, bakkal, manav, kasap ve kuruyemişçileregidip gelebilecektir. Aynı saatler arasındamarket, bakkal, manav, kasap, kuruyemişçilerveonline sipariş firmalarıevlere/adrese servis şeklinde de satış yapabileceklerdir. 1.3.Cumartesi ve Pazar günleriekmek üretimininyapıldığıfırınve/veyaunlu mamulruhsatlıiş yerleri ile bu iş yerlerinin sadeceekmek satan bayileriaçık olacaktır (Bu iş yerlerinde sadece ekmek ve unlu mamul satışı yapılabilir.). Vatandaşlarımız (65 yaş ve üzeri ile 20 yaş altında bulunanlar hariç) ekmek ve unlumamul ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine yürüme mesafesinde olan fırına gidip gelebileceklerdir. Fırın ve unlu mamul ruhsatlı işyerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallara ekmek servisi yapılabilecek, ekmek dağıtım araçlarıyla sokak aralarında kesinlikle satış yapılmayacaktır. 1.4.Lokanta ve restorantarzı işyerleri, sokağa çıkma kısıtlamasının olduğu Cumartesi ve Pazar günleri10.00-­20.00saatleri arasında sadece paket servis şeklinde hizmet sunmak üzere açık olabilecektir. 2.Yeni bir karar alınıncaya kadar ülke genelindehafta içerisindeyer alan günlerde (Pazartesi, Salı, Çarşamba, Perşembe ve Cuma)21.00­-05.00saatleri arasındasokağa çıkma kısıtlamasıuygulanacaktır. İlk uygulama olarak01.12.2020 Salı günü saat 21.00’debaşlayıp02.12.2020 Çarşamba günü saat 05.00’debitecek şekilde tüm vatandaşlarımız için sokağa çıkma kısıtlaması getirilecek olup bundan sonraki haftalarda da Pazartesi, Salı, Çarşamba, Perşembe ve Cuma günleri uygulama yukarıda belirtildiği şekilde devam edecektir. 2.1.Sokağa çıkma kısıtlaması süresinceüretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamakamacıylaEk’tebelirtilenyerler ve kişiler kısıtlamadan muaf tutulacaktır. 2.2.Sokağa çıkma kısıtlamasındaki getirilen sürelere uymak için istisna getirilenler dışındakitüm işyerleri hafta içi saat 20.00’dekapanacaktır. 3.Sokağa çıkma kısıtlaması getirilen süre ve günlerde(hafta içi ve hafta sonunda uygulanacak) aşağıda belirtilen zorunlu hallerdeşehirlerarası seyahatlereizin verilecektir. 3.1.Zorunlu Haller Sayılacak Durumlar; Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevk olan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmak için veya cenaze nakil işlemine refakat edecek olan (en fazla 4 kişi), Bulunduğu şehre son 5 gün içerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikamet ettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araç plakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ÖSYM tarafından ilan edilen ve diğer merkezi sınavlara katılacaklar ve refakatçileri, Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, Özel veya kamudan günlü sözleşmeye davet yazısı olan, Ceza infaz kurumlarından salıverilen, Vatandaşlarımız, yukarıda belirtilen durumların varlığı halindetoplu ulaşım araçlarıylaveya Bakanlığımıza aitE­BAŞVURUveALO 199sistemleri üzerinden ya da Valilik/Kaymakamlıklara doğrudan başvuru yoluylaSeyahat İzin Kurullarındanizin almak kaydıylaözel araçlarıylaseyahat edebileceklerdir. 3.2.Yukarıda belirtilen mazeretleri taşımayan kişilerin şehirlerarası seyahatleri ise ancak toplu ulaşım araçları (uçak, otobüs, tren, gemi vb.) kullanılmak suretiyle mümkün olacaktır. İşi ile ilgili illiyetini belgeleyen toplu ulaşım araçlarının görevlileri ile şehirlerarası seyahat edeceğini bilet, rezervasyon kodu vb. ile ibraz eden kişiler sokağa çıkma kısıtlamasından muaf olacaktır. 4.Sokağa çıkma kısıtlaması getirilen süre ve günlerde 65 yaş ve üzeri vatandaşlarımızın ihtiyaç duyduğu temel ihtiyaçları (ekmek, temel gıda vb.) planlama yapılarak Vefa Sosyal Destek Birimleri aracılığıyla karşılanacaktır. YeniKısıtlamaveTedbirler Genelgesi Koronavirüs (Covid­19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme, sosyal izolasyonu temin, fiziki mesafeyi koruma ve hastalığın yayılım hızını kontrol altında tutma amacıyla, içerisinde bulunduğumuz kontrollü sosyal hayat döneminin temel prensipleri olantemizlik,maskevemesafekurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemler; Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun önerileri, Sayın Cumhurbaşkanımızın talimatları doğrultusunda belirlenerek uygulamaya geçirilmektedir. Gelinen aşamada son dönemde Koronavirüs salgınının yayılımında tüm Dünya’da ve özellikle Avrupa’da hızlı bir artış yaşandığı ve Ülkemizde de vaka ve hasta sayılarında yükseliş görüldüğü kamuoyunun malumudur. 30.11.2020tarihinde Sayın Cumhurbaşkanımızın başkanlığında toplananCumhurbaşkanlığı Kabinesindealınan kararlar doğrultusunda;yeni bir karar alınıncaya kadar 01.12.2020 Salı günü saat 21.00’denitibaren geçerli olacak şekilde (1. madde hariç); 1.Cumhurbaşkanlığı İdari İşler Başkanlığının 30.11.2020 tarih ve 46676 sayılı yazısı doğrultusunda; illerde Valilerimiz tarafındankamu kurum ve kuruluşlarının günlük çalışma başlama ve bitiş saatlerinin 02.12.2020 Çarşamba günündenitibaren10:00­16:00arası olacak şekildebelirlenmesive personel servis saatlerinin bu mesai saatlerine göre yeniden düzenlenmesi, 2.Yüzme havuzu, hamam, sauna, masaj salonuvelunaparklarınfaaliyetlerinin durdurulması,ganyan, iddiavemilli piyango bayilerindeiçeriye müşteri kabul etmeksizin sadece kupon/ganyan yatırma işleminin yapılabilmesi, 3. 65 yaş ve üzeri ile 20 yaş altıvatandaşlarımızın 18.11.2020 tarihli ve 19161 sayılı Genelgemizlebelirlenen saatler içerisinde(10.00­13.00, 13.00­16.00 saatleri arası)şehir içi toplu ulaşım araçlarını(metro, metrobüs, otobüs, minibüs, dolmuş vb.)kullanmalarının kısıtlanması, 4. Şehir içi toplu ulaşım araçlarında yaşanan yoğunluğun azaltılmasıamacıyla ilgili mahalli idarelerce alınması gereken tedbirlerin (sefer sayısının artırılması, denetim vb.) İl/İlçe Umumi Hıfzıssıhha Kurullarınca belirlenmesi, 5.Cenaze namazlarınınvefat edenlerin yakınları dahilen fazla 30 kişi ile kılınması,Nikahlarvenikah merasimi şeklindeki düğünlerin degelin ve damadın yakınları dahilen fazla 30 kişi ile düzenlenmesi, 6.Kış mevsimi nedeniyle kapalı alanlarda daha fazla vakit geçirilen bu süreçte vatandaşlarımızın evlerde misafir kabulünün salgının bulaşma/yayılım hızını artırdığı göz önüne alındığında; ­ Evlerde gün, mevlid, taziye, yılbaşı kutlaması gibi toplulukların bir araya geleceği etkinliklere müsaade edilmemesi, ­ Yine yukarıdaki sebeplerle bu süreçte evlere misafir kabul edilmemesi hususunun vatandaşlarımıza hatırlatılması, 7.HerAVMvesemt pazarıiçinaynı anda kabul edilebilecek müşteri sayısınınİl/İlçe Umumi Hıfzıssıhha Kurulları kararı ile ayrı ayrı belirlenmesi, Ayrıca AVM’lerde ve semt pazarlarında daha önceki Genelgelerde belirlenen kuralları/alınan tedbirleri takip etmekle sorumlu AVM Covid­19 sorumlusu ve pazaryeri yöneticileri ile zabıta/kolluk birimleriyle denetimlerin eksiksiz yapılması, AVM’lere girişte çalışanlar ve müşteriler için HES kodu zorunluluğunun getirilmesive gerekli sorgulama yapıldıktan sonra herhangi bir olumsuzluğa rastlanmayan çalışan veya müşterinin AVM’ye kabul edilmesinin sağlanması, 8.İl/İlçe Hıfzıssıhha Kurullarınca gerek görülmesi durumundakalabalık cadde ve meydanlaragirebilecek/aynı anda bulunabilecekkişi sayısının(metrekare ve alan büyüklüğü göz önünde bulundurularak) belirlenmesi, buna ilişkin gerekli fiziki tedbirler ile diğer önlemlerin eksiksiz alınması, 9. Anasınıfı ve anaokullarınınfaaliyetlerine ara verilmesi, 10.50 ve daha fazla çalışanı olan işyerlerinde; işyeri hekimi gözetiminde, mevcut iş güvenliği uzmanı veya bulunmadığı durumda görevlendirilecek bir personel tarafından salgın tedbirlerinin uygulamasının sıkı bir şekilde denetlenmesi, Gerektiği değerlendirilmektedir.
Ticaret Hukuku Uzman Arabulucu Genel Eğitimi
Sayın Üyemiz, TOBB ETÜ UYUM Arabuluculuk ve Uyuşmazlık Çözüm Merkezi nden Birliğimize iletilen yazıda Adalet Bakanlığı Hukuk İşleri Genel Müdürlüğü Arabuluculuk Daire Başkanlığı tarafından TOBB Ekonomi ve Teknoloji Üniversitesi Hukuk Fakültesi nin Ticaret Hukuku Uzman Arabulucu Genel Eğitimi için yetkilendirildiği, ön kaydın http://sem.etu.edu.tr adresinden gerçekleştirilebileceği bildirilmektedir. Konuya ilişkin duyuru ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Gıda, Tarım ve Orman Alanında Bazı Düzenlemeler Yapılması Hakkındaki 7255 Sayılı Kanun Hk.
Sayın Üyemiz, 4 Kasım 2020 tarihli 31294 sayılı resmi gazetede yayımlanan Gıda, Tarım ve Orman Alanında Bazı Düzenlemeler Yapılması Hakkındaki 7255 sayılı kanunla; 5996 sayılı Veteriner Hizmetleri, Bitki Sağlığı, Gıda ve Yem Kanunu nda değişiklik yapılmıştır. Buna göre; Kişilerin hayatını ve sağlığını tehlikeye sokacak gıdalar, masrafları sorumlusuna ait olmak üzere piyasadan toplatılacak ve mülkiyeti kamuya geçirilerek imha edilecektir. Bu gıdaları üreten, ithal eden, kendi adı veya ticari unvanı altında piyasaya arz eden gıda işletmecilerine, 1 yıldan 5 yıla kadar hapis ve 1000 günden 5000 güne kadar adli para cezası verilecektir. Fiilin 3 yıl içinde tekrarlanması durumunda ayrıca, gıdayı üreten, ithal eden, kendi adı veya ticari unvanı altında piyasaya arz eden gıda işletmecisi 5 yıldan 10 yıla kadar gıda sektörü faaliyetinden men edilecektir. Taklit veya tağşiş yapılan gıda veya yemleri üreten, ithal eden veya kendi adı veya ticari unvanı altında piyasaya arz eden gıda veya yem işletmecisine 50 bin Türk lirasından, izlenebilirliğini sağlamadan piyasaya arz eden perakende gıda veya yem işletmecisine 5 bin Türk lirasından aşağı olmamak ve 500 bin Türk Lirasını geçmemek kaydıyla, fiilden bir önceki mali yıl sonunda oluşan veya bunun hesaplanması mümkün olmazsa fiil tarihine en yakın mali yıl sonunda oluşan yıllık gayri safi gelirlerinin yüzde 1 i oranında idari para cezası verilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ticaret Müşavirlerimizle Elektronik Sohbetler-Kolombiya
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 25.11.2020 tarihli ve E-29077148-743.02.01.01 sayılı yazısı. Ticaret Bakanlığımızın ilgide kayıtlı yazısı ile, Ticaret Müşavir ve Ataşelerimizle Türk iş dünyasını bir araya getirmek üzere Ticaret Bakanlığımız tarafından "Ticaret Müşavirlerimizle Elektronik Sohbetler" toplantılarının düzenlendiği ifade edilmektedir. Bu itibarla, 1 Aralık 2020 Salı günü 16.30-18.00 saatleri arasında Kolombiya Cumhuriyeti nde görev yapmakta olan Ticaret Müşavirimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu toplantıya katılmak isteyen firmalarımız, toplantı detaylarına https://bit.ly/39j9YHU adresinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Westpac Imports and Export
Sayın Üyemiz, İlgi : Ticaret Bakanlığı nın 20.11.2020 tarihli ve 68460249-141.99 sayılı yazısı. Ticaret Bakanlığımızın ilgide kayıtlı yazısı ile, Sidney Ticaret Ataşeliğinden alınan bir yazıya atfen, "Leura, New South Wales 2780 Australia" adresinde faaliyet gösterdiği iddiası ile "Westpac Imports and Export" firma ismi ve annamartine910@gmail.com e-posta adresi kullanılarak Anna Martine adlı kişi tarafından bazı firmalarımıza e-posta gönderilerek, firmaları tarafından tedarik kararlarında değerlendirilmek üzere internet sitelerinde excel formatında bulunan bir belgedeki ürünlere ilişkin fiyat tekliflerinin gönderilmesinin istenildiği ve fiyat tekliflerinin istenildiği ürün grubu için https://westpaclimited.weebly.com adresine yönlendirme yapıldığının görüldüğü belirtilmektedir. Yazıda devamla, Ataşeliğimiz tarafından internet üzerinden yapılan araştırmada mezkur adrese ulaşılamadığı ifade edilmekte olup, ayrıca, Avustralya ticari sicil kayıtlarının incelenmesi sonucunda "Westpac Imports and Export" isimli bir firma kaydının olmadığının tespit edildiği de belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
COSME Programı Kümelenme Çağrısı Eğitimi Hk.
Sayın Üyemiz, Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı tarafından yürütülen, COSME Türkiye Teknik Destek Projesi çerçevesinde düzenlenecek olan "COSME Cluster Excellence Çağrısı Hazırlık Eğitimi Programı" duyurusu ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Tarıma Dayalı Ekonomik Yatırımların Desteklenmesi Hk. Tebliğ
Sayın Üyemiz, 21 Kasım 2020 tarih ve 31311 sayılı Resmi Gazetede, Kırsal Kalkınma Destekleri Kapsamında Tarıma Dayalı Ekonomik Yatırımların Desteklenmesi Hakkında Tebliğ yayımlanmıştır. Söz konusu tebliğde; Tarımsal ürünlerin işlenmesi, yeni tesislerin yapımı, kısmen yapılmış yatırımların tamamlanması, faal olan mevcut tesislerin kapasite artırımı ile teknoloji yenileme veya modernizasyonu konularına verilecek hibe desteklerinin detayları yer almaktadır. Hibe destekleriyle ilgili Proje Ön Değerlendirme Kriterleri başlığında, yatırım konusunun "coğrafi işaret tescili yapılmış bir ürünün işlenmesi" ile ilgili olması durumunda ilave puan uygulanacağı belirtilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TÜBİTAK Ar-Ge destekleri 2021 Yılı Çağrısı
Sayın Üyemiz, Ar-Ge destekleri kapsamında, KOBİ lere yönelik olarak %75 oranında 600.000 TL destekli "1507-KOBİ ArGe Başlangıç Destek Programı" ile bütçe sınırlaması bulunmaksızın destekli 1501-Sanayi Ar-Ge Destek Programı 2021 yılı çağrıları açılacak olup, konu ile ilgili detaylı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Resmi Gazetede Yayınlanan Hayvancılık İle İlgili Bazı Yönetmelik Değişiklikleri
Sayın Üyemiz, Resmi Gazetede yayınlanan hayvancılık ile ilgili bazı yönetmelik değişiklikleri linklerde bilgilerinize sunulmuştur. link1, link 2,link 3, link4,link 5 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bazı Alacakların Yeniden Yapılandırılmasına İlişkin 7256 Sayılı Kanun Genel Tebliği
Sayın Üyemiz, 27 Kasım 2020 tarihli ve 31317 sayılı Resmi Gazetede Hazine ve Maliye Bakanlığı Gelir İdaresi Başkanlığı tarafından “Bazı Alacakların Yeniden Yapılandırılmasına İlişkin 7256 Sayılı Kanun Genel Tebliği” yayımlanmıştır. 17/11/2020 tarihli ve 31307 sayılı Resmi Gazete’de yayımlanarak yürürlüğe giren 7256 sayılı Bazı Alacakların Yeniden Yapılandırılması İle Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanunun 1, 2 ve 3 üncü maddelerinde, Hazine ve Maliye Bakanlığına, il özel idarelerine, belediyelere, büyükşehir belediyeleri su ve kanalizasyon idarelerine ve Yatırım İzleme ve Koordinasyon Başkanlıklarına (YİKOB) ait bazı alacakların yeniden yapılandırılmasına ilişkin düzenlemeler yer almakta olup, söz konusu hükümlerin uygulamasına yönelik usul ve esasların belirlendiği bu Tebliğde Kanun kapsamına giren alacaklar ve bu alacakların yapılandırılmasına ilişkin açıklamalar yer almaktadır. Detayları linkte yer alan Tebliği bilgilerinize sunarız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TMO Peşin Hububat Şatışları
Sayın Üyemiz, TMO Genel Müdürlüğünden Borsamıza gelen yazıda, Kasım ayı fiyatlarından satılmak suretiyle, ekmeklik buğday ve arpa için para yatırma süre sonu 27 Kasım 2020 tarihine kadar, ürün teslimat süre sonu ise 13 Aralık 2020 tarihi mesai bitimine kadar vadeli arpa satışlarında sözleşme imzalama son tarihi de 30 Kasım 2020 tarihi mesai bitimine kadar uzatılmıştır, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Polatlı T.İ.M. Çeşitli Buğday Satış İhalesi
Sayın Üyemiz, TİGEM Polatlı Tarım İşletmesi Müdürlüğünden Borsamıza gelen yazıda, çeşitli buğday Satış İhalesi yapılacağı bilgisi verilmektedir. İhale hakkında ayrıntılı bilgi linkte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğ
Sayın Üyemiz, Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğ, 25 Kasım 2020 tarih ve 31315 sayılı Resmi Gazete’de yayınlanarak 1 Ocak 2020 tarihinden itibaren geçerli olmak üzere yürürlüğe girmiştir. Söz konusu Tebliğ, ülkemizde bitkisel üretimi artırmak, verim ve kaliteyi yükseltmek, üretim maliyetlerinin karşılanmasına katkıda bulunmak, sürdürülebilirliği sağlamak, kayıtlılığı arttırmak ve çevreye duyarlı alternatif tarım tekniklerinin geliştirilmesine yönelik, çiftçilere destekleme yapılmasına ilişkin usul ve esasların belirlenmesi amacıyla hazırlanmıştır. 2020 yılında yapılacak; Bombus arısı kullanım desteği, fındık alan bazlı gelir desteği, geleneksel zeytin bahçelerinin rehabilitasyonu desteği, iyi tarım uygulamaları desteği, katı organik-organomineral gübre desteği, küçük aile işletmesi desteği, mazot ve gübre desteği, organik tarım desteği, sertifikalı fidan/fide ve standart fidan kullanım desteği, sertifikalı fidan üretim desteği, sertifikalı tohum kullanım desteği, toprak analizi desteği, Türkiye tarım havzaları üretim ve destekleme modeline göre fark ödemesi desteği, yem bitkileri desteği ve yurt içi sertifikalı tohum üretim desteği uygulamalarında görev alacak kurum ve kuruluşların belirlenmesi, tarımsal faaliyette bulunan çiftçilere ve toprak analiz laboratuvarlarına yapılacak destekleme ödemelerine ilişkin usul ve esasları kapsamaktadır. “Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğ” metnine link’te yer verilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
TİGEM Mahmudiye T.İ.M. Çeşitli Buğday Satış İhalesi
Sayın Üyemiz, TİGEM Mahmudiye Tarım İşletmesi Müdürlüğünden Borsamıza gelen yazıda, çeşitli buğday Satış İhalesi yapılacağı bilgisi verilmektedir. İhale hakkında ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Akkuyu İhaleleri
Sayın Üyemiz, Bilindiği üzere Ülkemiz ve Rusya arasında imzalanan hükümetlerarası anlaşmayla her biri 1200 MW gücünde 4 reaktörden oluşacak Akkuyu Nükleer Santrali nin kurulmasına yönelik çalışmalar başlamış, Nisan 2018 de ilk ünitenin inşaat lisansı alınması ile inşaat faaliyetleri hızlanmıştır. Halihazırda ilk 2 ünitenin inşaatı aktif olarak sürmektedir. Akkuyu Nükleer A.Ş. ile gerçekleştirilen görüşmeler neticesinde Akkuyu Nükleer Santrali nin ihalelerine ülkemiz KOBİ lerinin katılımını artırmak ve bilgilendirme amacıyla, ilgili ihalelerin Birliğimiz tarafından yürütülen KOBİ lerimizin potansiyel iş ortaklarını tanımaları için kurulan profesyonel bir eşleştirme eplatformu olan http://www.tobb2b.org.tr adresinde yayınlanmasına karar verilmiştir. Bu kapsamda Akkuyu Nükleer Santraline yönelik ihaleler https://www.tobb2b.org.tr/ihaleozellestirme.php adresinden takip edilebilmekte, ilgili ihalelere aynı zamanda http://www.tobb2b.org.tr adresinden "İhale ve Özelleştirmeler" bölümünde "Güncel İhaleler" başlığı altından erişilebilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Avrupa Birliği Yeşil Mutabakatı nın enerji sektörüne etkileri webinarı
Sayın Üyemiz, Avrupa Birliği Yeşil Mutabakatının enerji sektörüne etkileri hakkında 1 Aralık 2020 Salı günü saat 14:00 te internet üzerinden bilgilendirme semineri gerçekleştirilecektir. Davet ekte sunulmaktadır. Birliğimiz organizasyonunda Global Resources Partnership Yönetim Kurulu Başkanı ve The London Energy Club İcra Başkanı Mehmet Öğütçü nün katılımı ile gerçekleştirilecek olan seminerde Avrupa Yeşil Mutabakatı nın küresel enerji sektörüne etkileri ve iş dünyası liderlerine tavsiyeler dahil Türkiye için nasıl sonuçlar doğurabileceği konuları anlatılacak, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Ayrıntılı bilgi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Salgın Sonrası için Kurumsal Öneriler Webinarı
Sayın Üyemiz, KOBİ sahiplerine ve yöneticilerine yönelik olarak salgın sonrası için kurumsal öneriler hakkında 3 Aralık 2020 Perşembe günü saat 14:00 te internet üzerinden bir bilgilendirme semineri gerçekleştirilecektir. Türkiye Odalar ve Borsalar Birliği ve Türkiye Kurumsal Yönetim Derneği işbirliğinde internet üzerinden gerçekleştirilecek olan seminerde;  Salgının başından itibaren alınan/alınabilecek kısa ve uzun vadeli önlemler,  Kurumsal yapılanma çalışmaları ve çevik yönetime bakış açıları,  Belirsizlik dönemlerinde iş yaparken dikkat edilecek başlıklar,  Dünyayı nasıl takip edelim? Finansman, Yatırımcı arayan, pazarlarını genişletmek isteyenlere öneriler. Finansman sağlayıcılar şirketlerde neleri soruyor?  Salgın sonrası üst düzey yöneticileri hangi vasıflar aranacak? Hangi vasıflar şirketleri kurtardı? konuları değerlendirilecek olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Ufuk2020 Yeşil Mutabakat Çağrıları Webinarı
Sayın Üyemiz, Avrupa Birliğinin KOBİ lere, sanayicilere, üniversitelere, araştırma merkezlerine ve STK lara yönelik olarak toplamda 1 Milyar Avro bütçeli hibe programı olan Ufuk2020 Yeşil Mutabakat çağrıları hakkında 26-27 Kasım 2020 tarihlerinde saat 10:00 da internet üzerinden bilgilendirme seminerleri gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Birliğimiz organizasyonunda TÜBİTAK işbirliğinde internet üzerinden gerçekleştirilecek olan seminerlerde Avrupa Birliği nin iklim değişikliği politikaları çerçevesindeki hibe programı olan Ufuk2020 Yeşil Mutabakat çağrılarının konu başlıkları, proje içerikleri, uygun maliyetler ve konsorsiyumlara katılım konuları anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
Karayolu Taşıma Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik Yayınlandı
Sayın Üyemiz, Karayolu Taşıma Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik, T.C. Ulaştırma ve Altyapı Bakanlığı tarafından 21 Kasım 2020 Cumartesi tarih ve 31311 sayılı Resmi Gazete de yayımlanarak yürürlüğe girdi. İlgili yönetmelik değişikliğine Resmi Gazete üzerinden ulaşmak için burayı tıklayınız Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter