"Hiçbir şeye ihtiyacımız yok, yalnız bir şeye ihtiyacımız vardır; çalışkan olmak!" M.Kemal Atatürk
28 Haziran 2022 Salı

Tüm Duyurular

Eskişehir İli Hayvan Sağlık Zabıtası Komisyon Kararı (2022/01)
Sayın Üyemiz, İlimiz 2022 yılı Hayvan Hastalıkları İle Mücadele ve Hayvan Hareketlerinin Kontrolü ve Kurban Hizmetleri ile ilgili, 17.06.2022 tarih ve 2022/01 sayılı İl Hayvan Sağlık Zabıtası Komisyon Kararı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.06.2022
Tarım Ürünleri Lisanslı Depoculuk Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik
Sayın Üyemiz, 12/4/2013tarihli ve 28616 sayılı Resmî Gazete’de yayımlanan Tarım Ürünleri Lisanslı Depoculuk Yönetmeliğinin 4 üncü maddesinin birinci fıkrasının (b) bendi değiştirilmiştir. Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.06.2022
İthalatta Tarife Kontenjanı Hakkında
Sayın Üyemiz, Cumhurbaşkanı Kararı ile yürürlüğe konulan Bazı Sanayi Ürünlerinin İthalatında Tarife Kontenjanı Uygulanması Hakkında Karar uyarınca, Gümrük Tarife Pozisyonu (GTP) ve tanımları yer alan eşyanın ithalatında açılan tarife kontenjanlarının dağıtımı, yönetimi ile başvuru ve kullanım usul ve esasları düzenlenmiştir. Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.06.2022
Kredi Okuryazarlık Haftası (27 Haziran – 1 Temmuz)
Sayın Üyemiz, Özel sektör, kamu ve sivil toplum kuruluşlarının iş birliğinde bireylerin ve kurumların finansal hayatlarını daha sağlıklı ve etkin yönetmelerine katkı sağlamak amacıyla bilinçlendirme ve farkındalık etkinlikleri gerçekleştirmek üzere Kredi Okuryazarlık Haftası projesi hayata geçirilmiştir. Proje kapsamında 27 Haziran ile 1 Temmuz 2022 tarihleri arasında; kredi okuryazarlık, krediye kolay erişim ve işletmelerin kendini tanıması, krediye ulaşmada dijitalleşmenin önemi, reel sektörün gözünden alacak riski yönetimi, yeşil dönüşüm, sürdürülebilirlik, krediye erişimde dijital çözümler ve bireylerin kredi okuryazarlığı ve sigorta başlıkları olmak üzere birçok konuda internet üzerinden etkinlikler gerçekleştirilecektir. Etkinlik programı ekte sunulmaktadır. Kredi Okuryazarlık Haftası kapsamında düzenlenecek etkinliklerwww.krediokuryazarlikhaftasi.com web sitesi üzerinden 27 Haziran – 1 Temmuz tarihleri arasında canlı olarak izlenebilecektir. Detaylı ve güncel programa aynı web sitesinde program başlığı altında ulaşılabilmektedir. Bilgilerinize rica olunur.
28.06.2022
Ulusal Staj Programı
Değerli üyemiz, Sizlere Cumhurbaşkanlığı İnsan Kaynakları Ofisi tarafından 3 yıldır başarıyla yürütülen, Ulusal Staj Programı (USP)* aday havuzunun özel sektör işverenlerinin de erişimine açıldığı bilgisini vermek üzere ulaşıyoruz. OECD tarafından üye ülkelere iki kez örnek uygulama olarak gösterilen Program aracılığıyla farklı üniversite, bölüm ve sınıflardan ihtiyaç duyduğunuz genç yeteneklere kolayca ulaşabilir, staj teklifi gönderebilirsiniz. Staj yapacak tüm öğrencilerin sigorta bildirimleri ve prim ödemeleri ise bölüm ve gönüllü/zorunlu staj ayrımı yapılmaksızın öğrenim gördüğü kurumlar tarafından karşılanacaktır. Siz değerli işverenimizi de, Ulusal Staj Programı aracılığıyla gençlerin kariyer gelişimlerini ve istihdam edilebilirliklerini destekleyen özel sektör paydaşları arasında görmekten mutluluk duyacağımızı belirtir, iyi çalışmalar dileriz. Saygılarımızla, *Ulusal Staj Programına ilişkin detaylara ve işveren olarak Programa nasıl dâhil olacağınıza dair bilgilere aşağıdaki linklerden ulaşabilirsiniz. Detaylı Bilgi: https://kariyerkapisi.cbiko.gov.tr/ulusalstajprogrami İşveren Kayıt. https://kariyerkapisi.cbiko.gov.tr/ulusalstajprogrami#4 Ayrıntılı Bilgi İçin Prof. Dr. Duygu KIZILDAĞ Cumhurbaşkanlığı İnsan Kaynakları Ofisi Yetenek Kazanımı ve Organizasyon Dairesi Birim Müdürü Telefon: 0312 403 53 58 E-Posta: duygu.kizildag@cbiko.gov.tr Teknik Destek: 0312 403 53 50 - 0 312 403 53 63 - 0 312 403 53 65
27.06.2022
Hizmet İhracatı Eğitim Programı
Sayın Üyemiz, Birliğimiz koordinasyonunda ve Ticaret Bakanlığı işbirliğinde ihracatçı firmalara yönelik belirli aralıklarla bilgilendirme amaçlı webinarlar düzenlenmektedir. Bu defa, - 2564 sayılı Döviz Kazandırıcı Hizmet Sektörleri Markalaşma Destekleri Hakkında Karar, - 5447 sayılı Türkiye Bilişim Sektörünün Uluslararasılaşma ve E-Turquality (Bilişimin Yıldızları) Programı Hakkında Karar, - 5448 sayılı Hizmet İhracatının Tanımlanması, Sınıflandırılması ve Desteklenmesi Hakkında Karar, - 5449 sayılı Yurt Dışı Lojistik Dağıtım Ağlarının Desteklenmesi Hakkında Karar, ile ilgili 29 Haziran 2022 tarihinde Ticaret Bakanlığı uzmanlarınca ekte bir örneği sunulan programdaki gibi bir bilgilendirme webinarı düzenlenecektir. Bu itibarla,tobb-org.zoom.us/webinar/register/WN_p5g-7oTGSd6y824dS7WhFg adresi üzerinden kayıt olabilirsiniz. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.06.2022
İthalat Rejimi Kararında Değişiklik Yapılmasına İlişkin Karar
Sayın Üyemiz, 16 ürüne ihracattan önce ithalat şartı geldi DİR kapsamında tarım ürünlerine ilişkin düzenlemeleri içeren genelgede köklü bir değişiklik yapılarak aralarında ayçiçeği yağı, margarin, hayvan yemi ve kristal şekerin de bulunduğu 16 tarım ürününe ‘önce ithalat’ şartı getirildi. Pandemi, Rusya-Ukrayna savaşı ve iklim değişikliği etkisiyle tarımsal üretimde yaşanan sıkıntının, gıda arz güvenliğine etkisin azaltmak amacıyla, önemli tarım ürünlerinin DİR kapsamında imalatçı ihracatçılara satışı yasaklandı. Hâlen söz konusu hammaddeleri Türkiye’den alıp, nihai ürüne çevirdikten sonra ihraç etme seçeneği bulunan üreticiler, 1 Ağustos 2022’den itibaren iç piyasadan hammadde alamayacaklar. 20016/1 sayılı Tarım Ürünlerine İlişkin Dahilde İşleme Rejimi (DİR) Genelgesi’nde yapılan değişikliğe göre, bu ürünleri kullanarak ihracat yapanlar 1 Ağustos’tan itibaren önce hammaddeyi ithal edip nihai ürüne çevirmeleri durumunda indirimli veya sıfır gümrük vergisinden yararlanabilecekler. Genelge, ihracata konu işlem görmüş ürünlerin elde edilmesinde kullanılan, ithali vergiye tabi tarım ürünlerini kullanarak üretim yapıp ihracat yapan firmalar için Dahilde İşleme İzin Belgesi (DİİB) düzenlenmesi şartlarını düzenliyor. Yürürlükteki mevzuat uyarınca DİR kapsamında bazı ürünler özel düzenlemeye tabi tutuluyor. Belirli dönemlerde de bu ürünlerin ithalat ve üretim şartları değiştiriliyor. Genelgeye konu 16 ürün şunlar; Buğday, mısır, mercimek, ayçiçeği, aspir ve kolza yağı, margarin, yağlık soya tohumu, ham soya yağı, ham pamuk yağı, palm/palm çekirdeği yağı, kristal şeker, konserve kuru fasulye, konserve nohut ve işlenmiş bezelye. Buğdayda 1.500 ton sınırı; Buğday ithalatı karşılığında buğday unu, buğday irmiği, makarna, şehriye, bulgur, aşurelik buğday ve hazır/anında noodle ihracatı öngören üreticiler önce ithalat yapacaklar. Buğday unu, bulgur ve aşurelik buğday ihracatında, fabrika kendisine ait olan firmalar ilk belgede en fazla 1500 ton buğday ithalatı yapabilecekler. Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.06.2022
BİLGİLENDİRME NOTU
Çalışma izni olmayan yabancı uyruklu kişileri istihdam eden işverenler, çalıştırdıkları işçi başına idari para cezalarına maruz kalmaktadırlar. Üyelerimizden gelen talepler doğrultusunda, yabancı uyruklu işçilerin istihdamında cezai müeyyideye maruz kalınmaması adına Çalışma ve İş Kurumu ile yapılan görüşmeye istinaden; aşağıda yer alan açıklamaların dikkate alınması gerekmektedir. Tarım ve / veya Hayvancılık sektöründe çalışacak, başvuru sahibi ve şartlı mülteci statüsü sahibi yabancılar hakkında duyuru: Tarım ve hayvancılık konusunda muafiyet izni almak isteyen yabancı uyruklu işçilere, Göç İdaresi tarafından bir kimlik belgesi verilmektedir. Tarım ve / veya Hayvancılık sektöründe çalışacak, geçici koruma, uluslararası koruma başvuru sahibi ve şartlı mülteci statüsü sahibi yabancılar, il göç idaresinden aldıkları kimlik belgesi ile doğrudan uluslararası koruma sağlanan ildeki Çalışma ve İş Kurumu İl Müdürlüğü’ ne başvuru yapacaklardır. Örneğin Eskişehir İl Göç İdaresinden kimlik belgesi alan yabancı uyruklu işçi sadece Eskişehir Çalışma ve İş Kurumu İl Müdürlüğü’ne müracaat edebilir. Çalışma ve İş Kurumu İl Müdürlüğü personelleri tarafından işçilerden Muafiyet Talep Dilekçesi alındıktan sonra Çalışma Bakanlığı sistemi üzerinde işçilerin kontrolü yapılarak uygun bulunmaları halinde işçilere “Uluslararası Koruma Sağlanan Yabancılara Mevsimlik Tarım veya Hayvancılık İşlerinde Tanınan Çalışma İzni Muafiyet Bilgi Formu” verilecektir. İşverenlerin İşkur’a başvuru yapmasına gerek bulunmamaktadır. Yabancı uyruklu kişiler, çalışma izinleri onaylandığında başka bir ilde çalışmak istemeleri durumunda, bağlı oldukları göç idaresine başvuruda bulunmak suretiyle (Göç İdaresi Daire Başkanlığı’nın olumlu bakması halinde) sevkleri yapılarak diğer illerde de çalışabilmektedirler. Bilgilerinize sunulur. Saygılarımızla,
23.06.2022
Türk Devletleri Teşkilatı - Tarım Forumu
Sayın Üyemiz, Türk Devletler Teşkilatı Tarım Bakanları 6. Toplantısı kapsamında, Türk Devletleri Tarım İş Forumu ve İkili İş görüşmeleri 4 Temmuz 2022 tarihinde Özbekistan ın başkenti Taşkent te gerçekleştirileceği bildirilmişti. Söz konusu Foruma, Türkiye Cumhuriyeti Tarım ve Orman Bakanı Sayın Prof. Dr. Vahit KİRİŞCİ nin de katılım sağlayarak bir konuşma yapması beklenmektedir. İş Forumu na; Özbekistan başta olmak üzere, ülkemiz ve Azerbaycan, Kazakistan, Kırgızistan, Macaristan ve Türkmenistan dan tarımsal üretim ve çiftçilik, gıda işleme, tarım makineleri ve teçhizatı ve tarım teknolojileri konularında faaliyet gösteren firma temsilcilerinin katlımı beklenmektedir. İş Forumu nun taslak programı ekte sunulmaktadır. İlgilenenlerin katılım teyidini en geç 30 Haziran 2022 tarihine kadar, Borsamıza (Egemen Akbulut, Eposta: egemenakbulut@esktb.org.tr ) iletilmesini rica ederiz. Gültekin Güler Genel Sekreter
23.06.2022
İşyerleri İçin Afet Farkındalık Eğitimi-28.06.2022
Sayın Üyemiz, Birliğimiz organizasyonunda, 28 Haziran 2022 Salı günü saat 14:00 te internet üzerinden "İşyerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
23.06.2022
2022 Yılı Trampa Programı
Sayın Üyemiz, 2863 sayılı Kanunun 15 inci maddesinin (f) bendi ile bu bende dayanılarak hazırlanan ve 22.05.2010 gün, 27588 sayılı Resmi Gazete de yayımlanarak yürürlüğe giren "Sit Alanlarında Kalan Taşınmazların Hazine Taşınmazları İle Değiştirilmesi Hakkında Yönetmelik" hükümleri kapsamında değerlendirilmek üzere Bakanlığımıza iletilen başvurular ve bilgi, belgeler doğrultusunda hazırlanan 2022 Yılı Trampa Programı, Bakanlık Makamının 14.06.2022 tarihli ve E-18508952-752.01.02-2563221 sayılı Oluru ile uygun bulunduğu ilgi yazı ile bildirilmiştir. Yukarıda adı geçen Yönetmeliğin 5.maddesinin (1),(2),(3),(4) fıkralarında belirtilen usul ve esaslara göre ilan edilmesi; Trampa talebine konu taşınmazların, Yönetmeliğin "Başvurunun şekli ve inceleme" başlıklı 6.maddesinin (4),(5) fıkralarında belirtilen esaslar doğrultusunda incelenerek, tapu kayıtlarına (bulunmaması halinde) sit alanında kaldığına dair şerh konulmasının da sağlanarak hazırlanacak olan belgelerinin Bakanlığımız Kültür Varlıkları ve Müzeler Genel Müdürlüğüne iletilmesi; 2022 yılı Trampa Programında yer alan sit alanlarının, sınırları itibarıyla programda belirtilen yerleşim birimleri dışında başka yerleşim birimlerini kapsaması halinde bu mahalle/köylerde olup trampası talep edilen gerçek ve özel hukuk tüzel kişilerinin mülkiyetindeki taşınmazlar ile ilgili olarak da ilgi yazıda belirtilen işlemlerin ilgi yazı doğrultusunda gerçekleştirilmesi hususunda bilgilerinizi ve gereğini arz ve rica ederim. Gültekin Güler Genel Sekreter
22.06.2022
TOBB Türkiye 100 Yarışması
Sayın Üyemiz, Birliğimiz öncülüğünde Türkiye Ekonomi Politikaları Araştırma Vakfı (TEPAV) ve TOBB Ekonomi ve Teknoloji Üniversitesi (TOBB ETÜ) işbirliğinde, 2011 yılından bu yana Türkiye nin en hızlı büyüyen şirketlerini belirlemek üzere, "TOBB Türkiye 100" programı düzenlenmektedir. Türkiye 100 ile Türkiye nin hızlı büyüyen şirketlerinin başarılarına küresel ölçekte dikkat çekerek küresel bağlantılarını kuvvetlendirmek başarı hikayelerinin ulusal ve uluslararası yazılı ve görsel basında yer almasını sağlayarak doğru iş ortaklarına, yeni müşterilere ve yatırımcılara erişimlerini kolaylaştırmak hedeflenmektedir. Türkiye 100 programında dereceye giren şirketler tamamen objektif kriterlere dayanılarak tespit edilmektedir. Satış gelirleri artış hızının temel performans kriteri olduğu olduğu değerlendirmelerde, en yüksek satış gelirleri artış hızını yakalayan şirket birinciliği almaktadır. Bildiğiniz gibi 2021 yılında TOBB Türkiye 100 ödül töreni; Ticaret Bakanımız Mehmet Muş ve çok sayıda Oda-Borsa Başkanı ile TOBB Başkanımız M. Rifat Hisarcıklıoğlu nun ev sahipliğinde Ankara da düzenlenen törenle açıklandı. 2022 yılında düzenlenecek olan TOBB Türkiye 100 programında şirketlerin 2019 - 2021 dönemindeki yıllık ortalama satış gelirlerinin artış hızı dikkate alınacaktır. Başvuru kriterini sağlayan şirketler büyüme hızlarına göre sıralanacak, en hızlı büyüyen şirket birinciliği alacaktır. Türk özel sektörünün dünyayla olan bağlantılarının kuvvetlendirilmesine imkan sağlayacak olan TOBB Türkiye 100 e başvuru şartları ekte yer almakta olup, başvuruların en geç 30 Temmuz 2022 tarihine kadar turkiye100.tobb.org.tr üzerinden yapılması gerekmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
22.06.2022
İhale İlan Metni-21.06.2022
Çifteler Kaymakamlığı Milli Emlak şefliğince 05.07.2022 tarihinde 2886 sayılı Kanunun 45. maddesi uyarınca satış ihaleleri yapılacak taşınmazlara ait ihale ilan metni ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
21.06.2022
KOSGEB Ar-Ge, Ür-Ge ve İnovasyon Destek Programı Bilgilendirme Semineri
Sayın Üyemiz, KOSGEB Ar-Ge, Ür-Ge ve İnovasyon Destek Programı Bilgilendirme Semineri, 23 Haziran 2022 Perşembe günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. KOSGEB, 2050 yılında sıfır karbon hedefine katkı sağlayacak Ar-Ge ve İnovasyon ile Ür-Ge projelerinin desteklenmesi için yeni bir çağrı başlatmıştır. KOSGEB ve TOBB iş birliğinde gerçekleştirilecek olan seminerde, KOBİ ler için Ar-Ge, Ür-Ge ve İnovasyon Desteği kapsamında karbon emisyonu azaltılmasına yönelik 2 milyon TL ye kadar destek sağlayan KOSGEB Ar-Ge, Ür-Ge ve İnovasyon Destek Programı yeni çağrısı anlatılacak olup, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
21.06.2022
Ekonomik Yatırımlar Hibe Desteği Süreleri
Sayın Üyemiz, Tarım ve Orman Bakanlığı ndan Birliğimize intikal eden ilgi yazıda; 21.11.2020 tarihli ve 31311 sayılı Resmi Gazete de yayımlanarak yürürlüğe girmiş olan Kırsal Kalkınma Destekleri Kapsamında Tarıma Dayalı Ekonomik Yatırımların Desteklenmesi Hakkında Tebliğe ilişkin Bakanlığın Hukuk Hizmetleri Genel Müdürlüğü nden almış olduğu görüş ekte yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
20.06.2022
HKS Stok Kayıtları
Sayın Üyemiz, Ticaret Bakanlığı nın ilgi yazısında; Hal Kayıt Sistemi üzerinden alınan verilere göre sebze ve meyve ticareti ile iştigal eden sanayicilerin stoklarında fiili olarak bulunması mümkün olmayan geçmiş tarihlere ait önemli miktarda mal bulunduğu tespit edildiği ifade edilmekte ve sistem kayıtlarında yer alan ancak fiilen sanayicilerin stoklarında bulunmayan malların stok kayıtlarından düşülebilmesi için, bu mallardan; sınai üretimde kullanılmış olanların sınai işletmesine sevk bildirimlerinin, iç piyasaya sunulmuş olanların ise satış/sevk bildirimlerinin ivedilikle yapılarak depo kayıtlarından çıkışının sağlanması gerekmekte olduğu bildirilmektedir. Bu itibarla, Odalara kayıtlı sebze ve meyve ticaretiyle iştigal eden tüm sanayicilerin, anılan mevzuat hükümleri çerçevesinde Hal Kayıt Sistemi üzerinden yapılmamış olan satış veya sevk bildirimlerinin ivedilikle yapılması gerekmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.06.2022
Bitkisel ve Hayvansal Atık Yağların Yönetimi Yönetmeliği Taslağı Hk.
Sayın Üyemiz, Bitkisel atık yağların oluşumundan bertarafına kadar çevre ve insan sağlığına zarar vermeden yönetiminin sağlanması, yönetiminde gerekli teknik ve idari standartların oluşturulması ve buna yönelik prensip, politika ve programların belirlenmesine ilişkin usul ve esaslar 06.06.2015 tarihli ve 29378 sayılı Resmî Gazetede yayımlanan Bitkisel Atık Yağların Kontrolü Yönetmeliği ile hüküm altına alındığı belirtilmiştir. Bitkisel ve hayvansal atık yağlardan biyodizel üretimine ilişkin olarak katma değeri yüksek ve standartlara uygun ürünlerin elde edilmesi, yüksek verimli tesislerin kurulması, toplama oranlarının arttırılarak usulsüz kullanımların önlenmesi, mevzuata uyum sağlanması ve uygulamada yaşanan sorunların giderilerek ülkemizde bitkisel ve hayvansal atık yağların yönetiminin daha etkin hale getirilmesi amacı ile "Bitkisel ve Hayvansal Atık Yağların Yönetimi Yönetmeliği Taslağı" Bakanlık tarafından hazırlanmış olupcygm.csb.gov.tr/taslaklar-i-443 adresinde görüşe açılmıştır. Bahse konu görüşe açılan taslağa ilişkin görüşlerinizin "Mevzuat Hazırlama Usul ve Esasları Hakkında Yönetmelik" hükümleri çerçevesinde ekte iletilen "Görüş Bildirme Formu"na işlenerek 27 Haziran 2022 tarihi mesai bitimine kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesini rica ederim. Gültekin Güler Genel Sekreter
16.06.2022
Standart Dışı Buğday ve Arpa Alımı
Sayın üyemiz, 2022 dönemi hububat alımlarına ilişkin olarak "2022 Yılı TMO Alım Uygulamaları" ile "Randevulu Alım Usul Ve Esaslarını" içerir duyuru metni 10.06.2022 tarihli ve E-46095028-106.01-776870 sayılı yazımız ile Başkanlığınıza/Müdürlüğünüze duyurulmuştu. Bilindiği üzere, ekilişlerde gübre ve sertifikalı tohum kullanımı geçtiğimiz yıllara nazaran düşük gerçekleşmiş olup içinde bulunduğumuz hasat döneminde ise yaşanan/yaşanmakta olan iklimsel hadiseler dikkate alındığında, Kurumumuza satın alma şartları ve baremleri dışında ürün getirebilecek üreticilerin mağduriyetine sebebiyet vermemek amacıyla güncelleme yapılmıştır. Bu kapsamda, Kurumumuzca 2022 döneminde satın alma şartları ve baremlerini belirtilen kriterlerin dışında kalan makarnalık/ekmeklik buğdaylar ve arpalar ayrı birer kod ve fiyat ile Standart Dışı Buğday ve Standart Dışı Arpa olarak satın alınacaktır. Üreticilerimiz tarafından Lisanslı depolara arz edilecek ürünler, TSE standardına göre analiz edilerek sınıflandırıldığından dolayı, Standart Dışı Buğday ve Standart Dışı Arpa grubundan alınacak ürünler, sadece Kurumumuz iş yerlerinde alım işlemine tabi tutulacaktır. Alımı yapılacak standart dışı makarnalık/ekmeklik buğdaylar ve arpalar ekteki tabloda belirtilen kod ve fiyattan satın alınacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.06.2022
İş Etiği ve Uyum Uygulamaları Semineri
Sayın Üyemiz, 22 Haziran 2022 Çarşamba günü saat 14:00 te internet üzerinden "Uluslararası Rekabette Sürdürülebilir Ticaretin Kapısı: İş Etiği ve Uyum Uygulamaları" semineri gerçekleştirilecektir. Seminere ilişkin program ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği organizasyonunda internet üzerinden gerçekleştirilecek olan seminerde; TOBB üyeleri ve paydaşları iş etiği ve uyum konularında bilgilendirilecek ve bu alandaki faaliyetlerin özellikle uluslararası rekabette kurumlara sağlayacağı avantajlar anlatılacaktır. Ayrıca etkin bir etik ve uyum programının temel unsurlarından da bahsedilerek, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
13.06.2022
Elektronik İhale Zorunluluğu Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz ve Kamu İhale Kurumu işbirliğinde 21 Haziran Salı günü saat 14:00 te "Elektronik İhale Zorunluluğu Bilgilendirme Semineri" düzenlenecektir. Etkinliğe ilişkin davet ekte yer almaktadır. Türkiye Odalar ve Borsalar Birliği İle Kamu İhale Kurumu iş birliğinde gerçekleştirilecek olan seminerde 1 Ağustos 2022 den itibaren kademeli olarak zorunlu getirilecek elektronik ihale (e-ihale) süreci ve EKAP hakkında bilgi verilecek, e-ihale kayıt, ilan ve ihale komisyonu işlemleri, ihale dokümanı indirme ve e-teklif verme işlemleri, yeterlilik bilgileri tablosu işlemleri, e-teklif değerlendirme, yasaklılık teyidi ve ihale komisyonu kararı işlemleri anlatılacak, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
13.06.2022
İnovasyonla Yerli Üretim ve KOBİlerin Gücü Dijital Etkinliği
Sayın Üyemiz, Turkcell in satın alma politikaları ve yerlilik programları hakkında bilgi vermek üzere, Sanayi ve Teknoloji Bakanlığı, Birliğimiz ve Turkcell işbirliğinde 14 Haziran 2022 Salı günü saat 13:00 te "İnovasyonla Yerli Üretim ve KOBİ lerin Gücü" dijital etkinliği gerçekleştirilecektir. Etkinliğe ilişkin program ekte sunulmaktadır. Sanayi ve Teknoloji Bakanı Sn. Mustafa Varank, Türkiye Odalar ve Borsalar Birliği Başkanı Sn. M. Rifat Hisarcıklıoğlu ve Turkcell Yönetim Kurulu Başkanı Sn. Bülent Aksu ile Turkcell CEO su Sn. Murat Erkan ın katılımıyla dijital ortamda gerçekleştirilecek etkinlikte Turkcell in tedarik zinciri çalışmaları, Tedarikçi Eksenli İnovasyon Programı, Büyük Ortağım Programı, Yerlilik Programı, Dijital İş Çözümleri ile Yerli Malı Belgesi uygulaması anlatılacak, ayrıca siber güvenlik ve yapay zeka alanında Turkcell ile işbirliği imkanlarından bahsedilecek, etkinlik sonunda katılımcıların soruları cevaplanacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
13.06.2022
Kuraklık Toplantısı Tavsiye Kararları
Eskişehir Tarımsal Kuraklık İl Kriz Merkezi Yönetiminin, Tarımsal Kuraklık Yönetiminin Görevleri Çalışma Usul ve Esaslarına ilişkin 18.08.2012 tarihli Yönetmeliğin 12. Maddesi 2. Bendine göre 28.04.2022 tarihinde yapmış olduğu toplantıya ilişkin 2002/3 nolu kararı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
10.06.2022
2022 Yılı TMO Alım Uygulamaları ve Randevulu Alım Duyurusu
Sayın İlgililer, TMO 2022 dönemi hububat (buğday, arpa, çavdar, tritikale ve yulaf) alımlarını geçtiğimiz yıllarda olduğu gibi randevulu olarak yapacaktır. Lisanslı Depolarda yapılacak alımlarda randevu şartı aranmayacak olup, "2022 Yılı TMO Alım Uygulamaları" ile "Randevulu Alım Usul ve Esaslarını" içerir duyuru metni ekte sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
10.06.2022
Buğday-Arpa Alım Fiyatı Belirlendi
Sayın Üyemiz, TMO tarafından hububat alım fiyatları ile ilgili açıklama aşağıdaki gibidir. 2022 DÖNEMİ TMO ALIM FİYATLARI CİNSİ ALIM FİYATI(TL/TON) MAKARNALIK BUĞDAYLAR MAKARNALIK BUĞDAY (2.Grup) 6.500 DÜŞÜK VASIFLI MAKARNALIK BUĞDAY 6.250 EKMEKLİK BUĞDAYLAR SERT EKMEKLİK BUĞDAY (2.Grup) 6.050 DİĞER EKMEKLİK BUĞDAY (2.Grup) 6.025 DÜŞÜK VASIFLI EKMEKLİK BUĞDAY 5.975 ARPA-ÇAVDAR-YULAF-TRİTİKALE (2. Grup) 5.500 SertEkmeklik Buğdayfiyatına kalitesine göre (1. Grup)ton başına 100 TL ilave fiyat verilecektir. Bu şekilde1. Grup Sert Ekmeklik Buğday fiyatı ton başına 6.150 TL olacaktır. Makarnalık Buğday fiyatınakalitesine göre (1. Grup)ton başına 100 TL ilave fiyat verilecektir. Bu şekilde1. Grup Makarnalık Buğday fiyatı ton başına 6.600 TL olacaktır. Arpa fiyatınakalitesine göre (1. Grup)ton başına 100 TL ilave fiyat uygulanacaktır. Bu şekilde 1. Grup Arpafiyatı ton başına 5.600 TL olacaktır. Ayrıca üreticilerimiz, Bakanlığımızca verilenmazot, gübre, sertifikalı tohum ve fark ödemesi desteklerinialmaya devam edecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.06.2022
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-02.06.2022
Sayın Üyemiz, TMO 2022 yılı Haziran ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve Sözleşme Bazında)" konulu satış duyurusu ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.06.2022
Devlet Destekli Ticari Alacak Sigortası-2022
Sayın Üyemiz, 27 Mayıs 2022 tarihli ve 31848 sayılı Resmi Gazete de; "Küçük ve Orta Ölçekli İşletmelere Yönelik Devlet Destekli Ticari Alacak Sigortası Tarife ve Talimat Tebliğinde Değişiklik Yapılmasına Dair Tebliğ" yayımlanmıştır. Buna göre; KOBİ lerin sağlaması gereken ciro şartı 125 milyon TL den 250 milyon TL ye çıkarılırken, yurt içi satışlardan elde ettiği cirosu 250 milyon TL ye kadar olan KOBİ ler sistemden faydalanabilecektir. Halihazırda sistemdeki KOBİ lerin yenileme dönemleri bakımından 300 milyon TL olarak uygulanan bu sınır 500 milyon TL ye yükseltilirken, bu kapsamda sistemin kapsayıcılığı genişletilmiştir. Ayrıca; sisteme ilişkin sorgulama ücreti 10 TL yerine 15 TL şeklinde artırılmıştır. Alıcı başına azami kredi limiti 750 bin TL den 1 milyon TL ye yükseltilirken bu kapsamda sistemin teminat sağlama kapasitesi genişletilmiştir. Tebliğ ile ilgili bilgi dokümanı ve karşılaştırma tablosu ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.06.2022
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-01.06.2022
Sayın Üyemiz, TMO 2022 yılı Haziran ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve Sözleşme Bazında)" konulu satış duyurusu ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
1.06.2022
Educathon Eğitim Maratonu ve Ödüllü Yarışması
Sayın Üyemiz, Adana Sanayi Odası tarafından Birliğimize iletilen 26.05.2022 tarih ve 1593 sayılı yazı ekte dikkatinize sunulmuştur. Söz konusu yazıda Adana Mesleki Eğitim Merkezi Teknik Destek Projesi kapsamında "Mesleki Eğitimde Yenilikçi Yaklaşımlar" konulu bir Educathon (Eğitim Maratonu) organizasyonu gerçekleştirileceği bilgisi yer almaktadır. Mesleki eğitime olan ilgiyi artırmayı hedefleyen söz konusu etkinliğin ayrıntıları yazımızın ekinde yer almakta olup başvurularegitimmaratonu.com linki üzerinden alınacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.05.2022
Bilişim Sektörü Destekleri Bilgilendirme Toplantısı 2 Haziran 2022
Birliğimiz bünyesinde yürütülen sektör bilgilendirme faaliyetleri kapsamında,TOBB Ankara Birlik Merkezi Konferans Salonu nda, 2 Haziran 2022 tarihinde saat 14:00-16:00 arasında, "Bilişim Sektörü Destekleri Toplantısı" düzenlenecektir. Toplantı Davet yazısı ve program ekte takdim edilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
30.05.2022
Şeker İthalatında Tarife Kontenjanı Uygulaması
Sayın Üyemiz, Şeker İthalatında Tarife Kontenjanı Uygulaması hakkında karar Resmi Gazetede yayınlanarak yürürlüğe girdi. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
27.05.2022
Şeker İthalatında Tarife Kontenjanı Uygulanmasına İlişkin Tebliğ
Sayın Üyemiz, Şeker İthalatında Tarife Kontenjanı Uygulanmasına İlişkin Tebliğ Resmi Gazetede yayınlanarak yürürlüğe girdi. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
27.05.2022
Özel Tüketim Vergisinde Değişiklik
Sayın Üyemiz, Özel tüketim vergisi kanununda yapılan değişiklik Resmi Gazetede yayınlanarak yürürlüğe girdi. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
27.05.2022
Küçük ve Orta Ölçekli İşletmelere Yönelik Devlet Destekli Ticari Alacak Sigortası Tarife Ve Talimat Tebliğinde Değişiklik
Sayın Üyemiz, "Küçük ve Orta Ölçekli İşletmelere Yönelik Devlet Destekli Ticari Alacak Sigortası Tarife Ve Talimat Tebliğinde Değişiklik"Resmi Gazetede yayınlanarak yürürlüğe konmuştur. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
27.05.2022
Türk Ticaret Kanunu Çalıştayı
Sayın üyemiz, Adalet Bakanlığı Hukuk İşleri Genel Müdürlüğü nden alınan ilgi yazıda, 6102 sayılı Türk Ticaret Kanunu nun yürürlüğünün onuncu yılı münasebetiyle düzenlenmesi planlanan sempozyumda/çalıştayda dikkate alınmak üzere mezkûr Kanun özelinde yargıya intikal etmiş veya edebilecek hususlarda, ticari yaşamın sürat, etkinlik ve güvenilirliğine engel teşkil ettiği düşünülen sorunlar ve varsa çözüm önerilerinin Bakanlıklarına iletilmesi istenilmektedir. Bu itibarla, Birliğimiz görüşüne esas teşkil etmek üzere anılan Kanuna ilişkin sorunlar ve varsa çözüm önerilerinizin 01.06.2022 Çarşamba günü mesai bitimine kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesini rica ederim. Gültekin Güler Genel Sekreter
26.05.2022
2022 Yılı Taslak Buğday Alım Baremi
Sayın Üyemiz, 28 Nisan 2022 tarihinde düzenlenen 2022 Yılı Ekmeklik Buğday Çeşitleri Değerlendirme Toplantısı sonucunda kararlaştırılan 2022 Yılı Taslak Buğday Alım Baremi ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.05.2022
Elektronik Ürün Senedi Yönetmeliğinde Değişiklik
Sayın Üyemiz, Elektronik ürün senedi yönetmeliğinde değişiklik yapılmasına dair yönetmelik Resmi Gazete yayınlanarak yürürlüğe girdi. Resmi Gazete ayrıntıları için tıklayınız Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.05.2022
KOSGEB-İşletme Geliştirme Destek Programı Belgelendirme Desteği
Sayın Üyemiz, Helal Akreditasyon Kurumu (HAK) tarafından Birliğimize iletilen 16.05.2022 tarih ve 74621249 sayılı yazı ekte dikkatinize sunulmuştur. Söz konusu yazıda KOSGEB tarafından yapılan güncellemeyle, HAK tan ve HAK tarafından akredite edilmiş kuruluşlardan alınacak belgeler için destek üst limitinin 2.500 TL den 10.000 TL ye yükseltildiği bilgisi iletilmektedir. KOSGEB internet sayfası üzerinden ayrıntılara erişim sağlanabilmektedir: www.kosgeb.gov.tr/site/tr/genel/destekdetay/6798/isletme-gelistirme-destekprogrami Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.05.2022
UKCA İşareti Webinarı
Sayın Üyemiz, 1 Ocak 2023 tarihinden itibaren Britanya ya (İngiltere, Galler ve İskoçya) yapılacak ihracatta UK Conformity Assessed/BK Uygunluk Değerlendirmesi (UKCA) işareti, Avrupa Birliği (AB) Yeni Yaklaşım Direktifleri kapsamında AB de ve Türkiye de yerleşik (AB tarafından tanınan 3. ülkelerde yerleşik olanlar dâhil) onaylanmış kuruluşlar tarafından düzenlenen CE işaretinin yerini alacaktır. CE işareti gerektiren çoğu eşyayı kapsayan ve CE işareti gibi, eşyanın ilgili mevzuata ilişkin tüm gereklilikleri karşıladığını gösteren UKCA işaretinin, Britanya (İngiltere, Galler ve İskoçya) piyasasına sunulacak eşya için kullanılması zorunlu olacak ve bu önemli değişiklik Türk ihracatçılarını da doğrudan etkileyecektir. İngiltere İş, Enerji ve Sanayi Stratejisi Departmanı (BEIS) tarafından söz konusu değişikliğin getireceği yeni düzenlemeler hakkında bilgilendirme yapılması amacıyla Türkiye nin öncelikli ülkelerden biri olarak belirlendiği vurgulanmıştır. Bu çerçevede, ilgide kayıtlı elektronik postada, 27 Mayıs 2022 tarihinde 14:00-15:30 saatleri arasında Birleşik Krallık Uluslararası Ticaret Bakanlığı ve İngiliz Standartları Enstitüsü (BSI) işbirliğinde çevrimiçi "UKCA İşareti: Birleşik Krallık ta pazar erişimini güvence altına almak" konulu webinarın düzenleneceği bildirilmektedir. Ekte programı sunulan söz konusu sanal etkinliğe ilgi duyan firma temsilcilerininregister.gotowebinar.com/register/8705543165130214670 linkten kayıt yapmaları gerekmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.05.2022
TOBB Ticaret Merkezleri ABD ile Ticaret Bilgilendirme Semineri
Sayın Üyemiz, TOBB Ticaret Merkezleri, ABD ile Ticaret Bilgilendirme Semineri 27 Mayıs 2022 Cuma günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin program ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile TOBB Ticaret Merkezleri A.Ş. işbirliğinde internet üzerinden gerçekleştirilecek olan seminerde, TOBB Ticaret Merkezleri nin ABD Şikago daki birimi, bu birimin ABD ile ticaret, e-ticaret ve lojistik operasyonlar konusunda Türkiye de faaliyet gösteren şirketlere yönelik hizmetleri anlatılacak, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.05.2022
Webinar- Telekomünikasyon Sektörünün Yurtdışına Açılımına Yönelik Sağlanacak Teşvikler
Sayın Üyemiz, Birliğimizce organize edilen, Telekomünikasyon Sektörünün Yurtdışına Açılımına Yönelik Sağlanacak Teşvikler başlıklı webinarda saat değişikliği olmuştur. Konuyla ilgili detaylar aşağıda verilmektedir. Birliğimiz bünyesinde yürütülen sektör bilgilendirme faaliyetleri kapsamında, 26 Mayıs 2022 tarihinde15:30- 16:45saatleri arasında Telekomünikasyon Sektörünün Yurtdışına Açılımına Yönelik Sağlanacak Teşvikler başlıklı bir webinar düzenlenecektir. Webinarda, 20 Nisan 2022 tarihinde yayınlanan "Türkiye Bilişim Sektörünün Uluslararasılaşması ve E[1]Turquality (Bilişimin Yıldızları) Programı Hakkındaki Cumhurbaşkanlığı Kararı çerçevesinde; telekomünikasyon sektörüne sağlanan teşvik ve destekler hakkında bilgi verilecektir. Veri merkezi, telekomünikasyon, bulut veri ve iletişim, 5G gibi sektörleri ilgilendiren webinarın ardından, katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.05.2022
Yurt İçinde Canlı Hayvan Ve Hayvansal Ürünlerin Nakilleri Hakkında
Sayın Üyemiz, Yurt içinde canlı hayvan ve hayvansal ürünlerin nakilleri hakkında yapılan Resmi Gazetedeki Değişiklik ve ayrıntılar için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.05.2022
Sığır Cinsi Hayvanların Tanımlanması Hk.
Sayın Üyemiz, Sığır cinsi hayvanların tanımlanması, tescili ve izlenmesi yönetmeliğinde değişilik yapılmasına dair Resmi Gazetede yayınlanan tebliğ ve ayrıntıları içintıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.05.2022
Koyun ve Keçi Türü Hayvanların Tanımlanması Hk.
Sayın Üyemiz, Koyun ve keçi türü hayvanların tanımlanması, tescili ve izlenmesi yönetmeliğinde değişilik yapılmasına dair Resmi Gazetede yayınlanan tebliğ ve ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.05.2022
Coğrafi İşaret Webinarları
Sayın Üyemiz, Birliğimiz, Türk Patent ve Marka Kurumu işbirliğiyle aşağıdaki program çerçevesinde bilgilendirme webinarları düzenleyecek olup webinar sonunda katılımcıların soruları cevaplandırılacaktır. Webinarlara ilişkin duyuru materyalleri ekte dikkatinize sunulmuştur.  26 Mayıs 2022 14:00: Coğrafi İşaret ve Geleneksel Ürün Adı Başvuru Hazırlama Webinarı  9 Haziran 2022 14:00: Coğrafi İşaret ve Geleneksel Ürün Adı Denetim Süreçleri ve Hukuki İşlemler Webinarı  30 Haziran 2022 14:00: Avrupa Birliği Coğrafi İşaret Koruması, Doğru Ürün Seçimi ve Başvuru Hazırlanması Webinarı  4 Ağustos 2022 14:00: Coğrafi İşaret ve Geleneksel Ürün Adı Tescil Sonrası İşlemler ve Ticarileşme Webinarı Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
23.05.2022
D-8 Yatırım Forumu
Sayın üyemiz, Ülkemiz ile Bangladeş, Endonezya, İran, Malezya, Mısır, Nijerya ve Pakistan dan oluşan Gelişen Sekiz Ülke (D-8) Ekonomik İşbirliği Teşkilatı, üye ülkeler arasında kalkınmaya yönelik işbirliğini geliştirmek, ekonomik ve sosyal ilişkileri zenginleştirmek amacıyla 1997 yılında kurulmuş olan bir örgüttür. Türkiye Odalar ve Borsalar Birliği, D-8 marjında kurulmuş olan D-8 Ticaret ve Sanayi Odaları nın (D-8 TSO) kurucu üyesidir. Ülkemizin D-8 2017-2021 dönem başkanlığı çerçevesinde, D-8 TSO Dönem başkanlığı da Birliğimizce yürütülmüştür. D-8 TSO Dönem Başkanlığı kapsamında Birliğimiz tarafından bir dizi etkinlik gerçekleştirilmiştir. Bu çerçevede, bu yıl kutlanacak olan D-8 Ekonomik İşbirliği Teşkilatı nın 25 inci kuruluş yıl dönümü münasebetiyle, 16 Haziran 2022 tarihinde Wyndham Grand Istanbul Levent Otel de 10:00-17:50 saatleri arasında D-8 Genel Sekretaryası ve Birliğimiz işbirliğinde, D-8 üye ülkelerinin Yatırım Ajansları ve D-8 Ticaret ve Sanayi Odası temsilcilerinin bir araya geleceği "D-8 Yatırım Forumu" düzenlenecektir. D-8 üyesi ülkelerin Yatırım Ajansları yetkilileri tarafından sunumların yapılması planlanan ve Türkçeİngilizce tercüme hizmeti sunulacak olan Foruma katılmak isteyenlerinanket.tobb.org.tr/#/anket/d-8- yatirim-forumu linki üzerinden 14 Haziran 2022 tarihine kadar kayıt yaptırmaları gerekmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
23.05.2022
İş Yerleri için Afet Farkındalık Eğitimi - 25.05.2022
Sayın üyemiz, Birliğimiz organizasyonunda, 25 Mayıs 2022 Çarşamba günü saat 14:00 te internet üzerinden "İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur.
20.05.2022
Tekstil ve İklimlendirme Sektörleri - SKDM Eğitimi
Sayın üyemiz, Bildiğiniz üzere, Aralık 2019 tarihinde yayımlanan Avrupa Yeşil Mutabakatı Belgesi, Avrupa nın 2050 yılında ilk karbon-nötr kıta olması hedefiyle yola çıkan ve bütün sanayisini dönüştürmeyi gerektiren bir yeşil büyüme stratejisidir. Bu kapsamda AB, bütün politika metinlerini gözden geçirmektedir. Yapılan düzenlemeler arasında; İklim Kanunu, Yeni Sanayi Stratejisi, Tekstil Stratejisi, Sürdürülebilir Ürün İnisiyatifi gibi metinler bulunmaktadır. Söz konusu düzenlemelere ilişkin bilgi notları zaman zaman tarafınıza iletilmektedir. Avrupa Yeşil Mutabakatı kapsamında, uluslararası arenayı en çok etkileyecek düzenleme ise Sınırda Karbon Düzenleme Mekanizması (SKDM) olacaktır. Temmuz ayında açıklanan 55 e Uyum paketi ile detayları açıklanan SKDM ile AB ülkelerine yapılacak ihracata bir vergi yükü gelmesi beklenmekte olup; sektörlerimizin şimdiden hazırlıklarına başlaması elzemdir. Bu kapsamda, ilgili sektörlere SKDM kapsamındaki ürünlere yönelik detaylı eğitim verme çalışmalarımız başlamış olup, ilk eğitim Ocak ayında gübre ihracatı yapan firmalar için düzenlenmiştir. Diğer sektörler için de eğitimlerimiz devam etmektedir. Tekstil sektörü için 8 Haziran 2022, İklimlendirme sektörü için 9 Haziran 2022 tarihlerinde Birliğimiz Sosyal Tesislerinde (Ankara) gerçekleştirilecek olan eğitimlerin programı ekte yer almaktadır. Bu eğitim hizmetinin kontenjanı sınırlı olup, eğitime katılmak isteyen üyelerimizin bilgilerini 27 Mayıs 2022 tarihi mesai saati sonuna kadar ekteki forma işlenmek suretiyle Borsamıza egemenakbulut@esktb.org.tr adresine elektronik ortamda gönderilmesini rica ederiz. Gültekin Güler Genel Sekreter
20.05.2022
7. Uluslararası Su ve Sanitasyon Teknolojileri Fuarı
Sayın Üyemiz, Rabat Büyükelçiliğine "Field Attitude" tarafından gönderilen bir yazıya atfen, 07-09 Haziran 2022 tarihleri arasında Kazablanka şehrinde "7e Edition du Salon International des Technologies de l Eau et de l Assainissement (SITeau 7) - 7. Uluslararası Su ve Sanitasyon Teknolojileri Fuarı"nın düzenleneceği ve söz konusu Fuar çerçevesinde, Su, sanitasyon ve enerji mesleklerine ilişkin sergi alanının olduğu, (Burada Start-up lara ayrılmış özel bir alan da olacağı), Fas Su Koalisyonu "COALMA" ile ortaklaşa "Su, Topraklar ve Sürdürülebilirlik" temalı üst düzey bir uluslararası konferans yapılacağı, Deneyim alışverişi ve aktarımı için "gençler" ve "yaşlılar"ı bir araya getirerek "kuşaklar arası" bir diyalog oluşturulacağı, SITeau ile birlikte düzenlenen suyun yasal ve kurumsal boyutlarına yönelik eğitimler yapılacağı, B2B toplantıları (istek üzerine) etkinliklerinin düzenleneceği bildirilmektedir. Yazı ekinde iletilen Fuarın sunumunda, düzenlenecek ilgili Fuara katılmak isteyen firmaların fieldattitude.com/siteau7/inscription/sitesi üzerinden başvuru yapmasının mümkün olduğu belirtilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
20.05.2022
Webinar- Telekomünikasyon Sektörünün Yurtdışına Açılımına Yönelik Sağlanacak Teşvikler
Sayın Üyemiz, Birliğimiz bünyesinde yürütülen sektör bilgilendirme faaliyetleri kapsamında, 26 Mayıs 2022 tarihinde 16:30- 17:45 saatleri arasında Telekomünikasyon Sektörünün Yurtdışına Açılımına Yönelik Sağlanacak Teşvikler başlıklı bir webinar düzenlenecektir. Webinarda, 20 Nisan 2022 tarihinde yayınlanan "Türkiye Bilişim Sektörünün Uluslararasılaşması ve E[1]Turquality (Bilişimin Yıldızları) Programı Hakkındaki Cumhurbaşkanlığı Kararı çerçevesinde; telekomünikasyon sektörüne sağlanan teşvik ve destekler hakkında bilgi verilecektir. Veri merkezi, telekomünikasyon, bulut veri ve iletişim, 5G gibi sektörleri ilgilendiren webinarın ardından, katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
20.05.2022
Coğrafi İşaret Türevi Ürünler Hakkında
Sayın Üyemiz, Türk Patent ve Marka Kurumu tarafından Birliğimize iletilen 09.05.2022 tarih ve 220334570 sayılı yazıda Türk Patent ve Marka Kurumu nun coğrafi işaret türevi ürünlerin ambalajında kullanılabilecek ifadelere ilişkin görüş ve önerileri yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.05.2022
Pirinç Satışları
Sayın Üyemiz, TMO stoklarında bulunan 4.495ton pirinç marketlere (gıda perakendecilerine), yönelik olarak TMO Elektronik Satış Platformu üzerinden 05Mayıs 2022 tarihinden itibaren peşin bedel mukabili toptan satışa açılmıştır. Platforma kayıt ve talep oluşturma işlemleri https://ticaret.tmo.gov.tr linkinden veya http://www.tmo.gov.tr sayfasındaki "TMO ELEKTRONİK SATIŞ PLATFORMU" kısa yol sekmesinden girilmek suretiyle yapılacaktır. TMO tarafından 05-16Mayıs2022 tarihleri arası platform üzerinden talep toplanacak, 18 Mayıs 2022 tarihinde platform üzerinden tahsis miktarları bildirilecek olup para yatırma süresi 27Mayıs2022 tarihinde (mesai bitiminde) sona erecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
13.05.2022
Yatırımlarda Devlet Yardımları Hakkında
Sayın Üyemiz, Resmi Gazetede yayınlanan sayıda "Yatırımlarda Devlet Yardımları Hakkında Karar”ın yürürlüğe konulması; Ekonomi Bakanlığının 15/6/2012 tarihli ve 43145 sayılı yazısı üzerine, 14/5/1964 tarihli ve 474 sayılı Kanunun 2 nci, 29/6/2001 tarihli ve 4706 sayılı Kanunun ek 3 üncü, 31/5/2006 tarihli ve 5510 sayılı Kanunun ek 2 nci, 25/10/1984 tarihli ve 3065 sayılı Kanunun 13 üncü ve geçici 30 uncu, 3/6/2011 tarihli ve 637 sayılı Kanun Hükmünde Kararnamenin 11 inci ve 26 ncı maddeleri ile 13/6/2006 tarihli ve 5520 sayılı Kanunun 32/A maddesine göre, Bakanlar Kurulu’nca 15/6/2012 tarihinde kararlaştırılmıştır." bilgisi yer almıştır. Ayrıntılı bilgi için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
13.05.2022
Mesleki Eğitim ve İşbaşı Eğitim Programlarına ilişkin yeni İşkur Genelgesi ile İşverenler İçin İşbaşı Eğitim Programı (İEP) İşkur Başvuru Ekranı Kullanım Kılavuzu
Sayın üyemiz, 08.04.2022 tarih ve 31803 sayılı Resmî Gazetede yayımlanarak yürürlüğe giren Aktif İşgücü Hizmetlerinin Yürütülmesine İlişkin Usul ve Esaslar Hakkında Yönetmelik e istinaden, mesleki eğitim ve işbaşı eğitim programlarının yürütülmesine ilişkin usul ve esaslarla ilgili yeni İş-Kur Genelgesi yürürlüğe konulmuştur. Konuya ilişkin bilgi notu, "Aktif İşgücü Hizmetlerinin Yürütülmesine İlişkin Usul ve Esaslar Hakkında Genelge" ve "İşverenler için İEP Başvuru Ekranı Kullanım Kılavuzu" ekte dikkatinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
12.05.2022
36. İSG Haftası etkinlikleri
Sayın Üyemiz, Çalışma ve Sosyal Güvenlik Bakanlığı İş Sağlığı ve Güvenliği Genel Müdürlüğü tarafından Türkiye Odalar ve Borsalar Birliğine iletilen29/04/2022 tarihli ve 124510 sayılı yazıda; bu yıl 36 ncısı düzenlenecek İş Sağlığı ve Güvenliği Haftası etkinlikleri kapsamında,11-12 Mayıs 2022tarihlerinde çevrimiçi gerçekleştirilecek olan"Sosyo-Ekonomik Boyutu ile İş Sağlığı ve Güvenliği"ana teması çerçevesinde oturumlar planlandığı belirtilmiştir. Yazıda devamla; programa ait detaylara ve etkinlik kayıt sisteminehttps://isghaftasi.csgb.gov.trweb sitesinden ulaşılabildiği belirtilerek ilgili kişilerin etkinliğine katılımının sağlanmasının güvenlik kültürünün oluşturulması için oldukça önemli olduğu ifade edilmektedir. İlgili üyelerimize duyurulur. Gültekin Güler Genel Sekreter
9.05.2022
Ufuk Avrupa Yeşil Dönüşüm Destekleri
Sayın Üyemiz, Avrupa Yeşil Mutabakatı sonrasındaki gelişmelerin, özelikle 55 e Uyum (fit for 55) kapsamındaki düzenlemelerin firmalar üzerinde büyük etkisi olacağı aşikardır. Bu sebeple, yeşil dönüşüme uyum sağlama aşamasında firmaları bilgilendirmek amacıyla Ufuk Avrupa Yeşil Dönüşüm Destekleri Webinarı gerçekleştirilecektir. Webinarda, Ufuk Avrupa Programı kapsamında yer alan yeşil dönüşüme ilişkin desteklere ve proje çağrılarına ilişkin bilgi verilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.05.2022
Mısır Satışı - 10.05.2022
Sayın Üyemiz, S.S. Eskişehir Pancar Ekicileri Kooperatifi Dane Mısır Satışına Dair ilan ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
29.04.2022
Nohut Satışı-27.04.2022
Sayın Üyemiz, Toprak Mahsulleri Ofisi Gaziantep Başmüdürlüğü stoklarında bulunan 50 kiloluk çuvallarda 68 ton 5-7 mm orta tane nohutlar ve 50 kiloluk çuvallarda 150 ton elenmiş naturel nohutlar 9 TL/Kg. fiyatla (KDV hariç) talep toplamak suretiyle peşin bedel mukabili serbest olarak satılacaktır. Talep sahiplerinin 29.04.2022tarihsaat17:00 ye kadar ekte gönderilen dilekçe ile birlikte TMO Gaziantep Başmüdürlüğü ne elden başvurmaları veya gaziantep.alimticaret@tmo.gov.tr mail adresine e-posta olarak taleplerini göndermeleri gerekmektedir. Nohut teslimatı, Güzel Gıda Maddeleri İthalat İhracat San.Tic.Ltd.Şti. Başpınar Org.San.Bölgesi 3.Bölge 83315 Nolu Cadde No: 16 Şehitkamil/GAZİANTEP adresinden yapılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.04.2022
Kuraklık 2022/ 1 ve 2 nolu Komisyon Kararları
Sayın Üyemiz, Tarımsal Kuraklık Yönetiminin görevleri, çalışma usül ve esaslarına ilişkin 18.08.2012 tarihli yönetmeliğin 12. maddesinin 2. bendi gereği, 01.04.2022 tarihinde Tarımsal Kuraklık İl Kriz Merkezince alınan 2022/1 ve 2022/2 nolu kararlar ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.04.2022
Çevrimiçi Çin Gıda ve Tarım Ürünleri İthalat Fuarı
Sayın Üyemiz, CCPIT tarafından 28.02.2022-28.02.2023 tarihleri arasında 1 yıl süreyle sanal platformda "Çevrimiçi Çin Gıda ve Tarım Ürünleri İthalat Fuarı" düzenleneceği ve çevrimiçi fuar ile eş zamanlı olarak alıcı ve satıcıların bir araya getirileceği "matchmaking" uygulamalarının olacağı belirtilmektedir. Bu kapsamda, ülkemizdeki gıda ve tarım ürünleri alanında faaliyet gösteren tedarikçilerin anılan fuara katılımından memnuniyet duyulacağı ifade edilmektedir. Bahse konu fuar ile ilgili tüm detaylara aşağıda bilgileri verilen yetkili ile iletişime geçerek ulaşılması mümkündür. Lisa Wang, CCPIT Information Center Tel:+86 10 82217954 Email: wangxicui@itc.ccpit.org Whatsapp/wechat:15010321706 https://ciffa.fastexpo.cn/ Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.04.2022
Şahabettin Bilgisu Çevre Ödül Töreni
Sayın Üyemiz, Kocaeli Sanayi Odası tarafından "28. Kocaeli Sanayi Odası Şahabettin Bilgisu Çevre Ödül Töreni" düzenlenmesi planlanmaktadır. Ödül törenine ilişkin bilgilere ulaşmak için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.04.2022
Şahabettin Bilgisu Çevre Ödülleri
Sayın Üyemiz, Kocaeli Sanayi Odası tarafından "28. Kocaeli Sanayi Odası Şahabettin Bilgisu Çevre Ödül Töreni" düzenlenmesi planlanmaktadır. Ödül törenine ilişkin bilgilere ulaşmak için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.04.2022
KOSGEB Enerji Verimliliği Yeşil Dönüşüm Destek Programı Bilgilendirme Semineri
Sayın Üyemiz, KOSGEB Yeşil Dönüşüm Destek Programı Bilgilendirme Semineri, 18 Mayıs 2022 Çarşamba günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Bu destek ile işletmelerin enerji etüdü maliyetleri ile etüt sonucu önerilen değişiklikler doğrultusundaki giderlerin bir kısmı KOSGEB tarafından karşılanacaktır. KOSGEB ve TOBB iş birliğinde gerçekleştirilecek olan seminerde, KOBİ ler için Enerji Motorları Desteği kapsamında 100 bin TL, Verimlilik Artırıcı giderleri içinse 400 bin TL ye kadar destek sağlayan KOSGEB Yeşil Dönüşüm Destek Programı anlatılacak olup, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.04.2022
E-Devlet Platformu Entegrasyonu
Sayın üyemiz, Daha önce BİLGE sistemi üzerinden erişim sağlanabileceği duyurulan Geri Verme-Kaldırma Talep Yönetimi Sisteminin ve Gümrük Vergi ve Ceza Borcu Sorgulama Sisteminin, e-devlet platformuna entegrasyonunun tamamlandığı bilgisi iletilerek, ilgili sistemlerin erişim adresleri bildirilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.04.2022
Ustalık Telafi Programı
Sayın Üyemiz, Milli Eğitim Bakanlığı Mesleki ve Teknik Eğitim Genel Müdürlüğü nden Birliğimize iletilen 21.04.2022 tarih ve 48289128 sayılı yazı ekte dikkatinize sunulmuştur. Söz konusu yazıda mesleki eğitim merkezi ustalık telafi programı kapsamında; çalışan sayısı 50 ve üzerinde olan işletmelere bulundukları il/ilçenin milli eğitim müdürlükleri ile ekte örneği yer alan protokolü imzalamaları halinde sürekli, 50 den az çalışanı olan işletmelere ise protokol imzalamaksızın 30 Aralık 2022 tarihine kadar öğrenci kaydı yapılabileceği bilgisi iletilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.04.2022
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-26.04.2022
Sayın üyemiz, TMO 2022 yılı Mayıs ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve Sözleşme Bazında)" konulu satış duyurusu ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.04.2022
Haşhaş Tohumu Yurtiçi Satış
Sayın Üyemiz, TMO Eskişehir Başmüdürlüğü nün haşhaş tohumu satışlarına dair duyurusu ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.04.2022
DDX Dijital Dönüşüm Değerlendirme Modeli ve Eğitim Programı
Sayın Üyemiz, Türkiye Bilimsel ve Teknolojik Araştırma Kurumu nun (TÜBİTAK) ilgide kayıtlı yazısında, TÜBİTAK TÜSSİDE, Boğaziçi Üniversitesi tarafından hazırlanan "Dijital Dönüşüm Değerlendirme Aracı"nı temel alarak "Dijital Dönüşüm Değerlendirme Modeli" geliştirdiği belirtilmektedir. Yazıda devamla, TÜBİTAK TÜSSİDE tarafından geliştirilen bu modelin ülke geneline yaygınlaştırılması için "Dijital Dönüşüm Danışman"ları yetiştirileceği ve TÜBİTAK TÜSSİDE den eğitim alarak başarıyla tamamlayan danışmanlar aracılığıyla "DDX Dijital Dönüşüm Modeli" kullanılarak yürütülen danışmanlık çalışmalarının KOSGEB tarafından destekleneceği ifade edilmektedir. Bu amaçla hazırlanan eğitim programına başvurular ddxhamle.org adresinden 8 Nisan - 8 Mayıs 2022 tarihleri arasında yapılacaktır. Konuya ilişkin olarak TÜBİTAK TÜSSİDE den alınan yazı ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.04.2022
Vakıfbank Salgın Destek Kredisi Bilgilendirme Semineri
Sayın Üyemiz, Dünya Bankası Acil Durum Firma Destek Projesi, Vakıfbank Salgın Destek Kredisi Bilgilendirme Semineri; 17 Mayıs 2022 Salı günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin program ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile Vakıfbank işbirliğinde gerçekleştirilecek olan seminerde, Covid-19 salgınının olumsuz etkilerini en aza indirmek ve salgından en çok etkilenen KOBİ leri desteklemek amacıyla Dünya Bankası ile Vakıfbank arasında imzalanan Acil Durum Firma Destek Projesi çerçevesinde 3 farklı hedef gruba yönelik olarak kredi başına 3 Milyon ABD Doları na kadar sunulan Salgın Destek Kredisi anlatılacak, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
22.04.2022
Kadın Girişimciler İçin POS Desteği
Sayın Üyemiz, Pandemi ile kullanımı daha çok artan kartlı ödemelerin kadın girişimciler kabul edilmesini sağlamak ve bu yolla onların dijital dönüşümlerine katkı sunmak amacıyla Birliğimiz ve Visa işbirliğinde Akıllı KOBİ Platformu çerçevesinde "Kadın Girişimciler İçin POS Desteği" kampanyası başlatılmıştır. Kampanyada, başvuranlar arasından kriterlere uyan ve belirlenen tarihler arasında ilk kez POS cihazı satın almış 1.000 kadın girişimciye 500 TL nakdi destek sağlanmaktadır. Kampanyadan yararlanmak isteyen kadın girişimciler https://akillikobi.org.tr/pos-destegi/ adresinden başvuru yapabilmektedir. Başvuru kriterleri aşağıda yer almaktadır. - Kadın girişimci olarak ticari işletmenin sahibi olunması veya kadın girişimcilerin şirketteki payının en az %51 olması - Ticari işletmenin/Şirketin TOBB a bağlı Oda/Borsalara ve Ticaret Sicil e kayıtlı olması - Desteğe konu POS Makinesinin, ticari işletmenin/şirketin ilk POS makinesi olması ve 1.1.2021 tarihinden sonra satın alınmış olması Bu kapsamda kampanyanın duyurulması için hazırlanan poster, billboard ve raket görselleri Akıllı KOBİ Platformu nun Medya Merkezi nde yer almaktadır. Akıllı KOBİ Platformu Medya Merkezi ne https://akillikobi.org.tr/medya-merkezi/ adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
22.04.2022
İş Yerleri için Afet Farkındalık Eğitimi-27.04.2022
Sayın Üyemiz, Birliğimiz organizasyonunda, 27 Nisan 2022 Çarşamba günü saat 14:00 te internet üzerinden "İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
22.04.2022
TÜBİTAK Çağrıları Webinarı ve Eşleştirme Etkinliği
Sayın Üyemiz, TÜBİTAK Siparişe Dayalı Ar-Ge ve Yapay Zeka Ekosistem Çağrıları Bilgilendirme Semineri ve Dijital Dönüşüm Eşleştirme Etkinliği; 28 Nisan 2022 Perşembe günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. TÜBİTAK, Türkiye Odalar ve Borsalar Birliği, TOBB Ekonomi ve Teknoloji Üniversitesi, TOBB ETÜ Teknoloji Transfer Ofisi ve Akıllı KOBİ Platformu işbirliğinde gerçekleştirilecek olan seminerde TÜBİTAK 1707 Siparişe Dayalı Ar-Ge ve 1711 Yapay Zeka Ekosistem Çağrıları anlatılacak ve işletmeler ile teknoloji tedarikçilerini eşleştirmek üzere ve teknoloji transferi konusunda TOBB ETÜ TTO nun hizmetleri ve Akıllı KOBİ Platformu nun teknoloji tedarikçilerine sağladığı imkanlar hakkında bilgi verilecek, webinar sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
22.04.2022
Nohut Satışı
Sayın Üyemiz, Toprak Mahsulleri Ofisi Ankara Başmüdürlüğü stoklarında bulunan 25 kiloluk çuvallarda 92 ton 5-8 mm orta tane nohutlar 9 TL/Kg. fiyatla (KDV hariç) talep toplamak suretiyle peşin bedel mukabili serbest olarak satılacaktır. Talep sahiplerinin 27.04.2022 tarih saat 17:00 ye kadar ekte gönderilen dilekçe ile birlikte TMO Ankara Başmüdürlüğü ne elden başvurmaları veya ankara.alimticaret@tmo.gov.tr mail adresine e-posta olarak taleplerini göndermeleri gerekmektedir. Nohut teslimatı, Tepeoğlu Bakliyat Tarım Ürünleri Gıda ve İhtiyaç Maddesi firmasına ait Saray Mah. Gimat Depolama Sanayi Sitesi 100 Cad. No: 1 Kahramankazan/ANKARA adresinden yapılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
22.04.2022
AmCham Türkiye Sürdürülebilirlik Komitesi-Su Konulu Çevrimiçi Toplantı
Sayın Üyemiz, Amerikan Şirketler Derneği (AmCham Türkiye) tarafından 27.04.2022 tarihinde saat 15:30 – 17:30 arasında çevrimiçi olarak "Sürdürülebilirlik Zirvesi: Su" başlıklı bir toplantı düzenleneceği, sanayide ve tarımda suyun geri dönüşümü, su kıtlığı, temiz su gibi konuların ele alınacağı bildirilmektedir. Detaylar ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
20.04.2022
Yazılım İşgücü Anketi
Sayın Üyemiz, TOBB bünyesinde çalışmalarına devam eden TOBB Türkiye Yazılım Meclisi veri odaklı çalışma stratejisi çerçevesindeTürkiye Yazılım İş Gücü İhtiyaçları ve Kayıpları Durum Tespiti, Uzaktan Çalışma ve Eğitim İhtiyaçları Anketihazırlamıştır. Anket ile Türkiye’deki; Yazılım iş gücü ihtiyaçları Yazılım iş gücü kayıpları İşe alımda yazılım iş gücü tercihleri İhtiyaç duyulan programlama araçları Eğitim ihtiyacı ve eğitim konuları İş gücü istihdama yönelik teşvik ve destekler Yazılım sektörüne özel değerlendirmelere ilişkin verinin elde edilmesi ve bu kapsamda durum tespiti ve analiz yapılarak kamuoyunun sağlıklı olarak bilgilendirilmesi hedeflenmiştir. Ankete; yazılım geliştirme faaliyeti olan tüm kamu kurumları, özel şirketler, yazılım geliştiren firmalar, eğitim kurumları ve kar amacı gütmeyen kuruluşlar katılabilir. Bahse konu anket hazırlanırken; ticari/kişisel/kurumsal mahremiyeti gözetilmiş ve yukarıda bahsedilen hedefe yönelik olacak şekilde düzenlenmiş olup,kişisel veriler talep edilmemiştir.Ekte linki verilen ankete vereceğiniz destek bizleri memnun edecektir. docs.google.com/forms/d/e/1FAIpQLSeFDO2CE8E2GHKnmZOm-DuFnJJftCF8J0rw-rOk5Gr371N5cQ/viewform Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
20.04.2022
Resmi Gazete de yayınlanan, Türk Gıda Kodeksi Baharat Tebliği Hakkında Değişiklik
Sayın Üyemiz, Resmi Gazetede yayınlanan bu tebliğin amacı; baharatın tekniğine uygun ve hijyenik şekilde üretilmesi, hazırlanması, işlenmesi, depolanması, nakledilmesi ve piyasaya arz edilmesi aşamalarında taşıması gereken özelliklerini belirlemektir. Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
19.04.2022
Yeşil Dönüşüm Destek Programı
Sayın Üyemiz, Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB) , küçük ve orta ölçekli işletmelere yönelik KOBİ Yeşil Dönüşüm Destek Programını başlatmıştır. Bu destek ile işletmelerin enerji etüdü maliyetleri ile etüt sonucu önerilen değişiklikler doğrultusundaki giderlerin bir kısmı KOSGEB tarafından karşılanacaktır. Yeşil Dönüşüm Destek Programı ile KOBİ lerin yeşil dönüşüm konusunda mevcut durumlarının tespit edilerek sorun ve ihtiyaçlarının belirlenmesi, gerekli stratejilerin oluşturulması, kapasitelerinin geliştirilmesi ve öncelikli ihtiyaçlarının karşılanması amaçlanmaktadır. Program, Enerji Motorları Desteği ve Verimlilik Artırıcı Destek olarak iki ayrı modüle sahiptir. KOBİ ler Enerji Motorları Desteği kapsamında 100 bin, Verimlilik Artırıcı giderleri içinse 400 bin liraya kadar destek alabilecektir. Yeşil Dönüşüm Destek Programına ilişkin bilgi notu ekte yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
18.04.2022
Ekonomiye Dair Öne Çıkan Düzenlemeler - 7-13 Nisan 2022
Sayın Üyemiz, TEPAV tarafından hazırlanan ve 7 – 13 Nisan 2022 tarihleri arasında ekonomiye dair öne çıkan düzenlemelerin yer aldığı bülteni ekte bulabilirsiniz. Gültekin Güler Genel Sekreter
14.04.2022
Yurt dışı iş gezisi desteği
Sayın Üyemiz, Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı (KOSGEB) tarafından gönderilen yazıda, Birliğimiz talepleriyle Yurt Dışı İş Gezisi Desteği kapsamında değişiklik yapılmasına ihtiyaç olduğu, bu kapsamda Yurt Dışı İş Gezisi Desteği üst limitinin 60.000 TL olarak belirlendiği ifade edilmektedir. KOSGEB ten iletilen ilave bilgi notunda ise her bir yurt dışı iş gezisi için işletme başına sağlanacak destek üst limitinin 20.000 TL olarak belirlendiği, bu tutarların 30.03.2022 tarihi itibariyle uygulanmaya başladığı bildirilmektedir. Konu ile ilgili afişler ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.04.2022
Kristal Şeker Satışları
Sayın Üyemiz, Türkiye Şeker Fabrikaları Genel Müdürlüğünden iletilen ilgi yazıda, Eylül 2022 de başlayacak yeni üretim dönemine kadar stoklarında yeterli miktarda şeker bulundurarak, piyasa fiyatlarının daha da artmasını önlemek için satışlarını bir plan dahilinde gerçekleştirildiği bildirilmekte ve şeker satış şekline ilişkin bilgi sunmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.04.2022
Besiciye 2 bin 500 TL lik Destek Kararı
Sayın Üyemiz, Et piyasasını düzenleme amacıyla alınan yeni düzenlemeyle besiciye destek getirildi. Resmi Gazete de yayımlanan karara göre 2 Nisan-1 Mayıs tarihleri arasında Et ve Süt Kurumu (ESK) tarafından kesimi ve satımı yapılan/yaptırılan her bir baş sığır için 2 bin 500 TL destekleme yapılacak. Kararda sığırların kesimi ve satışının ESK tarafından belirlenen kriterler çerçevesinde yapılacağını belirtildi. Ödemeler için kaynak, Tarım ve Orman Bakanlığı nın 2022 yılı tarımsal destekleme bütçesinden sağlanacak. Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
13.04.2022
Çin Dolandırıcılık Faaliyetleri
Sayın Üyemiz, Pekin Ticaret Müşavirliği nin yazısına atfen, son dönemde birçok Türk firmasının hammadde/ara mamulleri piyasa ortalamasının oldukça altında fiyat taahhüdü ile Çinli firmalara peşin ödeme veya büyük ölçekli avans ödemesi yoluyla dolandırıldığı, son olarak "Inner Mongolia Junsai Chemicals Co. Ltd" isimli Çinli firmanın bir Türk firmasını benzer şekilde dolandırdığı, Ticaret Müşavirliği ile irtibata geçmeden diğer Türk firmalarının da alım yapma ihtimali göz önünde bulundurulduğunda, hem adı geçen firma hem de genel olarak dolandırıcılık faaliyetleri konusunda firmalarımızın bilgilendirilmesinde yarar görüldüğü ifade edilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
12.04.2022
Speed-Match 2022 İkili İş Görüşmeleri Etkinliği
Sayın Üyemiz, Eskişehir Sanayi Odası organizatörlüğünde 27-28 Nisan 2022 tarihlerinde "Speed-Match 2022 International Networking Event" ikili iş görüşmeleri etkinliğinin çevrimiçi olarak organize edileceği bildirilmektedir. Havacılık, raylı sistemler ve otomotiv ana ve yan sanayide faaliyet gösteren firmalarımızın yeni iş bağlantıları kurabilmeleri amacıyla uluslararası katılımla gerçekleştirilecek olan etkinliğe geçtiğimiz yıl 34 ülkeden 369 firmanın katıldığı belirtilmektedir. Yazıda devamla, birçok farklı ülkeden Ticaret ve Sanayi Odası, sektörel kümelenmeler ve iş ağlarının ortak olarak destek verdiği, havacılık, raylı sistemler ve otomotiv sektörlerinde faaliyet gösteren üst kuruluşlar tarafından da desteklenen ve bu yıl 4000 den fazla işletmenin katılım sağlaması beklenen Speed-Match 2022 İkili İş Görüşmeleri Etkinliğine ilişkin detaylı bilgilere https://speedmatch2022.b2match.io/ adresinden ulaşılabileceği bildirilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.04.2022
Ekonomiye Dair Öne Çıkan Düzenlemeler
Sayın Üyemiz, TEPAV tarafından hazırlanan ve 31 Mart – 6 Nisan 2022 tarihleri arasında ekonomiye dair öne çıkan düzenlemelerin yer aldığı bülteni ekte bulabilirsiniz. Gültekin Güler Genel Sekreter
11.04.2022
"Tarımsal Sigorta ve Çiftlik Risk Yönetimi" konulu Konferans
Sayın üyemiz, Asya Verimlilik Teşkilatı (AVT) tarafından 15 Haziran 2022 tarihinde "Tarımsal Sigorta ve Çiftlik Risk Yönetimi" konulu konferansın düzenlenmesi planladığı bildirilmektedir. Söz konusu konferans hakkında bilgi, program ve başvuru formu (biodata-form) ekte sunulmakta olup, katılmak isteyen adayların ekte sunulan başvuru formunu eksiksiz doldurarak 9 Mayıs 2022 tarihine kadar Sanayi ve Teknoloji Bakanlığı na (avt.turkiye@sanayi.gov.tr) iletilmesi gerekmektedir. Ülkemizin AVT koordinasyon çalışmaları Sanayi ve Teknoloji Bakanlığı bünyesinde yürütülmekte olup, AVT faaliyetleri ve düzenlenen etkinliklerle ilgili ayrıntılı bilgileresanayi.gov.tr/merkezbirimi/92d9c73bddbb/asya-verimlilik-teskilati adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.04.2022
Tarımsal Yayım ve Danışmanlık Hizmetlerine Destekleme
Sayın Üyemiz, Resmi Gazetede yayınlanan "Tarımsal yayım ve danışmanlık hizmetlerine destekleme ödemesi yapılması hakkında tebliğ" ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.04.2022
Tarımda düşük faizli kredi uygulaması devam edecek
Sayın Üyemiz, Resmi Gazete nin bugünkü sayısında yayımlanan Ziraat Bankası ve Tarım Kredi Kooperatiflerince tarımsal üretime dair düşük faizli yatırım ve işletme kredisi kullandırılmasına ilişkin kararda değişiklik yapan Cumhurbaşkanı kararıyla, bu kapsamda verilecek kredi üst limitleri de %50 den %233 e varan oranlarda artırıldı. Daha önce karar kapsamında kredi tahsisi yapılmış ve kredilerin tamamını veya bir kısmını kullanamamış üreticiler, kullanamadıkları kısım için 2022 sonuna kadar yeni belirlenen indirim oranlarından ve üst limitlerden yararlanabilecek. Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.04.2022
Yeşil Verimlilik Eğitimi
Sayın Üyemiz, Asya Verimlilik Teşkilatı (AVT) tarafından 23-27 Mayıs 2022 tarihlerinde (5 gün) çevrimiçi ve İngilizce dilinde "Yeşil Verimlilik" konulu eğitimin düzenlenmesi planladığı bildirilmektedir. Söz konusu eğitim hakkında bilgi, program ve başvuru formu (biodata-form) ekte sunulmakta olup, katılmak isteyen adayların ekte sunulan başvuru formunu eksiksiz doldurarak 6 Mayıs 2022 tarihine kadar Sanayi ve Teknoloji Bakanlığı na (avt.turkiye@sanayi.gov.tr) iletilmesi gerekmektedir. Ülkemizin AVT koordinasyon çalışmaları Sanayi ve Teknoloji Bakanlığı bünyesinde yürütülmekte olup, AVT faaliyetleri ve düzenlenen etkinliklerle ilgili ayrıntılı bilgileresanayi.gov.tr/merkezbirimi/92d9c73bddbb/asya-verimlilik-teskilati adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.04.2022
TAŞINMAZ İLAN SATIŞ METNİ
Sayın Üyemiz, Çifteler Kaymakamlığı Milli Emlak Şefliği taşınmaz satış ilan metni ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
23.03.2022
KOBİ Tanımı Değişti Kapsam Genişledi
Sayın Üyemiz, Küçük ve Orta Büyüklükteki İşletmelerin Tanımı Nitelikleri ve Sınıflandırılması Hakkında Yönetmelikte değişiklik yapılarak KOBİ’lerin sınıflandırılmasında parasal sınırlar yeniden belirlendi. Buna göre mikro işletme için 3 milyon lira olan hasılat veya mali bilanço üst sınırı, 5 milyon liraya çıkarıldı. Hasılat veya mali bilanço üst sınırı küçük işletmelerde 25 milyon liradan 50 milyon liraya, orta büyüklükteki işletmelerde ise 125 milyon liradan 250 milyon liraya çıkarıldı. Bu işletmelerdeki çalışan sayısı sınırlarında ise herhangi bir değişiklik yapılmadı. Mikro işletmelerde 10, küçük işletmelerde 50, orta işletmelerde ise 250 kişilik çalışan sınırı bulunuyor. Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
18.03.2022
Fas Yatırım İmkanları
Sayın Üyemiz, Fas Kalkınma, Yatırımlar ve İhracat Ajansı tarafından "Morocco Now" adı altında yatırım ve ihracat markası lansmanı ile Fas ta otomotiv, havacılık, tekstil ve gıda gibi öne çıkan sektörlere ilişkin tanıtıcı broşürlerin Rabat Ticaret Müşavirliğimize iletilerek, Türk yatırımcıları ile işbirliği yapmaktan memnuniyet duyulacağının bildirildiği ifade edilmektedir. Bahse konu broşürler ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.03.2022
Kazakistan Mücevher Fuarı, 8-11 Haziran 2022
Sayın Üyemiz, Kazakistan ın Ankara Büyükelçiliği nden alınan yazıya atfen, 2. Uluslararası Mücevher Kongresi ve Mücevher Fuarı nın, 8-11 Haziran 2022 tarihlerinde Kazakistan ın başkenti Nur-Sultan da düzenleneceği bildirilmektedir. Fuar ile ilgili detaylı bilgi ve iletişim noktaları ekli belgede yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.03.2022
Zimbabve 62. Uluslararası Ticaret Fuarı
Sayın Üyemiz, Zimbabve nin Ankara Büyükelçiliği nin yazısına atfen, 62 nci Zimbabve Uluslararası Ticaret Fuarı nın 26-30 Nisan 2022 tarihlerinde Zimbabve de düzenlenmesinin öngörüldüğü bildirilmektedir. Bahse konu yazı ekinde iletilen; Türk Firmalarını muhatap davet mektubu, başvuru formu ve söz konusu fuara ilişkin broşür ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.03.2022
Pakistan Yatırım Zirvesi 2022 hk.
Sayın Üyemiz, Dışişleri Bakanlığı ndan alınan bir yazıya atfen, Pakistan ın önde gelen yatırım teşvik ajansı olan Pakistan Yatırım Kurulu nun (The Board of Investment – BOI), diğer faaliyetlerinin yanı sıra, Özel Ekonomik Bölgeler kurulmasını kolaylaştırarak ve yerli/yabancı yatırımları teşvik ederek Pakistan ı gerçek anlamda sanayileşmiş bir ülkeye dönüştürmek amacıyla yüksek marjinal etkiye sahip faaliyetler yürüttüğü bildirilmektedir. Yazıda devamla, Covid-19 un hafiflemesi sonrasında küresel ekonominin açılması ile birlikte birçok yatırımcının gelecekteki yatırımları için yeni ev sahibi ülkeler aradığı ve bu kapsamda BOI tarafından, 30-31 Mart 2022 tarihlerinde İslamabad Serena Hotel de, yerli ve yabancı yatırımcıları bir araya getirmeyi hedefleyen bir "Yatırım Zirvesi" düzenleneceği belirtilmektedir. Pakistan Başbakanı Imran Han tarafından açılışı yapılması planlanan Zirve kapsamında, turizm, madencilik, tarım ve gıda üretimi, tekstil, konut ve yapı inşaat, bilgi teknolojileri, otomotiv, taşımacılık, ulaştırma, lojistik ve eczacılık sektörlerindeki yatırım imkanları ile Pakistan daki Özel Ekonomik Bölgelerin tanıtılacağı ifade edilmektedir. katılmak isteyen üyelerimiz, bilgilerinin ekli tabloya işleyerek, Ticaret Bakanlığı na iletilmek üzere, 17 Mart 2022 Perşembe gününe kadar Borsamıza iletilmesi hususunda gereğini rica ederim. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.03.2022
Büyük Faw Limanı Hakkında
Sayın Üyemiz, Basra Üniversitesi ve Limanlar Genel Müdürlüğü işbirliği ile 15 Aralık 2021 tarihinde Basra da düzenlenen "Büyük Faw Limanı Hakkında Birinci Bilimsel Konferans" sırasında Irak Limanlar Genel Müdürü Dr. Farhan Al-Fartoosi tarafından yapılan sunumun bir örneği ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.03.2022
TMO Ürün Satışı, Başvuruda Süre Uzatımı
Sayın Üyemiz, TMO 2022 yılı Mart ayında satışa açılan arpa, mısır, kırmızı mercimek, pirinç ve çeltikiçin, ülkemizde yaşanan olumsuz iklim koşuları nedeniyle, ulaşım ve iletişimde yaşanan aksaklıklardankaynaklı başvuru sahiplerinin mağduriyet yaşamamasını teminen son başvuru tarihi 16.03.2022 tarihisaat 17.00 olarak yeniden belirlenmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.03.2022
Hububat Satışı Hk.
Sayın Üyemiz, S.S. Kütahya Pancar Ekicileri Kooperatifinden yapılacak muhtelif hububat satışları ihalesi ayrıntıları ekte bilgilerinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.03.2022
50.000 Kg Mezbuh Taze Soğutulmuş Gövde (Karkas) Tosun Eti Alım İşi Geçici Teminat Bedeli
Sayın Üyemiz, Et ve Süt Kurumu tarafından,50.000 Kg Mezbuh Taze Soğutulmuş Gövde (karkas) Tosun Eti alımı yapılması planlanmaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.03.2022
Türib Elüs Piyasası 2022 Yılı Eğitim Takvimi Hk.
Sayın Üyemiz, Türkiye Ürün İhtisas Borsası (TÜRİB) ve Elektronik Ürün Senedi (ELÜS) Piyasası Eğitimleri çevrim içi ve ücretsiz olarak verilecektir. Eğitimlerimiz sonunda sertifika verilmeyecek olup tüm eğitimlerimiz zoom üzerinden gerçekleştirilecek ve TÜRİB Youtube hesabı üzerinden canlı yayımlanacaktır. Eğitim videolarımıza youtube kanalımızdanhttps://www.youtube.com/channel/UC-WN7O05G9f39vCx3fCFivwerişilebilir. Eğitimler 2022 yılı için Mart ayından itibaren her ayın 3. Çarşambası saat 14.00-15.30 arasında gerçekleştirilecektir (16.03.2022, 20.04.2022, 18.05.2022, 15.06.2022, 20.07.2022, 17.08.2022, 21.09.2022, 19.10.2022, 16.11.2022, 21.12.2022). Bu eğitimlere, Borsamıza kayıtlı yatırımcılar, ELÜS takas ve saklama hizmeti veren finansal kuruluş çalışanları, lisanslı depo, ticaret borsası ve diğer tarım emtiası piyasası çalışanları, akademisyenler, öğrenciler ve eğitim konularına ilgi duyan diğer sektör paydaşları başvuru yapabilirler. Zoom üzerinden eğitimlere katılmak isteyenlerinhttps://bit.ly/35VGJf1adresinden “İLETİŞİM FORMU”nu; “Konu” olarak “1.9 ELÜS İşlemleri – Diğer” seçeneğini seçerek ilgili tarihteki eğitime kayıt olmaları durumunda, Eğitim öncesi erişim kısa yol bağlantısı eposta adreslerine iletilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.03.2022
Türkiye-Gana KEK 5. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Gana Karma Ekonomik Komisyonu (KEK) 5. Dönem Toplantısı nın 5-6 Nisan 2022 tarihinde Ankara da gerçekleştirilmesinin planlandığı bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere, Gana ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 15 Mart 2022 Salı günü mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederim. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.03.2022
Vergi denetiminde yaşanan sorunlar ve çözüm önerileri
Sayın Üyemiz, Vergi politikalarının oluşturulması ve uygulanması ile ilgili olarak görüş bildirmek, araştırma ve çalışmalar yapmak üzere danışma organı statüsünde kurulmuş olan Vergi Konseyi bünyesinde yürütülmekte olan çalışmalar kapsamında vergi denetiminde yaşanan sorunlar ve çözüm önerilerine ilişkin TOBB dan görüşleri istenmiştir. Bu itibarla, görüş ve önerilerinizin 17.03.2022 tarihine kadar yazılı olarak Borsamıza ve elektronik ortamda word formatında eskisehirtb@tobb.org.tr e-posta adresine gönderilmesi hususunda gereğini rica ederim. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.03.2022
Yetkilendirilmiş Yükümlü Sertifikası Semineri
Sayın Üyemiz, Birliğimiz tarafından 17 Mart 2022 Perşembe günü saat 14:00 te "Yetkilendirilmiş Yükümlü Sertifikası Semineri" gerçekleştirilecektir. Söz konusu seminerde Yetkilendirilmiş Yükümlü Sertifikasına ilişkin koşullar, başvuru süreçleri, getirdiği kolaylaştırmalar ve sorumlulukları konuları anlatılacak olup seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.03.2022
2021 Yılında Yapılacak Tarımsal Desteklemeler ve 2022 Yılında Uygulanacak Gübre ve Sertifikalı Tohum Kullanım Desteklerine İlişkin Kararda Değişiklik Yapılmasına Dair Karar (Karar Sayısı: 5284)
Sayın Üyemiz, 2021 Yılında Yapılacak Tarımsal Desteklemeler ve 2022 Yılında Uygulanacak Gübre ve Sertifikalı Tohum Kullanım Desteklerine İlişkin Kararda Değişiklik Yapılmasına Dair Karar (Karar Sayısı: 5284)ekteyer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.03.2022
Kadın girişimciliğin ve kadın istihdamının artırılmasına yönelik mektup
Sayın Üyemiz, Ülkemizin en büyük kadın girişimci ağını oluşturan TOBB Kadın Girişimciler Kurulu nun, ülkesini seven, ekonomik ve sosyal kalkınmaya katkıda bulunan değerli üyeleri, gerçekleştirdikleri projeler ile kadın girişimciliğini görünür hale getirmektedir. 8 Mart Dünya Kadınlar Günü vesilesiyle Birlik Başkanımız Sayın M. Rifat Hisarcıklıoğlu ve TOBB Kadın Girişimciler Kurulu Başkanımız Nurten Öztürk ün imzasıyla kadın girişimciliğin ve kadın istihdamının artırılmasına yönelik mektup ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
9.03.2022
Usta Ögreticilik Belgesi
Sayın üyemiz, Mesleki Egitim Merkezi programı ve 12. Sınıfta ögrenim görmekte olan ögrencilerimiz Isletmelerde Beceri Egitimi ve Staj Çalısması faaliyetlerini Kamu kurumları ve Belediyelerde yapmaktadır. Staj çalısmalarını yapmakta olan ögrencilerimizin egitimlerini sürdürebilmeleri için çalıstıkları kurumlarda egitiminden sorumlu egitici personellerin Yüksek Ögrenim Diplomaları veya ustalık belgelerinin mevcut oldugu ama Usta Ögretici belgelerin olmadıgı görülmektedir. Ögrencilerimizin egitimlerini sürdürebilmeleri için is yerindeki egitiminde sorumlu personellerinin, Ilgi (a) Kanunun; 15 inci Maddesinde, "Aday çırak ve çırak almak için isyerinde usta ögretici bulunması sarttır." Ilgi (b) Yönetmeligin Kalfalık, ustalık ve usta ögreticilik belgesi düzenlenmesi baslıklı 70/a Maddesinin ikinci fıkrasında, "Ustalık veya isyeri açma belgesine sahip olanlar ile en az ön lisans seviyesinde mesleki egitim almıs olanlar, okul ve kurumlarca açılan is pedagojisi kursuna katılabilirler. Is pedagojisi kursu uzaktan egitim yolu ile de düzenlenebilir ve sınavları e-Sınav seklinde yapılabilir. Kursu basarı ile tamamlayanlara usta ögreticilik belgesi verilir. Usta ögreticilik belgesi; ustalık belgesi, isyeri açma belgesi veya en az ön lisans diploması ile birlikte kullanılır." hükmü bulunmaktadır. Ilgi mevzuat hükümleri kapsamında, çırak, kalfa ile mesleki ve teknik egitim okul ve kurumları ögrencilerinin is yerindeki mesleki egitiminin kalitesi ve bu kalitenin sürekliliginin saglanması için Çırak, kalfa ve stajyerlere mesleki egitim verilen Kamu kurumları ve Belediyelerde, bu egitimden sorumlu alanında ustalık veya isyeri açma belgesine sahip olanlar ile en az ön lisans seviyesinde mesleki egitim almıs kisilerden, is pedagojisi egitimi almıs veya dogrudan sınava girerek usta ögreticilik belgesine sahip olanların görevlendirilmesi, belge sahibi olmayanlarında ilgili meslek egitim merkezlerine basvuru yaparak Usta Ögretici belgesi edinmeleri hususunda bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
9.03.2022
Tarım Arazilerinin Kullanımının Etkinleştirilmesinin Desteklenmesi
Sayın Üyemiz, Tarım Arazilerinin Kullanımının Etkinleştirilmesinin Desteklenmesine ilişkin Resmi Gazetede yayınlanan Karar kapsamında, toplam 5 ayrı proje çeşidi altında hibe desteği sağlanacak. Buna göre hibe desteği kapsamındaki yatırım konuları şunlar; Boş bırakılan atıl durumda bulunan veya nadasa (dinlenme) bırakılan arazileri uygun münavebe(ekim nöbeti) planı ve ekim yöntemleri kullanarak tarımsal üretime kazandırılması. İklim değişikliğini dikkate alarak uygun çeşitlerde hububat, baklagil ve yağlı tohumlu bitkilerin üretimi gerçekleştirmek, işlemeli tarıma uygun olmayan arazilerde, katma değir yüksek bitki türlerinin üretimini artırmak, hasat sonrası kayıpları azaltmak ve katma değeri artırmak amacıyla birincil üretim sonrası kurutma ve işleme tesisleri kurmak, doğal ekolojilerinde var olan bitki türlerinin aşılama, çeşit değişimi ve benzeri teknik uygulamalarla birim alandan verimliliği artırmak. Hibe oranları proje bedelinin en fazla yüzde 75’i kadar olabilecek. Diğer kamu kuruluşlarından ayın konuda destek alan yatırımlar, bu destekten yararlanamayacak. Haksız yere yapılan ödemeler, 6183 sayılı Amme Alacaklarının Tahsili Usulü Hakkında Kanun uyarınca geri alınacak. Resmi Gazetedeki ayrıntılar için tıklayınız. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
8.03.2022
Türkiye Markası
Sayın Üyemiz, TOBB dan Borsamıza gelen 07.03.2022 tarih ve 2360 sayılı yazıda, 4 Aralık 2021 tarihinde yürürlüğe giren 2021/24 Sayılı Cumhurbaşkanlığı Genelgesi ne istinaden, "Türkiye" markasının güçlendirilmesine yönelik yapılan çalışmalar çerçevesinde başlatılan "Hello Türkiye" kampanyası ile ilgili bilgi verilmekte ve kampanyaya dair video filme yazıda yer alan link üzerinden erişilebileceği bildirilmektedir. Yazıda devamla, yazı ekinde sunulan "Türkiye Markasının Güçlendirilmesi Rehberi" göz önünde bulundurularak, geleneksel ve dijital mecralarda, ulusal ve uluslararası resmi yazışmalarda "Turkey" yerine "Türkiye" ibaresinin kullanılmasına ilişkin ilgili kurum ve kuruluşların bilgilendirilmesi talep edilmektedir. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
8.03.2022
Yurt İçi Fuar Duyurusu
Sayın Üyemiz, Karabük Ticaret ve Sanayi Odasından alınan yazıda; Odaları ve Karabük Üniversitesi iş birliği ile düzenlenecek olan FENOFEM Demir ve Demir dışı Metaller Sanal Sanayi Fuarı nın düzenleneceği bildirilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.03.2022
İşbirliği Talebi - Bangladeş
Sayın Üyemiz, Dakka Ticaret Müşavirliğinden alınan bir yazıya atfen, Bangladeş te farklı sektörlerde faaliyet gösteren Unitex Group Firması nın, enerji (petrol/gaz), gıda ve otomotiv gibi alanlar başta olmak üzere Türk firmalarla iş ortaklıkları kurma talebi olduğu bildirilmektedir. Ayrıntılar ekte bilgilerinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.03.2022
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO nun 2022 yılı Mart ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve SözleşmeBazında)" konulu satış duyurusu ve ekleri yazımız ekinde gönderilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.03.2022
Bazı Tarım Ürünlerinin İhracatına İlişkin Değişiklik
Sayın Üyemiz, 27/1/2022tarihli ve 31732 sayılı Resmî Gazete’de yayımlanan Bazı Tarım Ürünlerinin İhracatına İlişkin Tebliğ (İhracat: 2022/1)’in 3 üncü maddesinin birinci fıkrasında yer alan tablo ekte belirtilen şekilde değiştirilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.03.2022
Usta Öğretici Belgesi Hk.
Sayın Üyemiz, Milli Eğitim Bakanlığı Mesleki ve Teknik Eğitim Genel Müdürlüğü tarafından TOBBa iletilen 16.02.2022 tarih ve 43710503 sayılı "Usta Öğretici Belgesi" konulu yazı ekte dikkatinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.03.2022
Meskenler ile Tarımsal Sulamada Kullanılan Elektriğin KDV sinde Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede yayınlanan karara göre, meskenler ile tarımsal sulamada kullanılan elektriğin KDV si %18 den %8 e düşürülmüştür. Ayrıca meskenlerdeki düşük tarife sınırı da günlük 8 kw saate, aylık 240 kw saate yükseltilmiştir. Resmi Gazetedeki ayrıntılar için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
1.03.2022
Teknofest Karadeniz
Sayın Üyemiz, Sanayi ve Teknoloji Bakanlığı Metroloji ve Sanayi Ürünleri Güvenliği Genel Müdürlüğü nden alınan yazıda; Teknofest Havacılık, Uzay ve Teknoloji Festivali nin bu yıl Samsun ilinde 30 Ağustos-4 Eylül 2022 tarihleri arasında Çarşamba Havalimanı nda gerçekleştirileceği belirtilmektedir. Bu kapsamda, Teknofest Karadeniz kapsamında düzenlenecek teknoloji yarışmaları için açılan başvurular başlamış olup yarışmalara son başvuru tarihi 28 Şubat 2022 tarihi olarak belirlenmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.02.2022
Kredi Garanti Fonu (KGF) Yeni Destek Paketleri Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz ve Kredi Garanti Fonu işbirliğinde 2 Mart 2022 Çarşamba günü saat 14:00 te Kredi Garanti Fonu (KGF) Yeni Destek Paketleri Bilgilendirme Semineri gerçekleştirilecektir. Söz konusu seminerde Kredi Garanti Fonu nun yeni destek paketleri olan "Yatırım Destek Paketi", "İhracat Destek Paketi" ve "İşletme Harcamaları Destek Paketi" anlatılacak olup seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Kredi Garanti Fonu (KGF) Yeni Destek Paketleri Bilgilendirme Semineri programı ve ayrıntılar ekte dikkatinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.02.2022
Kredi Garanti Fonu Yeni Destek Paketleri
Sayın Üyemiz, Geçtiğimiz günlerde açıklanan ve toplam büyüklüğü 60 Milyar TL olan KGF kefaletli "Yatırım Destek Paketi", "İhracat Destek Paketi" ve "İşletme Harcamaları Destek Paketi" başvuruları 22 Şubat 2022 tarihi itibariyle başlamış olup destek paketlerinde ilişkin bilgiler aşağıda dikkatinize sunulmuştur. Yatırım Destek Paketi Yatırım yapmayı planlayan KOBİ ve KOBİ dışı tüm işletmeler, yatırım ve yatırıma bağlı işletme harcamalarında kullanabileceği Yatırım Destek Paketi nden 120 aya kadar vade ile yararlanabilecek. Pakette kredi üst limiti KOBİ ler için 35 Milyon TL yi bulurken KOBİ Dışı işletmeler ise 100 Milyon TL ye varan miktarlarda kredi kullanabilecek. Kadın girişimci KOBİ ler %90, diğer KOBİ ler %85, KOBİ dışı işletmeler ise %80 oranında kefalet oranlarından faydalanabilecek. Detaylı bilgi için: https://kgf.com.tr/index.php/tr/urunlerimiz/hazine-destekli-kefaletler/yatirim-destek-paketi İhracat Destek Paketi İhracatçı veya döviz kazandırıcı sektörlerde faaliyet gösteren KOBİ ler ile ihracat potansiyeli taşıyan KOBİ lerin yararlanabileceği İhracat Destek Paketi nde ise işletmeler, azami 6 ay ödemesiz dönem dahil azami 24 ay vade ile kredi kullanabilecek. Pakette kredi üst limiti işletmenin segment ve cirosuna göre değişmekle birlikte azami 25 Milyon TL olarak belirlendi. Mevcutta ihracatı olan firmalar %90, potansiyel ihracatçı firmalar da %85 oranında kefaletten yararlanabilecek. Detaylı bilgi için: https://kgf.com.tr/index.php/tr/urunlerimiz/hazine-destekli-kefaletler/ihracat-destek-paketi İşletme Harcamaları Destek Paketi KOBİ ve KOBİ dışı firmaların işletme sermayesi ihtiyaçlarının karşılanması için oluşturulan İşletme Harcamaları Destek Paketi nden ise KOBİ ler azami 5 milyon TL, KOBİ Dışı işletmeler ise azami 20 Milyon TL tutarında krediden faydalanabilecek. Ticari kredi kartları ve Debit/Banka kartına bağlı kredili mevduat hesabı üzerinden kullandırılacak kredinin kefalet oranları KOBİ ler için %80, KOBİ Dışı işletmeler için ise %75 olacak. Detaylı bilgi için: https://kgf.com.tr/index.php/tr/urunlerimiz/hazine-destekli-kefaletler/isletme-harcamalari-destek-paketi Gültekin Güler Genel Sekreter
25.02.2022
Tarım, Tarımsal Mekanizasyon ve Tarla Teknolojileri Fuarı
Sayınüyemiz, Bölgede ve ülkemizde sektörünün en büyük fuarlarından olan “Tarım, Tarımsal Mekanizasyon ve Tarla Teknolojileri Fuarının” bu yıl 08-12 Mart 2022 tarihler arasında 18. si düzenlenecektir. En son düzenlenen Konya Tarım Fuarı 7 ayrı salonda toplam 90.000 m2 lik sergileme alanında, 20 ülkeden 441 firma ve firma temsilciliğinin katılımı ile 5 gün boyunca 101 ülke ve 72 ilden gelen 304.855 ziyaretçiyi Konya’da bir araya geldi. Yeni iş fırsatları yakalama, yeni iş birlikleri kurma, yeni tarım makineleri ve son teknolojileri doğrudan gözlemleme fırsatı, tarım makinelerini karşılaştırarak analiz etme imkânı sağlayan Tarım sektöründe faaliyet gösteren dernek, federasyon, STK, üniversite ve bilim çevreleri ile bir arada olma fırsatını ve düzenlenen etkinliklere katılarak yeni teknolojiler ve son trendlerden haberdar olma olanağı yakalayacağınız Konya Tarım Fuarı 2022 fuarı sektöründe büyük önem arz etmektedir. Online Fuar Davetiyesi için tıklayınız.https://davetiye.tuyap.online/index.php?Fid=2987 Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.02.2022
Mesleki Eğitime Kazandırma Programı
Sayın Üyemiz, MEB Mesleki ve Teknik Eğitim Genel Müdürlüğü ile UNICEF iş birliğinde yürütülen Mesleki Eğitime Kazandırma Programı (MEM) kapsamında saha ekipleri tarafından ev ve iş yeri ziyaretleri yoluyla okul dışı kalmış 14-17 yaş arası çocuklar tespit edilerek Mesleki Eğitim Merkezlerine kayıt şartlarını taşıyan çocuklara ve ailelerine; MEM programları hakkında bilgi verilmekte, kariyer rehberliği ve mesleki yönlendirme yapılarak MEM lere kayıt süreci gerçekleştirilmektedir. Konu hakkında gerekli desteklerin sağlanmasını rica ederim Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
23.02.2022
POLTEK DIGITAL FUARI
Sayın Üyemiz, Polatlı Ticaret Odası ndan Birliğimize intikal eden yazıda, 25 Şubat 2022 tarihinde "POLTEK DIGITAL - Polatlı Teknoloji Fuarı"nın sanal olarak gerçekleştirileceği belirtilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
22.02.2022
Dijital Dönüşüm ve Verimlilik Özel Sayısı Konferansı
Sayın Üyemiz, T.C. Sanayi ve Teknoloji Bakanlığı’nın hakemli bilimsel yayını olan ve 56 yıldır yayın hayatını sürdürenVerimlilik Dergisi’ninDijital Dönüşüm ve Verimlilik Özel Sayısı12 Ocak 2022tarihinde yayımlanmıştır. Özel sayıda yayımlanan makalelerinayrıntılarının kamuoyu ile paylaşılması amacıyla23 Şubat 2022 Çarşambagünü14:00-17:00saatleri arasında,Dijital Dönüşüm ve Verimlilik Özel Sayısı Konferansı(çevrimiçi)düzenlenecektir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
21.02.2022
TOBB ve AmCham İşbirliği ile ABD’ye E-ihracatta Mentorluk Desteği hk.
Sayın Üyemiz, Malumlarınız olduğu üzere; sınır ötesi elektronik ticarete olan ilgi son dönemlerde artma eğilimi göstermekte; bu durum, yeni ticaret olanakları için girişimcilerimizin aktif olarak desteklenmesini elzem hale getirmektedir. Bu kapsamda; Birliğimiz ve Amerikan Şirketler Derneği (AmCham Türkiye) işbirliği ile girişimcilerimizi Amerika ya e-ihracat yapma yolunda desteklemek amacıyla hayata geçirilen mentorluk desteği Şubat ayı itibariyle başlamıştır. Söz konusu işbirliği ile mobilya, tekstil, hazır giyim, makine yan sanayi olmak üzere öncelikli sektörlerde faaliyet gösteren, ABD ye e-ihracat yapmayı hedefleyen, başvurusu onaylanan firmalara birebir mentorluk desteği verilecektir. Proje aracılığıyla, seçilen firmalara ABD pazarına e-ihracat süreçlerini olgunlaştırabilmeleri için stratejik planlama, danışmanlık ve iş geliştirme desteği verilmesi planlanmaktadır. Mentorlar ile birebir görüşmeler yapacak firmaların, pazar analizleri sonucunda ABD pazarına e-ihracat ile giriş yapması öngörülmektedir. Mentorluk desteğine başvurmak, eğitimlerden yararlanmak ve ABD ye e-ihracat yapmak isteyen firmaların https://www.tobb.org.tr/TurkiyeSektorMeclisleri/anket adresindeki anketi 28 Şubat 2022 tarihine kadar doldurması gerekmektedir. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
21.02.2022
İş Yerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, TOBB organizasyonunda, 23 Şubat 2022 Çarşamba günü saat 14:00 te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
21.02.2022
TÜBİTAK BİGG 2022-1
TÜBİTAK 1512 Girişimcilik Destek Programı (BİGG) 2022 yılı 1. çağrı dönemi başvuruları açılmıştır. Ayrıntılar ekte bilgilerinize sunulmuştur.
21.02.2022
2022 Şubat Ayı Satış Talimatı Duyurusu
TMO Genel Müdürlüğünden gelen yazıda, 2022 yılı Şubat ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel veSözleşme Bazında)" konulu satış duyurusu ve ekleri yazımız ekinde gönderilmiştir. bilgisi yer almaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
18.02.2022
Fiyat Etiketinde Yer Alacak Bilgiler Yeniden Belirlendi
Sayın Üyemiz, Fiyat etiketi yönetmeliğinin tanım maddelerinde yapılan düzenlemeye göre, bir malın etiketinde "malın türüne uygun olan ölçü biriminin net miktarıyla ifade edilen tüm vergiler dâhil fiyatı" yer alacak. Değişikliğe göre ayrıca, satışa sunulan malın etiketinde, net miktar üzerinden hesaplanan tüm vergiler dahil peşin fiyatı veya sunulan hizmetin tüm vergiler dahil peşin fiyatı ve ambalajlı malın, ambalaj malzemesi ve mal ile birlikte ambalajlanan diğer malzemeler hariç miktarının da yer alması öngörülüyor. Yönetmelik değişikliğiyle, etiket ve listelerin Türkçe yazılması ve ambalajlı malın satış fiyatından ayrı olarak ambalajın teslimine ve iadesine ilişkin depozito bedeli varsa bu bedelin tutarının da belirtilmesi hüküm altına alındı. Uygulama 1 Mart tan itibaren başlayacak. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
18.02.2022
ICDT/Fuar daveti
Sayın Üyemiz, ilgili İSEDAK kararları ışığında, Senegal Ticaret ve KOBİ ler Bakanlığı, ICDT ve Senegal Dış Ticaret Uluslararası Merkezi nin işbirliğiyle, 17 inci İİT Üye Devletler Ticaret Fuarı nın 13-19 Haziran 2022 tarihleri arasında Dakar da düzenleneceği bildirilmekte olup, konuya ilişkin olarak İslam Ticareti Geliştirme Merkezi (ICDT) Genel Direktörü Latifa El Bouabdellaoui nin Sayın Ticaret Bakanımızı muhatap mektubu iletilmektedir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
15.02.2022
D-8 Proje Destek Fonu
Sayın Üyemiz, Ülkemiz ile Bangladeş, Endonezya, İran, Malezya, Mısır, Nijerya ve Pakistan dan oluşan Gelişen Sekiz Ülke (D-8) Ekonomik İşbirliği Teşkilatı, üye ülkeler arasında kalkınmaya yönelik işbirliğini geliştirmek, ekonomik ve sosyal ilişkileri zenginleştirmek amacıyla 1997 yılında kurulmuş olan bir örgüttür. Birliğimiz, D-8 marjında kurulmuş olan D-8 Ticaret ve Sanayi Odaları nın (D-8 TSO) kurucu üyesidir. Ülkemizin D-8 2017-2021 dönem başkanlığı çerçevesinde, D-8 TSO Dönem başkanlığı da Birliğimizce yürütülmüştür. 20 Ekim 2018 tarihinde düzenlenen 9. D-8 Zirvesi nde D-8 proje faaliyetlerinde kullanılmak üzere Proje Destek Fonu oluşturma fikri ortaya çıkmıştır. Bu çerçevede, ilgide kayıtlı yazıda, D-8 Sekretaryası ndan alınan Nota ya atfen, D-8 çerçevesindeki tarım, sanayi, ticaret, enerji, turizm, ulaştırma ve sağlık alanlarında proje ve programların uygulanması için yapılacak ön fizibilite ve fizibilite çalışmalarının desteklenmesi amacıyla D-8 Proje Destek Fonu nun kurulduğu ve bu Fondan istifade etmek isteyen D-8 Üyesi ülkelerin proje tekliflerini D-8 Sekretaryası na iletmeleri gerektiği ifade edilmektedir. D-8 Komisyonu tarafından seçilecek olan projede; en az 3 D-8 üyesi ülkenin yer alması gerekmektedir. Ön fizibilite ve fizibilite çalışmaları için D-8 tarafından, proje başına en fazla 20.000 Avro kadar bir finansman sağlanması, uygulama süresinin ise en fazla 12 ay olması öngörülmektedir. D-8 Proje Destek Fonu nun Başvuru Şartnamesi ile Proje Teklif Formu ekte sunulmakta olup, anılan Fondan yararlanmak isteyen firmaların 30 Nisan 2022 tarihine kadar Proje Teklif Formu nu doldurarak D-8 Sekretaryası nın yetkilisine (Mr. Sheikh Mohammad Moinuddin, IT Expert, E-posta: moin.uddin@developing8.org; Cep: 0506 395 61 83) iletmesi gerekmektedir. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
15.02.2022
Suudi Arabistan Ticari Gizleme İle Mücadele Programı
Sayın Üyemiz, Suudi Arabistan da (SA) faaliyet lisansı temininde ve vergi yükümlülüklerinde Suudi vatandaşlara daha elverişli şartlar sağlanması nedeniyle, yasak olmasına rağmen, genellikle küçük ve orta ölçekli ticari faaliyet göstermek isteyen yabancı girişimcilerin güvendikleri bir SA vatandaşı ile gayriresmi ortaklık kurarak ekonomik faaliyette bulunmasının ülkede yaygın bir uygulama olduğu bildirilmektedir. Ticari gizleme olarak isimlendirilen bu uygulamada; Suudi tarafın herhangi bir minimum yatırım tutarı olmaksızın, işletme ruhsatını temin ederek yabancı tarafın ticari faaliyetleri yürütmesine imkân sağladığı, bununla birlikte güvene dayalı ortaklık ilişkisi kurarak SA da yatırım yapıp şirket işleten ancak şirketin resmi sahibi olan Suudi tarafından şirketle ilişiği kesildiği için zarara uğrayan çok sayıda yabancının bulunduğu belirtilmektedir. Yazıda devamla; bu uygulamaları önlemek amacıyla, SA Ticaret Bakanlığı tarafından 28 Şubat 2021 tarihinde Ulusal Ticari Gizleme ile Mücadele Programının (National Anti-Concealment Program) hayata geçirilerek; işletmelerin, gerekli şartları yerine getirerek cezasız şekilde yasal statülerini kanuna uygun hale getirmelerine imkan tanındığı; anılan programın süresinin 16 Şubat 2022 tarihinde dolacağı, geçiş süresinden sonra bu tarz şirketlere daha sıkı denetimlerin yapılmasının beklendiği ifade edilmektedir. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
15.02.2022
Ürdün Yatırım Bakanının Ziyareti Hk.
Sayın Üyemiz, TOBB dan Borsamıza gelen yazıda, Ürdün Yatırım Bakanı Sayın Khairy Amro nun Mart ayının ilk yarısında ülkemize bir çalışma ziyareti gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere, Ürdün ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 16 Şubat Çarşamba günü mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederim. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
15.02.2022
Türkiye Yatırım Platformu Bilgilendirme Toplantısı Daveti
Sayın Üyemiz, Dışişleri Bakan Yardımcısı, AB Başkanı, Katılım Öncesi Yardım Aracı (IPA) Ulusal Koordinatörü (NIPAC) Büyükelçi Sayın Faruk Kaymakcı başkanlığında, Avrupa Komisyonu DG NEAR Genel Müdür Vekili Sayın Maciej Popowski ve Avrupa Komisyonu temsilcilerinin yanı sıra, AB Türkiye Delegasyonu temsilcilerinin katılımıyla 16 Şubat 2022 tarihinde saat 15:30 da özel sektör kuruluşlarına yönelik çevrimiçi, "Türkiye Yatırım Platformu Bilgilendirme Toplantısı (toplantı linki: https://zoom.us/j/98600422120?pwd=SnhyR0RtR1dpNnE4ckpnUFllZnlBQT09 Toplantı ID: 986 0042 2120, Toplantı Şifresi: 018148)" gerçekleştirilecektir. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
15.02.2022
Gıdada KDV yi yüzde 8 den yüzde 1 e indiren karar Resmi Gazete de yayımlandı.
Sayın Üyemiz, Cumhurbaşkanı Recep Tayyip Erdoğan ın açıkladığı temel gıda maddelerinde uygulanacak katma değer vergisi (KDV) indirimi oranı belirlendi. Mal ve Hizmetlere Uygulanacak Katma Değer Vergisi Oranlarının Tespitine İlişkin Kararda Değişiklik Yapılmasına Dair Cumhurbaşkanı Kararı Resmi Gazete de yayımlandı. Buna göre, temel gıda ürünlerinde KDV yüzde 8 den yüzde 1 e indirildi.Karar, 14 Şubat Pazartesi yürürlüğe girecek. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
14.02.2022
Tüzel Kişilerin Dönüşen DTH ve Altın Hesaplarına Stopaj Desteği
Sayın Üyemiz, Resmi Gazete’de yayınlanan Cumhurbaşkanı kararına göre, stopaj avantajından; yurt içi yerleşik kişilerin 20 Aralık 2021 itibarıyla, yurt içi yerleşik tüzel kişilerin ise 31 Aralık 2021 itibarıyla mevcut olan DTH’ları yararlanacak. Ayrıca yurt dışında yerleşik vatandaşların transfer edecekleri döviz tutarları karşısında açılan TL mevduat ve katılım hesapları da indirimli stopaj desteğinden yararlanabilecek. Cumhurbaşkanı kararının ikinci maddesi ile de yurt içi yerleşik gerçek kişilerin 28 Aralık 2021 itibarıyla, yurt içi yerleşik tüzel kişilerin ise 31 Aralık 2021 itibarıyla mevcut olan altın depo hesapları ve altın cinsinden katılma fonu hesaplarının da stopaj desteğinden yararlanması hükme bağlandı. Bu kalemde ayrıca bu tarihlerden sonra açılacak işlenmiş ve hurda altın karşılığı altın hesaplarından dönüşüm fiyatı üzerinden TL’ye çevrilen mevduat ve katılma hesapları da yararlanabilecek. 193 sayılı Gelir Vergisi Kanunu’nun geçici 67’nci maddesi kapsamında yer alan bazı kazanç ve iratlardan yapılacak stopajları düzenleyen Bakanlar Kurulu Kararı uyarınca, kur korumalı vadeli mevduat hesapları ile döviz tevdiat hesaplarında dönüşüm kuru üzerinden TL’ye çevrilen mevduat hesapları için stopaj yüzde 0 olarak uygulanıyor. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
14.02.2022
Sanayi Sicil Mevzuat Değişikliği
Sayın Üyemiz, TOBB tarafından Borsamıza gönderilen yazıda, ekteki yazı ile Sanayi ve Teknoloji Bakanlığı tarafından "Sanayi Sicil Mevzuat Taslağı" hazırlandığı bildirilmekte, bu kapsamda görüş ve değerlendirmeler talep edilmektedir. Bilgilerinizi ve konu ile ilgili görüş ve değerlendirmelerinizi Görüş Bildirme Formu ile 18.02.2022 tarihine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletmenizi rica ederim. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
11.02.2022
Sayın Cumhurbaşkanımızın Kongo Demokratik Cumhuriyeti ni Ziyaretleri Hk.
Sayın Üyemiz, TOBB tarafından Borsamıza gönderilen yazıda,Sayın Cumhurbaşkanımızın 21, 23 veya 24 Şubat 2022 tarihlerinde Kongo Demokratik Cumhuriyeti ne (KDC) resmi bir ziyaret gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bahse konu ziyaretin hazırlık çalışmalarında yararlanılmak üzere KDC ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 11 Şubat 2022 Cuma günü mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederim. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
11.02.2022
Tehlikeli Narenciye Zararlısının İsrail’de Tespiti
Sayın Üyemiz, TOBB tarafından Borsamıza gönderilen yazıda,İsrail Tarım ve Kırsal Kalkınma Bakanlığı nın 26 Ocak 2022 tarihinde yaptığı açıklamaya atfen, narenciye bahçe sahalarına zarar veren "yeşillenme" hastalığının İsrail de görüldüğü açıklanmış olup, söz konusu hastalığa neden olan böceklerin tüm ülke sathına yayılmış olabileceğinin tahmin edildiği ifade edilmiştir. Yazıda devamla, İsrail e ürün taşıyan TIR kamyonlarının ülkemizde narenciye havzası olan Mersin den İsrail deki narenciye ekimi yapıldığı bilinen noktalara mal taşımaları sebebiyle, anılan hastalığın ilgili kurum/kuruluşların dikkatine sunulması talep edilmiştir, Bilgisi yer almaktadır. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
11.02.2022
Türkiye-Bahreyn 7. Dönem KEK Toplantısı
Sayın Üyemiz, TOBB tarafından Borsamıza gönderilen yazıda,Türkiye-Bahreyn 7. Dönem KEK Toplantısının 23 Mart 2022 tarihinde Bahreyn / Manama da gerçekleştirilmesinin planlandığı bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere, Bahreyn ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 22 Şubat Salı günü mesai bitimine kadar Birliğimize (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederim. Üyelerimize duyurulur. Gültekin Güler Genel Sekreter
11.02.2022
Ticaret Müşavirlerimizle Elektronik Sohbetler- Madagaskar
Sayın Üyemiz, TOBB tarafından Borsamıza gönderilen yazıda,10 Şubat 2022 Perşembe günü 14.00-15.30 saatleri arasında Madagaskar da görev yapmakta olan Ticaret Başmüşavirimiz ile bu ülkelerle iş yapmakta olan iş insanlarımızın da konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantısının gerçekleştirileceği bildirilmektedir, bilgisi yer almaktadır. Toplantıya ilişkin detayların yer aldığı doküman ekte sunulmaktadır. Üyelerimize duyurulur. Gültekin Güler Genel Sekreter
11.02.2022
TABADER 2022 Zirve Programı
Sayın Üyemiz, TABADER tarafından, 11 Mart 2022 Cuma günü Uluslararası Tahıl Bakliyat ve Yem Zirvesi yapılacağı bildirilmiştir. Ayrıntılar için tklayınız:https://bit.ly/3GBWrIK Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
8.02.2022
Nebu Expo for Gold & Jewelery
Sayın Üyemiz, "Nebu Expo for Gold & Jewellery" sergi ve konferansının 19 – 21 Şubat 2022 tarihleri arasında Kahire Royal Maxim Palace Kempinski Hotel de, 25 in üzerinde büyük altın şirketinin katılımıyla gerçekleştirileceği bildirilmektedir. İlgili etkinliğin broşürü ve kat planı ekte iletilmekte olup, konuya ilişkin aşağıda sunulan e-posta ve web sitesi üzerinden bilgi alınması mümkündür: E-posta: nebuexpo.gold@gmail.com Web sitesi: www.nebugoldexpo.com Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
8.02.2022
Balkan İş Ödülleri 2022
Sayın Üyemiz, Balkan Odalar Birliği nin de katkılarıyla düzenlenen 8. Balkan İş Ödülleri nin, 25 Mart 2022 tarihinde, Kosova nın başkenti Piriştine deki Emerald Otel de gerçekleştirileceği bildirilmektedir. Ödül töreninin Balkan ülkelerindeki başarılı iş ve sanayi çevrelerini bir araya getirmeyi amaçlamaktadır. Tören ile ilgili detaylı bilgi http://vipcompr.com/balkan-business-awards-will-honor-business-leaders-2022/ adresinde yer almaktadır. Organizasyon ile ilgili detaylı bilgi için ise Bulgaristan Ticaret ve Sanayi Odası (+359 2 8117 489; m.markova@bcci.bg) ile irtibata geçilebilir. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekrete
8.02.2022
MSKÜ Bilge Fikirler Yarışması
Sayın Üyemiz, Muğla Sıtkı Koçman Üniversitesi Teknoloji Transfer Ofisi öncülüğünde 20-21.05.2022 tarihlerinde MSKÜ BilgeFikirler Yarışması düzenlenmesi planlanmaktadır. Bu etkinlik ile eğitim-öğretim, araştırma-geliştirme,bilimsel, teknik, sosyal ve kültürel faaliyetlerde işbirliği ve ortak girişimlerde bulunmak üzere bir arayagelen ADIM Üniversitelerinin ön lisans, lisans ve lisansüstü öğrencilerinin; ormancılık, hayvancılık,tarım ve madencilik temalarında fikirlerinin desteklenmesi hedeflenmektedir. Etkinliğe ilişkin detaylıbilgiye (http://mskubilgefikirler.org/) web sayfasından ulaşılabilecektir. Üyelerimize duyurulur. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
8.02.2022
Kurumlar vergisi muafiyeti
Sayın Üyemiz, 29 Ocak 2022 tarihli ve 31734 sayılı Resmi Gazete de yayımlanan 7352 sayılı Vergi Usul Kanunu ile Kurumlar Vergisi Kanununda Değişiklik Yapılmasına Dair Kanunun 2 nci maddesiyle 5520 sayılı Kurumlar Vergisi Kanununa eklenen geçici 14 üncü madde ile Türk lirası mevduata dönüşümde kur farkı ve altın kazançlarına kurumlar vergisi istisnası getirilmiştir. Yapılan düzenleme ile bankacılık sistemindeki toplam mevduat ve katılım payı büyüklüğü içerisinde Türk lirasının payının artırılarak finansal istikrarın desteklenmesi amacıyla, yabancı paralarını ve/veya altın bakiyelerini Türk lirasına çeviren kurumlar vergisi mükelleflerinin dönüşüm esnasında oluşan kur farkı kazançları da dahil olmak üzere bu kapsamda açılan vadeli Türk lirası mevduat ve katılma hesaplarından elde edecekleri faiz ve kar paylarının vergiden istisna edilmesi amaçlanmıştır. Buna göre; 1) 2021 yılı 4 üncü geçici vergi dönemine ilişkin beyannamenin verilme tarihine (17 Şubat 2022) kadar Türk lirası mevduat ve katılma hesaplarına dönüşüm: Kurumların 31/12/2021 tarihli bilançolarında yer alan yabancı paralarını dördüncü geçici vergi dönemine ilişkin beyannamenin verilme tarihine (17 Şubat 2022) kadar Türk lirasına çevirmeleri ve bu suretle elde edilen Türk lirası varlığı bu kapsamda açılan en az üç ay vadeli Türk lirası mevduat ve katılma hesaplarında değerlendirmeleri durumunda; a) Söz konusu yabancı paraların dönem sonu değerlemesinden kaynaklanan kur farkı kazançlarının 1/10/2021-31/12/2021 tarihleri arasındaki döneme isabet eden kısmı, b) 2021 yılı dördüncü geçici vergi dönemine ilişkin beyannamenin verilme tarihine kadar Türk lirasına çevrilen hesaplarla ilgili oluşan kur farkı kazançları ile söz konusu hesaplardan dönem sonu değerlemesinden kaynaklananlar da dâhil olmak üzere vade sonunda elde edilen faiz ve kar payları ile diğer kazançlar kurumlar vergisinden istisna tutulmuştur. 2) 2022 yılı sonuna kadar Türk lirası mevduat ve katılma hesaplarına dönüşüm: Kurumların 31/12/2021 tarihli bilançolarında yer alan yabancı paralarını 2022 yılı sonuna kadar dönüşüm kuru üzerinden Türk lirasına çevirmeleri ve bu suretle elde edilen Türk lirası varlığı en az üç ay vadeli Türk lirası mevduat ve katılma hesaplarında değerlendirmeleri durumunda; a) Oluşan kur farkı kazançlarının, geçici vergi dönemi sonu değerlemesiyle Türk lirasına çevrildiği tarih arasına isabet eden kısmı, b) Dönem sonu değerlemesinden kaynaklananlar da dâhil olmak üzere vade sonunda elde edilen faiz ve kar payları ile diğer kazançlar kurumlar vergisinden istisna edilmiştir. 3) Altın hesabı ile bu tarihten sonra açılacak işlenmiş ve hurda altın karşılığı altın hesabı bakiyelerinin 2022 yılı sonuna kadar Türk lirası mevduat ve katılma hesaplarına dönüşümü: Kurumların 31/12/2021 tarihli bilançolarında yer alan altın hesabı ile bu tarihten sonra açılacak işlenmiş ve hurda altın karşılığı altın hesabı bakiyelerini 2022 yılı sonuna kadar dönüşüm fiyatı üzerinden Türk lirasına çevirmeleri ve bu suretle elde edilen Türk lirası varlığı en az üç ay vadeli Türk lirası mevduat ve katılma hesaplarında değerlendirmeleri durumunda; a) Türk lirasına çevrildiği tarihte oluşan kazançlar, b) Dönem sonu değerlemesinden kaynaklananlar da dâhil olmak üzere vade sonunda elde edilen faiz ve kar payları ile diğer kazançlar kurumlar vergisinden istisna edilmiştir. 4) Türk lirası mevduat veya katılma hesabından vadeden önce çekim yapılması: Türk lirası mevduat veya katılma hesabından vadeden önce çekim yapılması durumunda bu madde kapsamında istisna edilen tutarlar nedeniyle zamanında tahakkuk ettirilmeyen vergiler, vergi ziyaı cezası kesilmek suretiyle gecikme faiziyle birlikte tahsil edilecektir. Bilgilerinizi rica ederim. Gültekin Güler Genel Sekreter
3.02.2022
ABD de Türk Kurum/Şirketleri İlgilendirebilecek İflas Davası
Sayın Üyemiz, Ticaret Bakanlığından alınan yazıda "Houston Teksas Bölge İflas Mahkemesi" tarafından Dışişleri Bakanlığı na "Carlson Travel" isimli şirketin iflas süreciyle ilgili bir tebligatname ulaştığı, konu hakkında görüşlerine başvurulan Vaşington Büyükelçiliğimiz sözleşmeli hukuk firmasının anılan iflas mahkemesince görülmekte olan davada Carlson Travel grubunun borçlu olduğu 90.000 alacaklı arasında Türk şirketlerinin de olabileceğini belirttiği bildirilmektedir. Ayrıca, konuya ilişkin iki ilave tebligatname alındığı,sözleşmeli hukuk firmasından bu defa alınan tebligatların anılan şirketin iflasına ilişkin konkordato süreci bağlamında 12 Kasım 2021 tarihinde gerçekleştirilen duruşmayla ilgili olduğu, tebligatlarda ilgililerin 13 Aralık 2021 tarihine kadar mahkemeye bir "opt-out" formu sunabileceği, bu düzenlemenin söz konusu duruşmada tasdik edilen plana itiraz ederek haklarını ayrı bir hukuk süreciyle takip etmek isteyen kuruluş ve kişilere yönelik olduğu ifade edilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.02.2022
Fikri Mülkiyet Lisanslama Aracılık Hizmetlerinin Geliştirilmesinin Desteklenmesi Çağrısı Eğitimi
Sayın üyemiz, Katılım Öncesi Mali Yardım Aracı (IPA) Rekabetçi Sektörler Programı altında KOSGEB tarafından tasarlanan ve geliştirilen, "COSME Programı nın Koordinasyonunun Güçlendirilmesi, Tanıtımı ve Yararlanıcıların Kapasitesinin Artırılması-COSME Türkiye Teknik Destek Projesi-" kapsamında; 2-3 Şubat 2022 tarihlerinde ekte iletilen gündem ile "Fikri Mülkiyet Lisanslama Aracılık Hizmetlerinin Geliştirilmesinin Desteklenmesi Çağrısı Eğitimi" düzenlenecektir.Söz konusu etkinlikler online gerçekleştirilecektir. Etkinliklere kayıt yaptırmak için cosme@kosgeb.gov.tr adresi ile iletişime geçilmesi ya da https://cosme.kosgeb.gov.tr adresindeki kayıt formunun doldurulması gerekmektedir. Çağrıyla ilgili bilgi dokümanı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.02.2022
KOSGEB - MİKRO ve KÜÇÜK İŞLETMELERE (MKİ) HIZLI DESTEK PROGRAMI
Sayın Üyemiz, Covid-19 salgını kapsamında mikro ve küçük işletmelere KOSGEB tarafından istihdam performansına dayalı faizsiz ve teminatsız geri ödemeli destek verilecektir. <<< Son başvuru tarihi: 31 Mart 2022 >>> Desteğin amacı: KOSGEB Mikro ve Küçük İşletmelere (MKİ) Hızlı Destek Programının amacı; MKİ’lerin salgın şartlarında faaliyetlerini sürdürmelerinin ve geçmiş dönem ortalama istihdam seviyelerini koruyarak yeni personel istihdam etmelerinin sağlanmasıdır. Destek kapsamı: İmalat, bilgisayar programlama, bilimsel Ar-Ge sektörleri ile Covid-19 salgınının nispeten daha fazla etkilediği bazı hizmet ve ticaret sektörlerindeki MKİ’lere: - 1981 ve sonrası doğumlu, son 3 yılda 180 günden fazla çalışmamış üniversite veya mesleki ya da teknik lise mezunu en az bir yeni personelin “12 ay boyunca istihdam edilmesi taahhüdü”, - “Başvuru dönemi ilanından önceki 12 aylık ortalama istihdamın korunması” şartı ile; yeni istihdam edilecek personel başına 100 Bin TL geri ödemeli destek verilecektir. İşletme sahibi kadın ise veya işe alınan personel kadın ise, destek personel başına 10 Bin TL artırımlı olarak uygulanacaktır. Başvuru dönemi ilan tarihinden önceki ayda işletmede çalışmıyor olan personel “yeni” kabul edilecektir. Mikro işletmeler en fazla 2 personel, küçük işletmeler en fazla 5 personel için destek alabilecektir. Destek kapsamında istihdam taahhüdünde bulunulan personelin işten ayrılması/değiştirilmesi durumunda, şartlara uygun yeni bir personel istihdam edilebilecektir. Programının önceki başvuru dönemlerinden yararlananlar, yeni başvuru dönemi şartlarını karşılamak kaydıyla bu dönemde de programa başvuru yapabilecektir. Başvuru şartları: - Destekten yararlanabilecek MKİ’lerin sektörleri; Program Bilgilendirme Sayfasında yayınlanmaktadır. - Covid-19 salgınından önce de aktif olduğu kabul edilen MKİ ler başvuru yapabilecektir. 2019 yılında asgari 75.000 TL net satış hasılatı elde edilmiş olması, salgından önce aktif işletme olmanın kanıtı sayılacaktır. Bu kriter 2017 ve sonrasında kurulan yenilikçi genç işletmelerde aranmayacaktır. Destek kapsamında yeni istihdam edilebilecek personelde aranan şartlar: - Üniversite (2 yıllık ve üstü) ya da mesleki ve/veya teknik lise mezunu olmalıdır. - Başvuru döneminin ilan edildiği aydan önceki ayda MKİ’de çalışmıyor olmalıdır. - Başvuru döneminin ilan edildiği aydan itibaren son 3 yıl içinde toplam SGK 4A’lı prim günü sayısı 180’den fazla olmamalıdır. - 1981 ve sonrası doğumlu olmalıdır. - Yabancı uyruklu personel istihdam edilemez. Başvuru yeri: - Başvuru kriterlerini karşılayan mikro ve küçük işletmeler www.kosgeb.gov.tr adresindeki “E-Hizmetler” menüsünden “Mikro ve Küçük İşletmelere Hızlı Destek Programı Başvurusu” alt menüsünü seçerek online başvuru yapabilecektir. KOSGEB Veritabanına kayıtlı olmayan veya KOBİ Bilgi Beyannamesi güncel olmayan işletmeler, önce kayıt ve güncelleme işlemini yapmalıdır. - Program başvuruları 31 Mart 2022’ye kadar yapılabilecektir. Program başvurusuna geçici onay verilen işletmelerin, istihdam edilen personel için ödeme talebi yapabilecekleri son tarih 25 Mayıs 2022’dir. Geri ödeme: Geçmiş dönem ortalama istihdam seviyelerini koruyarak yeni personel istihdam etme taahhütlerini yerine getirmiş olmak kaydı ile; MKİ’ler kullandıkları desteği 24 ay geri ödemesiz dönemi takiben 4’er aylık 6 taksitte faizsiz ve komisyonsuz olarak KOSGEB’e geri ödeyecektir. Detaylı bilgi www.kosgeb.gov.tr adresindeki Program Bilgilendirme Sayfasından ve KOSGEB İl Müdürlüklerinden alınabilecektir. Programa ilişkin sunum ekte yer almaktadır. İlgili program kontenjana tabi olduğundan başvurunuzun sıraya alınması adına erken başvuru yapmanız önemle rica olunur. Gültekin Güler Genel Sekreter
1.02.2022
Sanayi Tesislerinde Elektrik Kesintileri
Sayın Üyemiz, Sanayi tesislerinde yapılan elektrik kesintilerinin sebebi açıklanmakta ve sanayicilerimizin ihtiyaç duyması halinde yabancı muhataplarına iletmeleri için İngilizce olarak hazırlanan resmi mektup sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
1.02.2022
Deneyimler ve Uygulamalarla İş Etiği Semineri
Sayın Üyemiz, TOBB Tedarikçi Geliştirme Programı kapsamında 1 Şubat 2022 Salı günü saat 14:00 te internet üzerinden "Deneyimler ve Uygulamalarla İş Etiği Semineri" gerçekleştirilecektir. Seminere ilişkin program ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği organizasyonunda internet üzerinden gerçekleştirilecek olan seminerde; uluslararası şirketlerin iş etiği ve uyum konularındaki standartları, uluslararası şirketlere iş ortağı olma yolunda deneyimler ve gelişim aşamaları ile işletmelerde kurumsal iş etiği ve uyum kültürünün oluşturulması ve uygulamaları anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.01.2022
Verimlilik Proje Ödülleri Finale Kalan Projeler Konferansı
Sayın üyemiz, 2021 Verimlilik Proje Ödülleri kapsamında finale kalan projelerin ayrıntılarının kamuoyu ile paylaşılması amacıyla 31 Ocak 2022 Pazartesi günü 14:00 -17:00 saatleri arasında, Sanayi ve Teknoloji Bakanlığı tarafından "Verimlilik Proje Ödülleri Finale Kalan Projeler Konferansı" (çevrimiçi) düzenlenecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.01.2022
Bazı Tarım Ürünlerinin İhracatına İlişkin Tebliğ
Sayın Üyemiz, 27 Ocak 2022 tarihli ve 31732 sayılı Resmi Gazete de yayımlanan ve ekte bir örneği sunulan Bazı Tarım Ürünlerinin İhracatına İlişkin Tebliğ ile, Tebliğ de yer alan tarım ürünleri ihracatında gerektiğinde dönemsel düzenlemeler yapmaya Tarım ve Orman Bakanlığı nın yetkilendirildiği açıklanmıştır. İlgili tebliğe ulaşmak için tıklayınız. Gültekin Güler Genel Sekreter
27.01.2022
TEKNOFEST 2022
Sayın Üyemiz, Sanayi ve Teknoloji Bakanlığı ndan Birliğimize iletilen yazıda; Bakanlık öncülüğünde hayata geçirilen ve bu yıl beşincisi gerçekleştirilecek olan TEKNOFEST Havacılık, Uzay ve Teknoloji Festivali nin 30 Ağustos-4 Eylül 2022 tarihleri arasında Samsun da düzenleneceği bildirilmektedir. Teknoloji ve bilime yönelik toplumda farkındalık oluşturmayı ve Türkiye nin bilim ve mühendislik alanlarında yetişmiş insan kaynağını artırmayı hedefleyen TEKNOFEST, gençlerin geleceğin teknolojileri üzerinde çalışmalarını desteklemek için roketlerden otonom sürüş sistemlerine, insansız hava araçlarından sualtı sistemlerine teknolojinin birçok alanında düzenlenen yarışmalar başta olmak üzere, çeşitli etkinliklere ev sahipliği yapmaktadır. Teknofest 2022 heyecanı, festival kapsamında düzenlenecek teknoloji yarışmaları için açılan başvurular ile başlamış bulunmaktadır. Festivalin hedeflerine ulaşmasında, özellikle yarışmaların mümkün olduğunca fazla gence duyurulması büyük önem arz etmektedir. Anılan yarışmalara başvuru için belirlenen son tarih 28 Şubat 2022 olup, Teknofest 2022 e ve başvuruları başlayan teknoloji yarışmalarına dair Festival Tanıtım Metni ekte yer almaktadır. Detaylı bilgi ve başvuru koşullarına teknofest.org/tr/adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.01.2022
Gıda sektörü teknik destek çağrısı 14 Şubat 2022 tarihine uzatıldı
Sayın Üyemiz, Türkiye Gıda İnovasyon Platformu, TÜGİP faaliyetleri kapsamında gıda ve içecek sektöründe faaliyet gösteren 50 firmanın Ar-Ge ve İnovasyon kapasitesinin geliştirilmesi amacıyla 5 Ocak 2022 tarihinde Teknik Destek Çağrısı açılmıştır. Çağrı için son başvuru tarihi 14 Şubat Pazartesi gününe kadar uzatılmıştır. Teknik Destek Çağrısı öncelikle KOBİ’leri hedeflemektedir. Çağrıda destek almaya uygun bulunan firmalarla birebir yapılacak görüşmelerde firmaların Ar-Ge ve inovasyon yönetim süreçleri, üretim hatları ve teknoloji seviyeleri değerlendirilecek, bu süreçlerde yaşadıkları teknik sorunlar ve rekabetçiliklerinde öne çıkan engeller belirlenecektir. Görüşme sonrasında firmaya özel Değerlendirme ve İhtiyaç Analizi Raporu hazırlanarak, ihtiyaçları doğrultusunda 2-4 gün arasında bedelsiz danışmanlık ve teknik destek hizmeti verilecektir. Türkiye Gıda İnovasyon Platformu, TÜGİP TÜBİTAK MAM Gıda Enstitüsü’nün faydalanıcısı olduğu Rekabetçi Sektörler Programı destekli INNOFOOD projesi kapsamında paydaşların değerli katkıları ile kurulmuştur. TÜGİP ülkemiz gıda ve içecek sektörünün ihtiyaçlarından yola çıkarak oluşturulan çok taraflı ve tüm paydaşları kapsayan bir platformdur. Platformun yanısıra TÜBİTAK MAM Gebze yerleşkesinde çok farklı ürün gruplarında yeni ürün ve proses geliştirme çalışmalarının yürütülebileceği 9 Pilot Tesis ve İleri Gıda Güvenliği Laboratuvarını içeren “Gıda İnovasyon Merkezi” kurulmuştur. TÜGİP ile ilgili detaylı bilgiye [www.tugip.org.tr] www.tugip.org.tradresinden erişebilirsiniz. Çağrı ile ilgili açıklama ve başvuru formunu mail ekinde vewww.tugip.org.tradresinde bulabilirsiniz. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.01.2022
Verimlilik Dergisi
Sayın Üyemiz, Sanayi ve Teknoloji Bakanlığı, Stratejik Araştırmalar ve Verimlilik Genel Müdürlüğü tarafından Birliğimize gönderilen ekli yazıda; 2022 yılında derginin normal sayılarına ek olarak "Döngüsel Ekonomi ve Sürdürülebilirlik" temalı özel bir sayı yayımlanacağından bahisle, araştırmacıların çalışmalarını, 30 Nisan 2022 tarihine kadar iletmeleri istenmektedir. Bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
26.01.2022
Tek Pazar Programı – Sürdürülebilir Turizm ile Büyüme ve KOBİ’ler Çağrısı
Sayın Üyemiz, KOSGEB tarafından tasarlanan ve geliştirilen, "COSME Programı nın Koordinasyonunun Güçlendirilmesi, Tanıtımı ve Yararlanıcıların Kapasitesinin Artırılması -COSME Türkiye Teknik Destek Projesi-" kapsamında; 19-20 Ocak 2022 tarihlerinde "Tek Pazar Programı, Sürdürülebilir Turizm ile Büyüme ve KOBİ ler Çağrısı Eğitimi"; 25 Ocak 2022 tarihinde aynı çağrıya teklif sunma potansiyeli ve arzusu olan kurum/kuruluşlar için proje hazırlamaya yönelik bir çalıştay düzenlenecektir. Söz konusu etkinlikler online gerçekleştirilecektir. Etkinliklere kayıt yaptırmak için cosme@kosgeb.gov.tr adresi ile iletişime geçilmesi ya da https://cosme.kosgeb.gov.tr adresindeki kayıt formunun doldurulması gerekmektedir. Çağrıyla ilgili bilgi dokümanı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.01.2022
ARPA SATIŞI
Sayın Üyemiz, S.S. Eskişehir Pancar Ekicileri Kooperatifi merkez mağaza ambarlarında mevcut olan arpalar satışa sunulacaktır. Fiyatlar kapalı zarf usulü ile 25.01.2022 Salı günü mesai bitimine kadar verilecek olup, 26.01.2022 Çarşamba günü saat 14.00 te komisyon eşliğinde zarflar açılacak ve teklif veren tüccarlar arasında açık artırma usulü ile satış yapılacaktır. İlgili duyuru ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
18.01.2022
Kredi Garanti Fonu Bilgilendirme Semineri
Sayın Üyemiz, Teminat yetersizliği nedeniyle kredi alamayan işletmelere kefil olan ve bu işletmelerin finansmana erişmelerinde destekleyici mekanizmaları bulunan "Kredi Garanti Fonu (KGF) hakkında; 20 Ocak 2022 Perşembe günü saat 14:00 te internet üzerinden seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile Kredi Garanti Fonu işbirliğinde gerçekleştirilecek olan seminerde; Kredi Garanti Fonu tanıtımı ve kefalet sisteminin işleyişi, güncel hazine destekli kefalet paketleri ve özkaynak ve yurtdışı kaynaklı destek paketleri anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
18.01.2022
Türkiye-AB İş Dünyası Diyaloğu Projesi- Tarımsal Gıda Ağ Oluşturma Etkinliği
Sayın Üyemiz, Avrupa Birliği’nin sağladığı mali destekle, Birliğimiz ve “Avrupa Ticaret ve Sanayi Odaları Birliği” (EUROCHAMBRES) işbirliğinde yürütülmekte olan “Türkiye-AB İş Dünyası Diyaloğu (TEBD)” projesi kapsamında, 27-28 Ocak 2022 tarihlerinde, çevrim içi olarak, “TEBD Tarımsal Gıda Ağ Oluşturma” etkinliği gerçekleştirilecektir. TEBD Tarımsal Gıda Ağ Oluşturma Etkinliğinin amacı, tarımsal gıda sektöründeki temel konuları tartışmak ve şirketler arasında ağ oluşturarak katılımcıların yeni pazarlara, tedarikçilere, tüccarlara, ilgili kuruluşlara vb. erişimlerini sağlamak ve işbirliklerini geliştirmektir. TEBD Tarımsal Gıda Ağ Oluşturma Etkinliği, altı farklı oturum, paneller ve interaktif yuvarlak masalar aracılığıyla, “tarımsal gıda” alanındaki temel konuları tartışmak ve firmalar arasında yeni ortaklıklar kurmalarına fırsat yaratmak için bir araya getirecektir: 1. Coğrafi İşaretli Ürünler 2. Kuruyemişler ve Meyve 3. Aromatik Bitkiler 4. Dondurulmuş Gıdalar (su ürünleri dahil olmak üzere) 5. Sağlıklı Yaşam için Besleyici Ürünler (vegan, glutensiz, diyabetik vb.) 6. Bio-organik gıda Etkinliğe katılmak için gündemin de yer aldığı https://events.tebd.eu/event/TEBDagrifoodnetworkingevent?language=tr-TR linkinden kayıt yaptırılması gerekmektedir. Etkinlik 27 Ocak 2022 tarihinde başlayacak olup, grup seanslarında Türkçe ve İngilizce simültane çeviri sağlanacaktır. Etkinlikte, “Ağ Oluşturma Dijital Platformu” üzerinden firma/kurumlar ile ikili görüntülü görüşmeler yapılması imkanı sunulacaktır. Bu çerçevede, katılımcıların sisteme bilgi girişine başlamak için öncelikle “Click Here To Get Started” butonuna tıkladıktan sonra firmaları/kurumları ile ilgili sayfada belirtilen soruları cevaplamaları ve kayıt formunu doldurmaları (profil oluşturmaları) gerekmektedir. Etkinlikten 10 gün önce, katılımcılar, etkinlik içindeki ikili görüşmelerini planlamak üzere dijital platforma giriş yapmaları için davet mesajı (kayıt formlarındaki elektronik posta yada formda belirtildi ise cep telefonlarına) alacaklardır. Kendilerine gelen mesaj sonrası, platforma giriş yapan katılımcılar, katılımcı listesine göz atabilecek ve kimlerle tanışmak istediklerini (ikili görüşmelerini) kendileri seçebileceklerdir. Bu çerçevede platform üzerinden ikili görüşmelerini planlayan katılımcılar etkinlik içinde görüşmelerini başlatabilecektir. Yukarıdaki açıklamalar çerçevesinde kaydını tamamlayan ancak etkinlikte ikili görüşme yapmak istemeyen katılımcıların ise, toplantı tarihindeevents.conversationstarter.net/e/tebd-agri-food linkine girerek, “log-in” kısmında yer alan kullanıcı adı ve şifrelerini doldurarak toplantıya erişmeleri mümkün olacaktır. Platforma giriş konusunda sorular olması durumunda, tebd@eurochambres.eu elektronik posta adresinden teknik destek alınabilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
18.01.2022
IPA-Innofood Projesi
Sayın Üyemiz, Türkiye Gıda İnovasyon Platformu, TÜGİP faaliyetleri kapsamında gıda ve içecek sektöründe faaliyet gösteren 50 firmanın Ar-Ge ve İnovasyon kapasitesinin geliştirilmesi amacıyla 5 Ocak 2022 tarihinde Teknik Destek Çağrısı açılmıştır. Türkiye Gıda İnovasyon Platformu, TÜGİP TÜBİTAK MAM Gıda Enstitüsü’nün faydalanıcısı olduğu Rekabetçi Sektörler Programı destekli INNOFOOD projesi kapsamında paydaşların değerli katkıları ile kurulmuştur. TÜGİP ülkemiz gıda ve içecek sektörünün ihtiyaçlarından yola çıkarak oluşturulan çok taraflı ve tüm paydaşları kapsayan bir platformdur. Platformun yanısıra TÜBİTAK MAM Gebze yerleşkesinde çok farklı ürün gruplarında yeni ürün ve proses geliştirme çalışmalarının yürütülebileceği 9 Pilot Tesis ve İleri Gıda Güvenliği Laboratuvarını içeren “Gıda İnovasyon Merkezi” kurulmuştur. Teknik Destek Çağrısı öncelikle KOBİ’leri hedeflemektedir. Çağrıda destek almaya uygun bulunan firmalarla birebir yapılacak görüşmelerde firmaların Ar-Ge ve inovasyon yönetim süreçleri, üretim hatları ve teknoloji seviyeleri değerlendirilecek, bu süreçlerde yaşadıkları teknik sorunlar ve rekabetçiliklerinde öne çıkan engeller belirlenecektir. Görüşme sonrasında firmaya özel Değerlendirme ve İhtiyaç Analizi Raporu hazırlanarak, ihtiyaçları doğrultusunda danışmanlık ve teknik destek hizmeti verilecektir. 26 Ocak 2022tarihine kadar açık kalacak TÜGİP Teknik Destek Çağrısı ileilgili açıklama ve başvuru formunu mail ekinde vewww.tugip.org.tradresinde bulabilirsiniz. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.01.2022
BEBKA 2022 Yılı Kırsal Kalkınma Mali Destek Programı
Sayın üyemiz, Programın amacı, Bursa, Eskişehir, Bilecik Bölgesinde kırsal alanlarda tarım ve sanayi iş birliğinin güçlendirilmesi ve ekonomik çeşitliliğin oluşturularak gelir artışına katkı sağlanmasıdır. Programın toplam bütçesi 15 milyon TL’dir. Kalkınma Ajansları Yönetim Sistemi (KAYS) üzerinden proje başvurusu yapmak için son tarih20 Mart 2022 saat 23:59, projeye ilişkin taahhütnamenin imzalanması/Ajansa iletilmesi için son tarih 25 Mart 2022 saat 18:00 olarak belirlenmiştir. Programın Toplam Bütçesi: 15.000.000 TL Proje Başına Mali Destek Tutarı: Asgari Tutar: 250.000 TL Azami Tutar: 1.500.000 TL Proje Başına Mali Destek Oranı: Asgari Oran: %25 Azami Oran: %75 İlan edilen destek programı kapsamında hazırlanan başvuru rehberi ve programın detayları içintıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.01.2022
AB-Afrika İş Forumu
Sayın Üyemiz, TOBB Başkanı M. Rifat Hisarcıklıoğlu nun Başkan vekilliğini yürüttüğü Avrupa Ticaret Odaları Birliği (EUROCHAMBRES) tarafından 14-18 Şubat 2022 tarihlerinde AB-Afrika İş Forumu düzenleneceği bildirilmiştir. Söz konusu iş forumunun ana konusu "Sürdürülebilir büyüme ve insana yakışır işler için daha güçlü değer zincirleri oluşturmak" olarak belirlenmiştir. Hibrit formatta gerçekleştirilecek olan İş Forumunda tartışılacak konular aşağıdadır; - AB ve Afrika Değer zincirlerini entegre etme (17 Şubat 2022 TSİ 12:30-13:30) - Pan Afrika Fırsatları (16 Şubat 2022, TSİ 12:00-13:30) - Gençlik/KOBİ ve Girişimcilik (17 Şubat 2022, TSİ 13:45-15:00) Etkinliğe dinleyici olarakeu.eventscloud.com/ereg/index.php adresinden kayıt yapılabilmektedir. Forum hakkında detaylı bilgiye https://www.euafricabusinessforum.com/en adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.01.2022
Mikro ve Küçük İşletmelere Hızlı Destek Projesi
Sayın Üyemiz, KOSGEB tarafından 2021 yılında "Mikro ve Küçük İşletmelere Hızlı Destek Projesi" başlatılmış olup bu projenin amacı; mikro ve küçük işletmelerin salgın şartlarında faaliyetlerini sürdürmelerinin ve geçmiş dönem ortalama istihdam seviyelerini koruyarak yeni personel istihdam etmelerinin sağlanmasıdır. "Mikro ve Küçük İşletmelere Hızlı Destek" programına başvurular 2022 yılında bazı değişikliklerle yeniden açılmış olup söz konusu destekten yararlanabilmek için "mesleki ya da teknik lise mezunu en az bir yeni personelin 12 ay boyunca istihdam edilmesi taahhüdü" gerekmektedir. Programa ilişkin diğer ayrıntılarwww.kosgeb.gov.tr/site/tr/genel/detay/7579/proje-ozeti adresinde yer almaktadır. Bu kapsamda söz konusu destekten yararlanmak isteyen üyelerimizin Mesleki Eğitim İş Birliği Protokololü kapsamında yer alan proje okulumuz mezunlarını (Atatürk Mesleki ve Teknik Anadolu Lisesi) tercih etmeleri rica olunur. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
14.01.2022
Hayvancılık Desteklemeleri Uygulamasında Değişiklik
Sayın Üyemiz, Tarım ve Orman Bakanlığı, "Hayvancılık Desteklemeleri Uygulama Tebliği nde Değişiklik Yapılmasına Dair Tebliği", Resmi Gazete de yayımlanarak, 1 Ocak 2021 den geçerli olmak üzere, yürürlüğe girdi. Buna göre, hayvan genetik kaynaklarının yerinde geliştirilmesine (Halk Elinde Küçükbaş ve Anadolu Mandası Islahı Projesi) ilişkin desteklemeler kıvırcık koyunu için Aydın, Balıkesir, Bursa, İzmir, Kırklareli ve Yalova da birer, Manisa da 2 olmak üzere hayata geçirilen 8 projeye 50 bin 400 baş üzerinden verilecek. Daha önce adı geçen illerin yanı sıra Bolu daki 1 projeye 56 bin 700 baş üzerinden destek verilmesi kararlaştırılmıştı. Söz konusu destekten faydalanan bir diğer koyun türü olan Orta Anadolu Merinosu projelerine de Ankara, Eskişehir, Karaman da ikişer, Bolu, Konya ve Zonguldak ta birer olmak üzere 9 projeye 56 bin 700 baş üzerinden destek sağlanacak. Önceki tebliğde destek verilecek baş miktarı 50 bin 400 olarak belirlenirken, Bolu herhangi bir proje desteğine dahil edilmemişti.Resmi Gazete ayrıntıları için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
12.01.2022
Mesleki Eğitim Merkezi Programına İlk Kayıt Tarihinin Uzatılması
Sayın Üyemiz, Milli Eğitim Bakanlığı Mesleki ve Teknik Eğitim Genel Müdürlüğü tarafından TOBB a iletilen yazıda, mesleki eğitim merkezi programına ilk defa kayıt olacak öğrenciler ile kalfalık belgesi olup en az ilköğretim mezunu veya ortaokul/imam hatip ortaokulunu bitirmiş ve mesleki eğitim merkezi programının 12. sınıfına kayıt olmak isteyen öğrencilerin kayıt tarihlerinin 4 Şubat 2022 tarihine kadar uzatıldığı bilgisi iletilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.01.2022
Mesleki Eğitim Desteklerinin Artırılması Hk.
Sayın Üyemiz, 25 Aralık 2021 tarihli 31700 sayılı Resmi Gazete de Bazı Kanunlarda Değişiklik Yapılmasına Dair 7346 sayılı Kanun yayımlanmış olup bu kanunun; 12 nci maddesi ile 3308 sayılı Mesleki Eğitim Kanunu nun 25 inci maddesinin birinci fıkrasının ikinci cümlesine "aday çırak ve çırağa yaşına uygun asgari ücretin yüzde otuzundan" ibaresinden sonra gelmek üzere "kalfalık yeterliğini kazanan mesleki eğitim merkezi 12 nci sınıf öğrencilerine asgari ücretin yüzde ellisinden" ibaresi eklenmiştir. 14 üncü maddesi ile 3308 sayılı Kanunun geçici 12 nci maddesinin birinci fıkrası aşağıdaki şekilde değiştirilmiş ve maddeye birinci fıkrasından sonra gelmek üzere aşağıdaki fıkralar eklenmiştir: o "2016-2017 eğitim ve öğretim yılı sonuna kadar uygulanmak üzere aday çırak ve çıraklar ile 18 inci madde hükümleri uyarınca işletmelerde mesleki eğitim gören, staj veya tamamlayıcı eğitime devam eden öğrencilere, 25 inci maddenin birinci fıkrası kapsamında yapılacak ödemeler asgari ücretin net tutarının yüzde otuzundan, kalfalık yeterliğini kazanan mesleki eğitim merkezi 12 nci sınıf öğrencilerine yapılacak ödemeler asgari ücretin yüzde ellisinden az olamaz. Mesleki eğitim merkezi programı dışındaki okul ve kurumlarda öğrenim gören öğrencilere ödenebilecek en az ücretin; yirmiden az personel çalıştıran işletmeler için üçte ikisi, yirmi ve üzerinde personel çalıştıran işletmeler için üçte biri; mesleki eğitim merkezi programına devam eden öğrencilere ödenebilecek en az ücretin ise tamamı 25/8/1999 tarihli ve 4447 sayılı İşsizlik Sigortası Kanununun 53 üncü maddesinin üçüncü fıkrasının (B) bendinin (h) alt bendi için ayrılan tutardan Devlet katkısı olarak ödenir. Bu kapsamda yapılacak ödemeleri on eğitim ve öğretim yılına kadar uzatmaya Cumhurbaşkanı yetkilidir. Staj yapacak işletme bulunamaması nedeniyle stajını okulda yapan ortaöğretim öğrencileri ile öğretim programı gereği staj yapmak zorunda olmayan yükseköğretim öğrencilerinin yaptıkları stajlar bu fıkra hükmü kapsamı dışındadır. Kamu kurum ve kuruluşlarına Devlet katkısı ödenmez." o "Bu madde uyarınca ödenen Devlet katkısı ödemenin yapıldığı tarihi takip eden iki ay içerisinde Çalışma ve Sosyal Güvenlik Bakanlığı bütçesinden İşsizlik Sigortası Fonuna aktarılır." o Birinci fıkrada bu fıkrayı düzenleyen Kanunla yapılan değişiklikler sebebiyle 2021-2022 eğitim ve öğretim yılından önceki döneme ilişkin geçmişe dönük olarak herhangi bir ücret veya Devlet katkısı ödemesi yapılmaz." Buna göre Mesleki Eğitim Kanunu nda yapılan düzenlemeler ile: Kanun un 25 inci maddesinde belirtilen en alt ücret tutarları bu maddenin uygulanma süresinin Cumhurbaşkanı nca uzatıldığı süre boyunca işletmelerde mesleki eğitim gören, staj veya tamamlayıcı eğitime devam eden öğrenciler için asgari ücretin net tutarının yüzde otuzundan az olamayacağı, Mesleki eğitim merkezlerinde öğrenim gören öğrencilere işletmeler tarafından ödenebilecek en az ücretin tamamının devlet katkısı olarak ödenmesi, İşletmelerde beceri eğitimi ve staj yapan öğrencilere işletmeler tarafından ödenecek ücretlere yönelik Devlet katkısı ödeme süresinin beş yıl daha uzatılması yetkisi Cumhurbaşkanı na verilmesi düzenlemeleri yapılmıştır. Bununla birlikte; işletmelerde beceri eğitimi ve staj yapan öğrencilerin alacakları ücretlerin alt limitlerini düzenleyen maddesinde değişikliğe gidilmiş ve kalfalık yeterliğini kazanan mesleki eğitim merkezi 12. sınıf öğrencilerine işletmeler tarafından ödenebilecek en az ücret asgari ücretin net tutarının yüzde ellisi olarak tespit edilmiştir. Kalfalık yeterliliklerine sahip 12. sınıf öğrencilerinin, 9, 10 ve 11. sınıf öğrencilerine göre işletmeye daha fazla katkı sağladıkları dikkate alınarak bu öğrencilere farklı ücret uygulanması amacıyla bu düzenleme yapılmış olup, düzenleme ile birlikte mesleki eğitim merkezine devam eden 9, 10 ve 11. sınıf öğrencilerine asgari ücretin net tutarının en az yüzde otuzu, 12. sınıf öğrencilerine ise asgari ücretin net tutarının en az yüzde ellisi ödenmesi sağlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.01.2022
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-06.01.2022
Sayın Üyemiz, Ocak2022ayı TMO satışfiyatlistesininbuğday,arpavemısırürünlerineilişkinbölümüektegönderildiğişekilderevizeedilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.01.2022
Covid-19 Kapsamında Mikro ve Küçük İşletmelere Hızlı Destek Programı
Sayın Üyemiz, 2021 yılında KOSGEB tarafından, Covid-19 salgınından etkilenen Mikro ve Küçük İşletmelere (MKİ) yönelik olarak, Dünya Bankası ve Japonya Uluslararası İşbirliği Ajansı - JICA işbirliğinde "Mikro ve Küçük İşletmelere Hızlı Destek Projesi" başlatılmıştır. Projenin amacı; imalat ve bunun tamamlayıcısı olan öncelikli sektörler ile Covid-19 salgını etkilerinin nispeten yoğun olduğu diğer sektörlerdeki MKİ lerin faaliyetlerini sürdürmelerinin ve geçmiş dönem ortalama istihdam seviyelerini koruyarak yeni personel istihdam etmelerinin sağlanmasıdır. Geçen yıl uygulanan "Covid-19 Kapsamında Mikro ve Küçük İşletmelere Hızlı Destek Programı" bu yıl bazı değişiklikler ile tekrar başvuruya açılmıştır. KOSGEB tarafından hazırlanan "Mikro ve Küçük İşletmelere Hızlı Destek Programı" ile; imalat, bilgisayar programlama, bilimsel Ar-Ge sektörleri ve Covid-19 salgınının nispeten daha fazla etkilediği bazı hizmet ve ticaret sektörlerindeki MKİ ler ve yenilikçi genç işletmelere faizsiz ve teminatsız geri ödemeli işletme sermayesi desteği sağlanacaktır. Programın bu yılki uygulamasına ilişkin kısa tanıtım metni ve görsel tanıtım materyali ekte yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.01.2022
KOSGEB, Faizsiz ve Teminatsız Geri Ödemeli Destek Kredisi
Sayın Üyemiz, Covid-19 salgını kapsamında mikro ve küçük işletmelere KOSGEB tarafından istihdam performansına dayalı faizsiz ve teminatsız geri ödemeli destek verilecektir. Son başvuru tarihi:31 Mart 2022 Desteğin amacı: KOSGEB Mikro ve Küçük İşletmelere (MKİ) Hızlı Destek Programının amacı; MKİ’lerin salgın şartlarında faaliyetlerini sürdürmelerinin ve geçmiş dönem ortalama istihdam seviyelerini koruyarak yeni personel istihdam etmelerinin sağlanmasıdır. Destek kapsamı: İmalat, bilgisayar programlama, bilimsel Ar-Ge sektörleri ile Covid-19 salgınının nispeten daha fazla etkilediği bazı hizmet ve ticaret sektörlerindeki MKİ’lere: - 1981 ve sonrası doğumlu, son 3 yılda 180 günden fazla çalışmamış üniversite veya mesleki ya da teknik lise mezunu en az bir yeni personelin “12 ay boyunca istihdam edilmesi taahhüdü”, - “Başvuru dönemi ilanından önceki 12 aylık ortalama istihdamın korunması” şartı ile; yeni istihdam edilecek personel başına 100 Bin TL geri ödemeli destekverilecektir. İşletme sahibi kadın ise veya işe alınan personel kadın ise, destek personel başına 10 Bin TL artırımlı olarak uygulanacaktır. Başvuru dönemi ilan tarihinden önceki ayda işletmede çalışmıyor olan personel “yeni” kabul edilecektir.Mikroişletmeler en fazla2personel,küçükişletmeler en fazla5personel için destek alabilecektir. Destek kapsamında istihdam taahhüdünde bulunulan personelin işten ayrılması/değiştirilmesi durumunda, şartlara uygun yeni bir personel istihdam edilebilecektir. Programının önceki başvuru dönemlerinden yararlananlar, yeni başvuru dönemi şartlarını karşılamak kaydıyla bu dönemde de programa başvuru yapabilecektir. Başvuru şartları: - Destekten yararlanabilecek MKİ’lerinsektörleri;Program Bilgilendirme Sayfasında yayınlanmaktadır. - Covid-19 salgınından önce de aktif olduğu kabul edilen MKİ ler başvuru yapabilecektir. 2019 yılında asgari 75.000 TL net satış hasılatı elde edilmiş olması, salgından önce aktif işletme olmanın kanıtı sayılacaktır. Bu kriter 2017 ve sonrasında kurulan yenilikçi genç işletmelerde aranmayacaktır. Destek kapsamında yeni istihdam edilebilecek personelde aranan şartlar: - Üniversite (2 yıllık ve üstü) ya da mesleki ve/veya teknik lise mezunu olmalıdır. - Başvuru döneminin ilan edildiği aydan önceki ayda MKİ’de çalışmıyor olmalıdır. - Başvuru döneminin ilan edildiği aydan itibaren son 3 yıl içinde toplam SGK 4A’lı prim günü sayısı 180’den fazla olmamalıdır. - 1981 ve sonrası doğumlu olmalıdır. - Yabancı uyruklu personel istihdam edilemez. Başvuru yeri: - Başvuru kriterlerini karşılayan mikro ve küçük işletmelerwww.kosgeb.gov.tradresindeki “E-Hizmetler” menüsünden “Mikro ve Küçük İşletmelere Hızlı Destek Programı Başvurusu” alt menüsünü seçerek online başvuru yapabilecektir. KOSGEB Veritabanına kayıtlı olmayan veya KOBİ Bilgi Beyannamesi güncel olmayan işletmeler, önce kayıt ve güncelleme işlemini yapmalıdır. - Program başvuruları31 Mart 2022’ye kadar yapılabilecektir. Program başvurusuna geçici onay verilen işletmelerin, istihdam edilen personel için ödeme talebi yapabilecekleri son tarih25 Mayıs 2022’dir. Geri ödeme: Geçmiş dönem ortalama istihdam seviyelerini koruyarak yeni personel istihdam etme taahhütlerini yerine getirmiş olmak kaydı ile; MKİ’ler kullandıkları desteği 24 ay geri ödemesiz dönemi takiben 4’er aylık 6 taksitte faizsiz ve komisyonsuz olarak KOSGEB’e geri ödeyecektir. Program hakkında bilgi almak içintıklayınız. Programa başvurmak içintıklayınız. Bilgilendirici video içintıklayınız.
6.01.2022
TOBB Sektör Meclisleri Enerji Verimliliği Paneli
Sayın Üyemiz, “Malumları olduğu üzere, dünya ticareti Avrupa Yeşil Mutabakatı kapsamında şekillenmektedir. Sınırda karbon vergisi düzenlemesi de öngören Mutabakat, başta enerji sektörü olmak üzere pek çok sektörü derinden etkileyecektir. Diğer yandan bahse konu doküman çerçevesinde; binalar, yenilenebilir enerji, elektrikli araçlar gibi pek çok alanda sürdürülebilir politikalar oluşturulması ve yeni teşvik düzenlemeleri getirilmesi planlanmaktadır. Birliğimiz, yeşil mutabakat sürecini yakından takip etmekte, sektörel görüşlerin kamu ile paylaşılması, sanayinin bilgilendirilmesi ve ihtiyaç duyulan eğitimlerin verilmesi başta olmak üzere çeşitli faaliyetlerle sürece katkı sağlamaktadır. Yeşil dönüşümle birlikte, enerji verimliliğine yönelik çalışmaların daha fazla önem kazandığı bu dönemde Birliğimiz Enerji ve Tabii Kaynaklar Bakanlığı ile işbirliği içerisinde faaliyetlerini yürütmektedir. Ulusal Enerji Verimliliği Eylem Planı İzleme ve Yönlendirme Kurulu nda özel sektörü temsilen yer alan Birliğimiz, Enerji Verimliliği Haftasında "TOBB Sektör Meclisleri Enerji Verimliliği Paneli" düzenlenmektedir. 13 Ocak 2022 tarihinde Enerji Verimliliği Finansmanı ve Sanayide Enerji Verimliliği başlıklarında 2 oturum olarak düzenlenecektir. İlgilenen üyelerimiz panelehttps://webinar.tobb.org.tradresinden erişilebilir.” Gültekin Güler Genel Sekreter
6.01.2022
Yer Tahsis Belgeleri Hk.
Sayın Üyemiz, Birliğimize son zamanlarda düzenleyici firmalardan, fuar düzenleme başvurularında, fuar alanı sahibi ya da işletmecisince düzenleyici firma yerine başka firma adına düzenlemiş ve sonrasında düzenleyici firmaya sözleşme ile devredilmiş yer tahsis belgelerinin kabul edilmesi yönünde talepler iletilmektedir. Bugüne kadar uygulandığı üzere, bundan sonra da fuar alanı sahibi ya da işletmecisince doğrudan fuar düzenleyicisi firma adına düzenlenmiş yer tahsis belgelerinin geçerli kabul edilmesi uygulamasına devam edilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.01.2022
2022 Ocak Satış Talimatı Duyurusu
Sayın Üyemiz, TMO Genel Müdürlüğü 2022 yılı Ocak ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve Sözleşme Bazında)" konulu satış duyurusu ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.01.2022
Mesleki Eğitim Merkezi Diploma Telafi Programı
Sayın Üyemiz, TOBB dan Borsamıza iletilen yazıda; Milli Eğitim Bakanlığı Mesleki ve Teknik Eğitim Genel Müdürlüğü tarafından Birliğimize iletilen 22.12.2021 tarih ve 39613454 sayılı "Kayıt Süresinin Uzatılması" konululu resmi yazı ekte dikkatinize sunulmuştur. Söz konusu yazıda Mesleki Eğitim Merkezi Diploma Telafi Programı na son kayıt tarihinin 31 Aralık 2021 mesai bitimi olacak şekilde uzatıldığı bilgisi iletilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.12.2021
Çin Gümrükler Genel İdaresi Gıda Üreticileri Kayıt Sistemi
Sayın Üyemiz, TOBB dan Borsamıza gelen yazıda; Çin e gıda ürünü ihraç edecek firmaların kayıt altına alınmalarına ilişkin248 ve 249 sayılı Çin Gümrükler Genel İdaresi (GACC) tarafından yapılan düzenlemelerin, 1 Ocak 2022tarihinden itibaren yürürlüğe gireceği belirtilmiştir. Yazıda, gıda ürünü üreterek Çin e ihracat yapan ihracatçılarımızın kimi art niyetli danışmanlık firmalarıncakayıt sistemine ilişkin yanlış yönlendirildiği bildirilerek, yazıda detayları yer aldığı şekliyle danışmanlıkhizmeti almalarına gerek olmadan sisteme kaydolabileceği vurgulanmıştır. Yazıda devamla, GACC sistemine kayıt prosedürüne dair bilgiler içeren ve ekte bir örneği sunulan kayıtkılavuzunun da Ticaret Bakanlığınca hazırlandığı belirtilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.12.2021
1. WE-CYCLE Çevre ve Geri Dönüşüm Teknolojileri Fuarı Hk.
Sayın Üyemiz, 12 - 14 Mayıs 2022 tarihleri arasında İzmir Fuar Alanı Fuar İzmir de Ege Bölgesi Sanayi Odası ve İzmir Ticaret Odası destekleri ile 1.WE-CYCLE Çevre ve Geri dönüşüm Teknolojileri Fuarı" düzenlenmesiplanlanmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.12.2021
23. Mostar Uluslararası Ekonomi Fuarı
Sayın Üyemiz, Macaristan ın paydaş ülke olarak katılımıyla, 5-9 Nisan 2022 tarihlerinde düzenlenecek 23. MostarUluslararası Ekonomi Fuarı ile ilgili bilgi verilmekte olup, söz konusu Fuarın katılım formu ekte iletilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.12.2021
25. Tüketici Ödülleri İlanı
Sayın Üyemiz, Tüketici bilincini geliştirmek ve bu yönde hak arama alışkanlıklarını yaygınlaştırmak, tüketici haklarına saygılı kişi, kurum ve kuruluşları teşvik etmek, tüketicinin korunması ve bilinçlendirilmesi ile ilgili bilimsel çalışmaları özendirmek amacıyla, “Bilinçli Tüketici Ödülü”, “Yazılı Basın Tüketici Ödülü”, “Radyo-Televizyon Programı Ödülü”, “Tüketici Memnuniyetini İlke Edinen Firma Ödülü”, “Bilimsel Çalışma Ödülü” ve “Tüketici Özel Ödülü” dallarında her yıl hak sahiplerine verilen Tüketici Ödülleri’nin bu yıl 25 incisi verilecektir. 2021 yılı faaliyetlerine göre verilecek olan “25. Tüketici Ödülleri” ilanı ekte yer almaktadır. Ayrıca ilan metni Bakanlığımız web sitesi “www.ticaret.gov.tr”,tuketici.ticaret.gov.tr/ isimli internet sitelerimizde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.12.2021
ABD Vizesi Hk.
Sayın Üyemiz, COVID-19 salgınının, tüm dünyadaki büyükelçiliklerin ve konsoloslukların rutin vize hizmetlerine devam edebilme kapasitelerini etkilemekte olduğu, vize süreçlerinde sıkıntılar yaşandığı ve vize alma süreçlerinin yavaş ilerlediği belirtilmektedir. Bu kapsamda, özellikle ABD Ankara Büyükelçiliği ve ülkemizde bulunan ABD Konsolosluklarınca bir süredir vize işlemlerinin uzaktan yürütülmesi ve çalışılan personelin sayısında yaşanan azalmaların da etkisiyle randevu saatlerinin daha az olacak şekilde düzenlendiği, vize işlemlerinin yavaşlatıldığı, vize randevularının ileri bir tarihe (bazı durumlarda 8-10 ay) verildiği bildirilmektedir. Ayrıca, özellikle fuar katılımları/ziyaretleri kapsamında Odalarımızdan, Ticaret Bakanlığı na iletilen yazılarda ABD Ankara Büyükelçiliği ve ülkemizde bulunan ABD Konsolosluklarınca verilen randevu tarihlerinin öne çekilmesi ile ilgili olarak Ticaret Bakanlığı tarafından girişimlerde bulunulmasının talep edildiği ifade edilmektedir. Söz konusu problemin aşılabilmesini teminen Dışişleri Bakanlığı na taleplerin iletildiği, Dışişleri Bakanlığı ndan 13 Aralık 2021 tarihinde alınan cevabi e-posta mesajında, ABD nin İstanbul Başkonsolosluğu ndan alınan bilgiye atıfla Başkonsolosluğun hızlandırılmış bir randevu sağlayamayacağının belirtildiği eğer başvuru sahipleri çevrimiçi sistem üzerinden resmi olarak acil bir randevu talep ederlerse, başvuru sahiplerinin seyahatin amacı ve etkisi hakkında daha fazla destekleyici bilgi verme fırsatına sahip olacakları bildirilmektedir. Bu itibarla, vize taleplerine ilişkin başvuru sahiplerinin ABD nin İstanbul Başkonsolosluğu na çevrimiçi sistem üzerinden yukarıda bahsedildiği şekilde başvuru yapmalarında fayda görüldüğü ifade edilmektedir. Bilgilerinize sunarız. Genel Sekreter Gültekin Güler
24.12.2021
Turk Yatırım Bankası Sh.A
Sayın Üyemiz, Türk Ticaret Kanunu nda yer alan yükümlülük ve sınırlamaların Kosova mevzuatında icra kabiliyetinin bulunmaması nedeniyle çeşitli kişi ve kuruluşların Kosova da banka unvanı ile şirket açtıkları; Kosova Merkez Bankasından aldıkları herhangi bir bankacılık yetkileri olmamasına rağmen Türkiye de bu şirketlerin şubeleri gibi hareket ederek piyasaya çek, teminat mektubu vb. sundukları belirtilmektedir. Yazıda devamla, konuyla ilgili olarak en son, T.C. Priştine Büyükelçiliği üzerinden bir vatandaşımızın "Turk Yatirim Bankasi SH.A." hakkında bilgi talep ettiği bildirilmektedir. Konu araştırıldığında, anılan şirketin sadece şirket kaydının olduğu ve Kosova Merkez Bankası nın https://bqk-kos.org/financial-supervision2/licensing-of-financial-institutions/list-of-licensed-financial-institutions-2/?lang=en bağlantı adresinde belirttiği banka ya da finans kuruluşları arasında bulunmadığı bilgisine ulaşıldığı belirtilmektedir. Turk Yatirim Bankasi SH.A. nin Kosova Şirket Kayıt Ajansının internet sitesinden edinilen bahse konu kayıt örneği ekte sunulmaktadır. Bu çerçevede, bilgilerinizi ve Kosova da faaliyet gösteren banka ve finans kuruluşlarının yalnızca Kosova Merkez Bankası nın bahse konu listesinden teyit edilmesi hususunu bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
22.12.2021
Kamu Kurum ve Kuruluşları Tarafından Yapılan Tarımsal Destek Ödemeleri Üzerinden Kesilen Gelir Vergisinin İadesi
Sayın Üyemiz, Kamu Kurum ve Kuruluşları Tarafından Yapılan Tarımsal DestekÖdemeleri Üzerinden Kesilen Gelir Vergisinin İadesine ilişkin resmi gazetede yayımlanan tebliğe ulaşmak için tıklayınız. Detaylar ilgili linkte yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
10.12.2021
İLAN VE BEYANNAME KABULÜ
Sayın Üyemiz, 3516 sayılı Ölçüler ve Ayar kanunu ile bağlı yönetmelik hükümlerince, ölçü ve tartı aletlerinin 2022 yılı muayene ve damga işlemleri yapılacaktır. 2020 yılı ve öncesine ait, iki senelik damga süresini doldurmuş ölçü ve tartı aletlerinin 2022 yılı muayene ve damfa işlemlerinin yapılması için 03 Ocak 2022 tarihinden başlayarak 2022 yılı şubat ayının son gününe kadar Kurtuluş kapalı pazar markette bulunan Eskişehir Büyükşehir Belediyesi Grup Merkezi Ölçüler ve Ayar Memurluğunca beyanname kanulü yapılacaktır. 2022 Şubat ayının son gününe kadar beyanname vermeyen ve iki senelik damga süresini geçiren ölçü ve tartı sahipleri, kişi ve kuruluşlar hakkında 3516 sayılı ölçüler ve ayar kanunu gereğince cezai işlem uygulanacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
10.12.2021
BİTKİSEL ÜRETİME DESTEKLEME ÖDEMESİ YAPILMASINA DAİR TEBLİĞ
Sayın Üyemiz, 8 Aralık 2021 tarih ve 31683 sayılı Resmi Gazetede yayımlanan Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğe ulaşmak içintıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
8.12.2021
Sebze ve Meyve Soğuk Zincir Finansal Kiralama Destek Programı Bilgilendirme Semineri
Sayın Üyemiz, KOSGEB Sebze ve Meyve Soğuk Zincir Finansal Kiralama Destek Programı Bilgilendirme Semineri, 9 Aralık 2021 Perşembe günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. KOSGEB ve TOBB iş birliğinde gerçekleştirilecek olan seminerde sebze ve meyve taşıma sırasında oluşan zayiatı azaltmak amacıyla hayata geçirilen ve KOBİ lerin leasing yöntemiyle edinecekleri yerli malı ve yeni frigorifik kasa ve ünitelerine 750 bin TL ye kadar destek sağlayan KOSGEB Sebze ve Meyve Soğuk Zinciri Finansal Kiralama Destek Programı anlatılacak olup, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.12.2021
HAYVANCILIK DESTEKLEMELERİ UYGULAMA TEBLİĞİ (TEBLİĞ NO: 2021/43)
Sayın Üyemiz, 7 Aralık 2021 tarih ve 31682 sayılı Resmi gazetede yayımnlanan Hayvancılık Desteklemeleri Uygulama Tebliği ne ulaşmak için tıklayınız. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.12.2021
İhale Uygulama Yönetmelikleri Değişikliği
Sayın Üyemiz, 30.11.2021 tarihli ve 31675 sayılı Resmi Gazete de Kamu İhale Kurumu tarafından aşağıda adları geçen yönetmelikler yayımlanmıştır.  Elektronik İhale Uygulama Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik  Hizmet Alımı İhaleleri Uygulama Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik  Mal Alımı İhaleleri Uygulama Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik  Yapım İşleri İhaleleri Uygulama Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik Yayımlanan yönetmeliklerdeki değişikliklere dair bilgi notu ekte yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.12.2021
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-04.12.2021
Sayın üyemiz, TMO 2021 yılı Aralık ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve Sözleşme Bazında)" konulu satış duyurusu ve ekleri duyurulmuştu. TMO tarafından ekte yer alan (Ek-1/C) ELÜS ekmeklik buğday stok listesi güncellenmiş olup yeni stok listesi dikkate alınacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.12.2021
Kırsal kalkınma yatırımlarında süre uzatıldı
Sayın Üyemiz, Kırsal kalkınma destekleri kapsamında yatırımların tamamlanma tarihi 1 Temmuz 2022 ye uzatıldı. Kırsal kalkınma destekleri kapsamında yatırım projelerinin tamamlanma tarihi, sözleşmesinin imzalandığı takvim yılının kasım ayının son gününden 1 Temmuz 2022 ye uzatıldı. Resmi Gazete nin bugünkü sayısında yayımlanan kırsal kalkınma destekleri kapsamında tarıma dayalı ekonomik yatırımların desteklenmesi hakkında 2020/4 ve 2020/5 sayılı tebliğlerle, tebliğlere eklenen geçici maddelere göre, 2020-2021 başvuru dönemindeki yatırım projelerinin fiziki olarak son tamamlanma tarihi 1 Temmuz 2022 olarak belirlendi. Bu tarih itibarıyla fiziki olarak tamamlanamayan projelerin talep edilmesi ve uygun görülmesi halinde, yatırımcıların kendi kaynakları ile 60 günü aşmamak üzere verilecek süre içinde fiziki olarak tamamlanması öngörülüyor. Geçici maddelere göre ayrıca, 1 Temmuz 2022 tarihinde fiziki gerçekleşmeleri tamamlanmış ancak yasal izinleri alınamamış yatırımlar için ise yatırımcının başvurması halinde yasal izinleri alabilmesi için yatırımcıya 60 günü aşmamak üzere süre verilecek. Tebliğle yapılan düzenlemeye göre, kırsal kalkınma destekleri kapsamında hibe başvurusunun reddedilmesi gerekçeleri arasında yer alan "kapasite artırımı, teknoloji yenileme veya modernizasyon için hibe başvurusunda" sera, çelik silo ve soğuk hava depolarında yenilenebilir enerji üretim tesislerine muafiyet getiren kriter, sadece çelik siloları kapsayacak şekilde daraltıldı. Resmi Gazetedeki ayrıntılar için tıklayınız:Tebliğ-1Tebliğ-2 Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.12.2021
Burkina Faso III. Uluslararası Pamuk ve Tekstil Fuarı
Sayın Üyemiz, TOBB dan bildirilen yazıda,"Burkina Faso 3. Uluslararası Pamuk ve Tekstil Fuarı" nın 27-28 Ocak 2022 tarihlerinde düzenlenmesinin öngörüldüğü bildirilmektedir. "Pamuğun Yerel Dönüşümü: Afrika Kıtasal Serbest Ticaret Bölgesi Çerçevesinde Afrika İçin Hangi Sanayileşme Modelleri" temasıyla gerçekleştirilmesi planlanan söz konusu fuara ülkemizden pamuk ve sanayi sektöründe faaliyet gösteren iş insanları davet edilmekte olup, ilgili doküman ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
Mozambik Petrol ve Doğalgaz Arama ve Üretim Alanları İçin 6. Lisanslama Turu
Sayın Üyemiz, TOBB dan bildirilen yazıda,Mozambik Ulusal Petrol Enstitüsü (Instituto Nacional de Petróleo-INP) nün, ülkedeki 16 adet bloktan oluşan petrol ve gaz arama ve üretim alanlarının imtiyazı için 6. Lisans Turunu 25.11.2021 tarihi itibarı ile ihale başlattığı bildirilmektedir. Bu kapsamda, imtiyaz ihalesine konu on altı yeni bloktan beşinin açık deniz Rovuma Havzasında, yedisinin Angoche de, ikisinin Zambezi Deltası nda ve ikisinin Save de yer adığı; ihaleye ilişkin ön yeterlilik aşamasının 25.11.2021-28.02.2022 tarihleri arasında gerçekleştirileceği belirtilmektedir. Yazıda devamda, bu aşamada, ihale ile ilgilenen şirketlerin kayıt yapmaya davet edildiği ve lisans turuna katılmak için ön yeterlilik almalarının gerektiği; INP tarafından uygun bulunan şirketlerin bir sonraki aşama olan lisans turuna katılabileceği kaydedilmekte, ihaleye konu dokümanlara ise https://mozambique6thround.com/ adresinden ulaşılabileceği bildirilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
Aralık Ayı Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO Eskişehir İl Müdürlüğünden gelen yazıda; Kurumumuz 2021 yılı Aralık ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve Sözleşme Bazında)" konulu satış duyurusu ve ekleri yazımız ekinde gönderilmiştir, Bilgisi yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
Tataristan firma temsilcileri ile ikili görüşmeler
Sayın Üyemiz, Tataristan Ticaret ve Sanayi Odası Başkan Yardımcısı Marat Ahmatov un başkanlığında iş insanlarından oluşan ve ekte listesi sunulan heyetin Türkiye ziyareti kapsamında 9 Aralık 2021 Perşembe günü 11:00-13:30 saatleri arasında TOBB İstanbul Hizmet Binasında İbrahim Çağlar Toplantı Odasında ev kimyasalları ve kozmetik, konut inşaatı ve yatırım, tekstil, gıda üretimi ve satışı, soğutma ekipmanları imalatı, elektronik tasarım ve üretim, otomobil bileşenleri üretimi, doğal kozmetik üretimi, sergi faaliyetleri ve nakliye hizmetleri alanlarında işbirliği yapmak isteyen Tataristanlı firmaları ile toplantı ve ikili görüşmeler gerçekleştirilecektir. Türkçe-Rusça tercüme hizmeti sunulacak olan toplantıya ve ikili görüşmelere katılmak isteyen Türk firma temsilcilerinin https://anket.tobb.org.tr/#/anket/tataristan-firmalari-ile-toplanti linkinde yer alan formu 7 Aralık 2021 tarihine kadar eksiksiz doldurması gerekmektedir. Anılan ikili görüşmelere katılım için 2 doz aşı (2. dozun üzerinden en az 15 gün geçmiş olması gerekmektedir) ya da son 48 saatte yapılmış negatif PCR testi ibraz edilmesi zorunludur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
AYM-SKDM Eğitim ve Danışmanlık
Sayın Üyemiz, Bildiğiniz üzere, Aralık 2019 tarihinde yayımlanan Avrupa Yeşil Mutabakatı Belgesi, Avrupa nın 2050 yılında ilk karbon-nötr kıta olması hedefiyle yola çıkan ve bütün sanayisini dönüştürmeyi gerektiren bir yeşil büyüme stratejisidir. Bu kapsamda AB, bütün politika metinlerini gözden geçirmektedir. Yapılan düzenlemeler arasında; İklim Kanunu, Yeni Sanayi Stratejisi, Çiftlikten Çatala Stratejisi, Sürdürülebilir Ürün İnisiyatifi gibi metinler bulunmaktadır. Söz konusu düzenlemelere ilişkin bilgi notları zaman zaman tarafınıza iletilmektedir. Avrupa Yeşil Mutabakatı kapsamında, uluslararası arenayı en çok etkileyecek düzenleme ise Sınırda Karbon Düzenleme Mekanizması (SKDM) olacaktır. Temmuz ayında açıklanan 55 e Uyum paketi ile detayları açıklanan SKDM ile ilk etapta çimento, demir-çelik, gübre, elektrik ve alüminyum sektörleri için AB ülkelerine yapılacak ihracata bir vergi yükü gelmesi beklenmekte olup; sektörlerimizin şimdiden hazırlıklarına başlaması elzemdir. Söz konusu mekanizma konusundaki genel bilgilendirmeler Birliğimiz tarafından 7 Eylül 2021 – 14 Ekim 2021 tarihleri arasındaki webinar serisiyle yapılmıştır. Bu kapsamda, gelinen noktada sektörlere SKDM kapsamındaki ürünlere yönelik detaylı eğitim ve danışmanlık hizmeti verilecek olup, ilk etapta aralık ayında fiziki olarak gübre ihracatı yapan firmalar için düzenlenecektir. Bu eğitim ve danışmanlık hizmetinin kontenjanı sınırlı olup, taslak program ekte sunulmaktadır. Eğitime katılmak ve detaylı bilgi almak isteyen bir üyelerimizin bilgilerini 8 Aralık 2021 tarihi mesai saati sonuna kadar ekteki forma işlenmek suretiyle Borsamıza yazılı olarak, ayrıca eskisehirtb@tobb.org.tr adresine elektronik ortamda gönderilmesini rica ederim. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
Irak-Ek Vergilere Son Verilmesi/Koruma Süresi
Sayın Üyemiz, TOBB dan bildirilen yazıda,Ekte bir örneği sunulan ilgi yazıda, elma, kuru soğan, üzüm, taze fasulye, kabak ve taze börülce cinsi ürünlerin Irak a ithalatındaki ek vergi uygulamasının sona erdiği açıklanmış ve mezkur ürünlerin söz konusu ülkeye ithalatındaki işlemlerle ilgili bilgi verilmiştir. Yazıda devamla, taze sofralık patates ürünü üzerindeki koruma süresinin de 15 Aralık 2021 tarihine kadar uzatıldığı belirtilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
TÜRKSMD Bilgilendirme Semineri
Sayın Üyemiz, TOBB dan bildirilen yazıda,Birliğimiz, Türk Patent ve Marka Kurumu ve Türk Sinai Mülkiyet Değerleme Mühendislik ve Danışmanlık Hizmetleri A.Ş. (TÜRKSMD) işbirliğinde 7 Aralık 2021 Salı günü saat 14:00 te TÜRKSMD Bilgilendirme Semineri gerçekleştirilecektir. Söz konusu seminerde Türk Patent ve Marka Kurumu nun bir iştiraki olarak kurulan sınai mülkiyet (marka, patent, faydalı model) haklarıyla ilgili ön araştırma, değerleme ve danışmanlık hizmetleri veren TÜRKSMD nin faaliyetleri anlatılacak, webinar sonunda ise katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
Her Yöneticinin Bilmesi Gereken Finansal Bilgiler Eğitimi
Sayın Üyemiz, TOBB dan bildirilen yazıda,Şirket sahibi ve yöneticileri, şirketlerin finans müdürleri (CFO) ve finans alanında genel ilke ve bilgileri öğrenmek isteyenlere yönelik olarak internet üzerinden "Her Yöneticinin Bilmesi Gereken Finansal Bilgiler Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. Bu eğitimde, finansal yönetim ışığında, finans yöneticisinin amacı (değer maksimizasyonu) ve görevleri olan finansal analiz, finansal planlama ve denetim, fonların sağlanması, fonların yatırımı ve özel finansal sorunların çözümü konuları anlatılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
Ticaret Müşavirlerimizle Elektronik Sohbetler- Zambiya ve Kongo D.C
Sayın Üyemiz, TOBB dan bildirilen yazıda,30 Kasım 2021 Salı günü 14.00-15.30 saatleri arasında Zambiya da görev yapmakta olan Ticaret Müşavirimiz ve 2 Aralık 2021 Perşembe günü 14.00-15.30 saatleri arasında Kongo Demokratik Cumhuriyeti nde görev yapmakta olan Ticaret Müşavirimiz ile bu ülkelerde iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantılarının gerçekleştirileceği bildirilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.12.2021
İş Yerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, Birliğimiz organizasyonunda, 1 Aralık 2021 Çarşamba günü saat 14:00 te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
25.11.2021
Stratejik Satınalma ve Kategori Yönetimi Semineri
Sayın Üyemiz, TOBB Stratejik Satınalma ve Kategori Yönetimi Semineri, 25 Kasım 2021 Perşembe günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; Stratejik Satınalma, Geleneksel Satınalma ve Stratejik Satınalma Farkları, Kategori Yönetimi ile Kategori Kapsamında Kuyruk Yönetimi konuları anlatılacak olup seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
23.11.2021
Hububat Satışları-Pancar Ekicileri Kooperatifi
Sayın Üyemiz, S.S. Eskişehir Pancar Ekicileri Kooepratifi hububat satış ihalelerine ilişkin ayrıntılar ektedir. Bilgilerinize sunarız. Saygılarımızla, Gültekin Güler Genel Sekreter
16.11.2021
PEŞİN HUBUBAT SATIŞLARI (GENEL VE SÖZLEŞME BAZINDA)-16.11.2021
Sayın Üyemiz, 2021 Kasım ayında un sektörüne yönelik olarak satışa açılan 416 bin ton buğday stokuna 100 bin ton daha ekmeklik buğday stoku eklenerek Kasım ayı için un sektörüne yönelik satışa açılan ekmeklik buğday stoku 516 bin tona yükseltilmiştir. Un fabrikalarının vereceği un taahhüt fiyatları ve buna bağlı olarak yapılacak tahsis miktarları satışa açılan stoklarla sınırlı olmak kaydıyla aşağıdaki şekilde değiştirilmiştir. Kasım ayı un taahhüt fiyatlarına göre; 185 TL ve altında fiyat verenlere aylık fiili tüketimlerinin % 60 ına kadar, 186-190 TL aralığında fiyat verenlere aylık fiili tüketimlerinin % 50 sinekadar, 191-195 TL aralığında fiyat verenlere aylık fiili tüketimlerinin % 40 ına kadar, 196-200 TL aralığında fiyat verenlere aylık fiili tüketimlerinin % 20 sine kadar tahsis yapılacaktır. 200 TL nin üzerinde fiyat verenlere tahsis yapılmayacaktır. TMO Elektronik Satış Platformu üzerinden PEŞİN un taahhüt fiyatı vermeyen ve Kasım ayı ekmeklik un fiyatını 200 TL/Çuval ın üstünde taahhüt eden un fabrikalarına tahsis yapılmayacaktır. Firmalar satışa sundukları ekmeklik buğday unlarının tamamını azami olarak taahhüt ettikleri fiyatlardan satacaklardır. Arpa, buğday ve mısır satışlarımız için başvuru süresi uzatılarak 18.11.2021(dahil) tarihi olarak yeniden belirlenmiştir. Firmalar bu tarihe kadar yeni taahhüt girebilecek veya daha önce Kasım ayı için girdikleri taahhütlerini revize edebileceklerdir. Besici ve yetiştiricilere yapılan arpa teslimatlarında; besici-yetiştiricilerin 3. şahıslara ürünü teslim alması yönüyle verdiği vekaletname kabul edilmeyecek olup ürün teslimatı besici-yetiştiricinin kendisine ya da vekalet verdiği 1. ve 2. derece yakınlarına (çocuk, anne, baba, torun, kardeş, dede ve nine) yapılacaktır. Ayrıca ürün satışlarımızda tahsisat yapılan şahısların dışında, 1. ve 2. Derece yakınlarının bu şahısların adına yaptığı para transferleri de kabul edilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.11.2021
İşyeri Tehlike Sınıfları Komisyon Toplantısı Hazırlık Verileri
Sayın Üyemiz, 26/12/2012 tarihli ve 28509 sayılı Resmi Gazete de yayımlanan İş Sağlığı ve Güvenliğine İlişkin İşyeri Tehlike Sınıfları Tebliği gereğince Birliğimizin de üyesi bulunduğu iş sağlığı ve güvenliğine ilişkin işyeri tehlike sınıflarının belirlenmesinde görevli olan İşyeri Tehlike Sınıfları Komisyonu, "İşyeri Tehlike Sınıfına Yapılan İtirazların Değerlendirilmesi Prosedürü" çerçevesinde her yıl Ocak ayı içinde toplanarak çalışmalarını yürütmektedir. Anılan prosedür gereğince, işyeri tehlike sınıflarına ilişkin itiraz talepleri en geç Komisyon toplantısından 30 gün öncesine kadar bağlı oldukları üst işveren kuruluşları aracılığı ile Çalışma ve Sosyal Güvenlik Bakanlığı İş Sağlığı ve Güvenliği Genel Müdürlüğüne gönderilmektedir. http://www.mevzuat.gov.tr internet sitesinde yer alan "İş Sağlığı ve Güvenliğine İlişkin İşyeri Tehlike Sınıfları Tebliği" ekindeki İşyeri Tehlike Sınıfları Listesine ilişkin değişiklik taleplerinin İşyeri Tehlike Sınıfına Yapılan İtirazların Değerlendirilmesi Prosedürüne uygun doldurulmuş Tehlike Sınıfı Değişikliğine İlişkin Başvuru Formu ile Borsamız vasıtasıyla Birliğimize iletilmesi gerekmektedir. İşyeri Tehlike Sınıfına Yapılan İtirazların Değerlendirilmesi Prosedürüne ve Tehlike Sınıfı Değişikliğine İlişkin Başvuru Formuna www.tobb.org.tr/MaliveSosyalPolitikalar/Sayfalar/AnaSayfa.phpadresinden ulaşılabilmektedir. Bilgilerinizi ve varsa taleplerinizin en geç 29 Kasım 2021 tarihine kadar yazılı olarak Borsamıza, elektronik ortamda word belgesi olarak egemenakbulut@esktb.org.tr e-posta adresine ulaştırılması hususunda gereğini rica ederiz. Gültekin Güler Genel Sekreter
16.11.2021
TİGEM 100 Baş Reforme Sığır Satış İhalesi Yapılacak
Sayın Üyemiz, TİGEM stoklarında bulunan 100 baş reforme sığır satış ihalesi yapılacağını duyurdu. Ayrıntılar içintıklayınız. Bilgilerinize sunarız. Saygılarımızla, Gültekin Güler Genel Sekreter
15.11.2021
TİGEM 1.210 Ton Mahsul Buğday Satış İhalesi Yapılacak
Sayın Üyemiz, TİGEM stoklarında bulunan1.210 ton mahsul buğday satış ihalesi yapılacağını duyurdu. Ayrıntılar için tıklayınız. Bilgilerinize sunarız. Saygılarımızla, Gültekin Güler Genel Sekreter
15.11.2021
ESKİŞEHİR – BELARUS GRODNO DELEGASYONU TARIM ve GIDA SEKTÖRLERİ TOPLANTISI ve B2B İKİLİ İŞ GÖRÜŞMELERİ ORGANİZASYONU
Sayın Üyemiz, Borsamız ev sahipliğinde 19 Kasım 2021, Cuma günü 09.00 – 11.00 saatleri arasında, isimleri ve faaliyet alanları ekli listede yer alan Belarus Grodno Delegasyonu heyeti ile İlimiz tarım ve gıda sektörlerinin temsilcileri arasında toplantı ve ikili iş görüşmeleri gerçekleştirilecektir. Borsamızda fiziki olarak gerçekleştirilecek etkinliğe katılmak isteyen tarım ve gıda sektörlerinin temsilcileri 18 Kasım 2021, Perşembe günü saat 15.00’a kadar ekte yer alan katılım formunu doldurarak, Borsamızaeskisehirtb@tobb.org.tr veya 0222 237 94 50 no.lu faks numarasına iletmeleri gerekmektedir. Bilgilerinize sunarız. Saygılarımızla,
15.11.2021
Lisanslı Depolarda Muhafaza Edilen Ürünlere Yönelik Destekler Belli Oldu
Sayın Üyemiz, Tarım ve Orman Bakanlığınca, lisanslı depolarda muhafaza edilen ürünlere ödenecek kira, nakliye ve analiz desteklerinin tutarları belirlendi. Bakanlığın "Lisanslı Depolarda Muhafaza Edilen Tarımsal Ürünler İçin Destekleme Ödemesi Yapılması Hakkında Tebliği", Resmi Gazete de yayımlanarak yürürlüğe girdi. Buna göre, lisanslı depolarda muhafaza edilen buğday, arpa, çavdar, yulaf, mısır, çeltik, pirinç, mercimek, nohut, fasulye, ayçiçeği, soya fasulyesi, pamuk, fındık, kuru kayısı, Antep fıstığı, kuru üzüm, zeytin ve zeytinyağı ürünleri için Çiftçi Kayıt Sistemi ne (ÇKS) ve Tarımsal Üretim Kayıt Sistemi (TÜKAS) kayıtlı üretici ve üretici örgütlerine kira, nakliye, analiz ücreti destekleme ödemesi yapılacak. Buğday, arpa, çavdar, yulaf, mısır, çeltik ve pirinç için aylık ton başına 6 lira kira, 25 er lira nakliye ve analiz desteği; mercimek, nohut, fasulye ve soya fasulyesi için 8 lira kira 25 er lira nakliye ve analiz desteği; ayçiçeği için 10 lira kira, 25 er lira nakliye ve analiz desteği; pamuk için 25 lira kira, 25 lira nakliye, 12 lira analiz desteği; fındık için 15 lira kira, 100 lira nakliye 10 lira analiz desteği; Antep fıstığı için 30 lira kira, 100 lira nakliye, 25 lira analiz desteği; kuru kayısı ve kuru üzüm için 30 lira kira, 100 lira nakliye, 50 lira analiz desteği; zeytin ve zeytinyağı için 15 lira kira, 25 lira nakliye, 15 lira analiz desteği verilecek. Kira desteğinden yararlanan üretici ve üretici örgütlerine, başvuru yapmaları durumunda, ürün miktarı üzerinden her ürün çeşidi için belirtilen miktarlarda ve üst tonaj sınırı aşılmamak kaydıyla nakliye desteği sağlanacak. Ayrıntılar için tıklayınız: Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
15.11.2021
MWC Barcelona 2022
Sayın Üyemiz, Dünyanın en önemli mobil teknoloji fuarları arasında yer alan Mobile World Congress Barcelona Fuarının, İspanya nın Barselona şehrinde 28 Şubat – 3 Mart 2022 tarihleri arasında gerçekleştirileceği, anılan fuarın Türkiye milli katılım organizasyonunun İstanbul Ticaret Odası tarafından düzenleneceği belirtilmektedir. Yazıda devamla, bahse konu fuarda, 5. Nesil Mobil Teknolojisi (5G), İleri Yapay Zeka (AI), Her Şeyin İnterneti (IoE), Teknolojinin Ufku (Tech Hoziron) ve Finans Teknolojileri (Fintech) konularına yer verileceği ifade edilmektedir. MWC Barcelona 2022 Türkiye milli iştirakine ilişkin duyuru metni, sözleşme ve irtibat bilgileri ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
12.11.2021
Birleşik Krallık a İhracatta Karşılaşılan İhracat Engellerinin İhracat Performansı Üzerindeki Etkisi Üzerine Yürütülen Anket Çalışması Hk.
Sayın üyemiz, Daha önceden yapılan duyurularımızda, Birleşik Krallık a ihracat yapan firmaların, ihracatta karşılaştığı engellerin ihracat performansı ile arasındaki ilişkinin bir anket çalışması ile ortaya konulmasının amaçlandığı ifade edilerek, ankete ilişkin bilgilendirme yapılmıştı. İlgili anket çalışmasının tamamlanma süresinin 22 Kasım 2021 tarihine kadar uzatıldığı bildirilmiştir. E-postada devamla, ihracatımızın yoğun olduğu makine, elektrikli makine, beyaz eşya ve kablo sektörlerinde ankete katılımın yeterli bulunmadığı ifade edilmiştir. Bu itibarla, https://anketler.ticaret.gov.tr/index.cfm?ID=95 uzantısından erişilebilecek anket çalışmasına katılımın artırılması amacıyla destekleriniz rica ederiz. Gültekin Güler Genel Sekreter
12.11.2021
800 Gr lık Konserve Satışı
Sayın üyemiz, Et ve Süt Kurumu stoklarında bulunan 1.810.697 adet 800 Gr. lık kıyma konserve ile 807.119 adet 800 Gr lık kuşbaşı konservenin teklif toplama usulu ile satışı yapılacaktır.Adet/birim fiyat teklifleri hepsi için yada şartnamede belirtilen her bir grup için de verilebilecektir. Teklif veren alıcılar fiyat verdikleri ürünün toplamının % 3 (3) ü kadar en üç ay süreli geçici teminat vereceklerdir.Fiyat teklifleri uygun bulunan alıcı/alıcılar sözleşme için toplam mal tutarının % 6 (altı) sı kadar nakit teminat yada en az altı ay süreli kesin teminat mektubu vereceklerdir. Teklif fiyatları uygun bulunmayan alıcıların geçici teminatları iade edilecektir. Talep edilmesi halinde söz konusu ürünler iligili işyeri depolarından görülebilecek ve bedeli ödenmek üzere numune alınabilcektir. Şartnamede istenen belgeler ile birlikte en geç 30.11.2021 günü saat : 14:00 a kadar kapalı zarf içinde Et ve Süt Kurumu Genel Müdürlüğü İşçi Blokları Mah.Muhsin YAZICIOĞLU Cad. No:51/B 06350 YÜZÜNCÜ YIL/ÇANKAYA/ANKARA adresine fiyat teklifi verilecektir. Konu ile ilgili bilgi için Et ve Süt Kurumu Genel Müdürlüğü nün 0312 284 36 70 nolu yada Sincan Et Kombinası nın 0312 270 19 32 telefon numarasından irtibat kurulabilir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
12.11.2021
Girişimciler için AB Projeleri Fırsatları Online Toplantısı | 12 Kasım 2021 Cuma - Saat 14:30 (İnternet Üzerinden)
Değerli Üyemiz, Avrupa Birliği tarafından girişimcilere ve KOBİ’lere sağlanan destekleri anlatmak ve bu kapsamda ülkemizin AB desteklerinden daha fazla faydalanması sağlamak amacıyla 12 Kasım 2021 Cuma günü saat 14:30’da internet üzerinden “Girişimciler için AB Projeleri Fırsatları Online Toplantısı” gerçekleştirilecektir. Dışişleri Bakan Yardımcısı ve AB Başkanı Büyükelçi Faruk Kaymakcı, Türkiye Odalar ve Borsalar Birliği (TOBB) Yönetim Kurulu Üyesi Cengiz Günay, KOSGEB Başkanı Hasan Basri Kurt, Tarım ve Kırsal Kalkınmayı Destekleme Kurumu (TKDK) Başkanı Dr. Muhammed Adak, Türkiye Kadın Girişimcileri Derneği (KAGİDER) Başkanı Emine Erdem, Türk Girişim ve İş Dünyası Konfederasyonu (TÜRKONFED) Yönetim Kurulu Başkanı Orhan TURAN ve GEN Türkiye Yönetim Kurulu Başkanı Sn. Nevzat Aydın’ın katılımıyla gerçekleştirilecek olan toplantıda Rekabetçi Sektörler Programı destekleri, Tarım ve Kırsal Kalkınma Kapsamındaki girişimcilik destekleri, Ufuk Avrupa / Avrupa Yenilik Konseyi destekleri, Tek Pazar Programı kapsamında girişimcilik fırsatları konuları anlatılacak, toplantı sonunda katılımcıların soruları cevaplanacaktır. Toplantıya ilişkin program ekte sunulmaktadır. Toplantıya katılmak içinhttps://zoom.us/webinar/register/WN_ZDfrlcFJRDyk47_CiF5QsAadresinden kayıt olunması gerekmektedir. Toplantı linki ve şifresi kayıt olduktan sonra e-posta adresinize gönderilecektir. Bilgilerinizi ve toplantıya katılımınızı diler, ilgi ve alakanız için teşekkür ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
12.11.2021
2021 Yılında Yapılacak Tarımsal Desteklemeler ve 2022 Yılında Uygulanacak Gübre ve Sertifikalı Tohum Kullanım Desteklerine İlişkin Karar (Karar Sayısı: 4760)
Sayın Üyemiz, 2021 Yılında Yapılacak Tarımsal Desteklemeler ve 2022 Yılında Uygulanacak Gübre ve Sertifikalı Tohum Kullanım Desteklerine İlişkin Karar (Karar Sayısı: 4760)Resmi Gazetedeyayınlanarak yürürlüğe kondu. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.11.2021
Ticari Reklam ve Haksız Ticari Uygulamalar Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik Taslağı
Sayın Üyemiz, Ticari Reklam ve Haksız Ticari Uygulamalar Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik Taslağı ekte bilgilerinize sunulmuş olup, ilgili taslak hakkında varsa görüş ve önerilerinizin 11.11.2021 Perşembe günü saat 15.00 e kadar Borsamıza (egemenakbulut@esktb.org.tr) bildirmenizi rica ederiz. Gültekin Güler Genel Sekreter
10.11.2021
Cin Mısır Ürününe İlişkin Kalite Sınıflandırma Kriterleri
Sayın Üyemiz, Cin Mısır Ürününe İlişkin Kalite Sınıflandırma Kriterleri ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
9.11.2021
RF Başkortostan Cumhuriyeti İkili Görüşmeler
Sayın Üyemiz, Rusya Federasyonu ile Türkiye Cumhuriyeti arasındaki ticari ve ekonomik ilişkilerin gelişmesine katkı sağlamak ve Başkortostan ile Türk iş dünyası arasında doğrudan temas sağlamak amacıyla Rusya Federasyonu na bağlı olan Başkortostan Cumhuriyeti Lideri Radiy Habirov un kararıyla, 2020 yılının Eylül ayında, İstanbul da Başkortostan Daimi Temsilcilik Ofisi kurulmuştur. İlgi yazıda, Başkortostan Cumhuriyeti Dış Ekonomik İlişkiler Bakanlığı ve İhracat Merkezi desteğiyle, ekte yer alan Başkortostan iş heyetinin, Türk firmalarla ikili iş görüşmeleri yapmak üzere, 17 Kasım 2021 Çarşamba günü, 13:00-18:00 saatleri arasında İstanbul Polat Renaissance Bosphorous Otel (Beşiktaş) Balo Salonu bir etkinlik düzenleyeceği bildirilmektedir. Görüşmelerin kayıt formu forms.gle/8jDycgXEzCaVAPRi9linkinde yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
9.11.2021
Kırsal Kalkınma Hibe Desteği
Sayın Üyemiz, Bakanlığımız tarafından uygulanan Kırsal Kalkınma Destekleri Kapsamında Tarıma Dayalı Ekonomik Yatırımların Desteklenmesi Tebliği (2020/24 D.T. 2021/34) ve Kırsal Kalkınma Destekleri Kapsamında Kırsal Ekonomik Altyapı Yatırımlarının Desteklenmesi Tebliği (2020/25 D.T. 2021/35) 21.11.2020 tarih ve 31311 sayılı Resmi Gazetede yayımlanmıştır. Program kapsamındaki konulara ilişkin proje başvurusunda bulunmak isteyen gerçek ve tüzel kişiler başvurularınıwww.tarimorman.gov.tr internet adresinden yapacaklardır. Başvurular güncel uygulama rehberinin 31.10.2021 tarihinde yayımlanmış ve başvurular başlamıştır. Kırsal Ekonomik Altyapı Yatırımları başvuruları 17 Aralık 2021 tarihi saat 23.59 da, Tarıma Dayalı Ekonomik Yatırımlar başvuruları 21Ocak 2022 tarihi saat 23.59 da sona erecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
8.11.2021
Şirketlerde tasfiye sürecinin 6 aydan 3 aya indirilmesi
Sayın Üyemiz, 06.11.2021 tarihli Resmi gazetede yayınlanan 7341 sayılı TÜRKİYE İHRACATÇILAR MECLİSİ İLE İHRACATÇI BİRLİKLERİNİN KURULUŞ VE GÖREVLERİ HAKKINDA KANUN İLE BAZI KANUNLARDA DEĞİŞİKLİK YAPILMASINA DAİR KANUN un 17.maddesine göre şirketlerde tasfiye süreci 6 aydan 3 aya indirilmiştir. MADDE 17 –13/1/2011 tarihli ve 6102 sayılı Türk Ticaret Kanununun 543 üncü maddesinin ikinci fıkrasının birinci ve ikinci cümlelerinde yer alan “altı” ibareleri “üç” şeklinde değiştirilmiştir. Buna göre; 6102 saylı kanunun 543.maddesinin önceki hali; 4. Tasfiye sonucu dağıtma (1) Tasfiye hâlinde bulunan şirketin borçları ödendikten ve pay bedelleri geri verildikten sonra kalan varlığı, esas sözleşmede aksi kararlaştırılmamışsa pay sahipleri arasında, ödedikleri sermayeler ve imtiyaz hakları oranında dağıtılır. Tasfiye payında imtiyazın varlığı hâlinde esas sözleşmedeki düzenleme uygulanır. (2) Alacaklılara üçüncü kez yapılan çağrı tarihinden itibaren(Değişik ibare: 6728 S.K. m.68/c)"altı ay"geçmedikçe kalan varlık dağıtılamaz. Şu kadar ki, hâl ve duruma göre alacaklılar için bir tehlike mevcut olmadığı takdirde mahkeme(Değişik ibare: 6728 S.K. m.68/c)"altı ay"geçmeden de dağıtmaya izin verebilir. (3) Esas sözleşme ve genel kurul kararında aksine hüküm bulunmadıkça, dağıtma para olarak yapılır. Burada yer alan 6 ay ibaresi, 3 ay olarak değiştirilmiştir. Bilgilerinize sunulur. Gültekin GÜLER Genel Sekreter
8.11.2021
Devlet Yardımı İçin Asgari Yatırım Tutarı Yükseldi
Sayın Üyemiz, Yatırımlarda devlet yardımları hakkında karar kapsamında, yatırımların destek unsurlarından yararlanmasına esas asgari sabit yatırım tutarları sınırları artırıldı. Bu kapsamda, asgari sabit yatırım tutarı; 1 ve 2. bölgelerde 1 milyon TL den 3 milyon TL ye, 3, 4, 5 ve 6. bölgelerde ise 500,000 TL den 1.5 milyon TL ye çıkarıldı. Finansal kiralama yöntemiyle yapılacak yatırımlarda, finansal kiralamaya konu makine ve teçhizata ait toplam tutar sınırı, her bir finansal kiralama şirketi için 1, 2, 3 ve 4. bölgelerde asgari 500,000 TL den 750,000 TL ye, 5 ve 6. bölgelerde ise asgari 300,000 TL den 500,000 TL ye yükseltildi. Teşvik belgesi kapsamında yatırım harcaması olarak kabul edilen maddi olmayan duran varlıkların (marka, lisans, know-how vb.) oranının teşvik belgesinde kayıtlı toplam sabit yatırım tutarına olan oran sınırı ise yüzde 50 den yüzde 25 e indirildi. Resmi Gazete ayrıntıları için tıklayınız: ( 2. ,13. ve 14. maddeler 1.1.2022, diğer maddeler yayım tarihinde yürürlüğe girecektir.) Gültekin Güler Genel Sekreter
5.11.2021
Kırsal Kalkınma Yatırım Başvuruları Başladı
Sayın Üyemiz, Kırsal Kalkınma Yatırımlarının 2021-2022 Dönemi başvurularının alınmasına başlandı. Konuya ilişkin sosyal medya hesabı Twitter üzerinden açıklama yapan Tarım ve Orman Bakanı Bekir Pakdemirli, toplam 1,3 milyar lira yüzde 50 hibe desteği vermeyi planladıklarını bildirdi. Ekonomik yatırımlarda başvurunun 21 Ocak 2022 saat 23.59 da, kırsal alt yapı için ise başvurunun 17 Aralık 2021 saat 23.59 da sona ereceğini belirten Pakdemirli, şunları kaydetti: "Kırsal Kalkınma Yatırımlarının Desteklenmesi Programı kapsamında 74 ten fazla makine ve ekipman yüzde 50 hibe desteği ile çiftçilerimize can suyu olmaya devam edeceğiz. Bu dönem mevcut çiftçilerimizin makine-ekipman ihtiyaçlarının karşılanması için KKYDP 2021-2022 dönem başvuruları, Altyapı A İş Planı kapsamında 300 bin liraya kadar yüzde 50 hibe desteği için başvurular başlamıştır. 40 bin liraya kadar olan makine ve ekipmanlara öncelik verilecektir. Bu dönem ilk defa proje başvurularında asil ve yedek liste açıklanacak, böylece daha fazla proje hayata geçmiş olacaktır." Ayrıntılar için tıklayınız: Gültekin Güler Genel Sekreter
5.11.2021
TEŞVİK BELGESİNE BAŞVURACAKLARIN DİKKATİNE, ASGARİ YATIRIM TUTARI ŞARTLARI ARTTIRILDI
Sayın Üyemiz, Yatırımların Destek Unsurlarından Yararlanabilmesi İçin Asgari Sabit Yatırım Tutarları Arttırılmıştır. Buna Göre 2022 Yılından İtibaren Uygulanmak Üzere; * 1. ve 2. Bölgelerde 1 Milyon TL Olan Asgari Sabit Yatırım Tutarı 3 Milyon TL ye, * 3., 4., 5. ve 6. Bölgelerde ise 500.000 TL den 1.5 Milyon TL ye çıkarılmıştır. Yatırımlarınızı riske atmamak için 01.01.2022 tarihinden önce yatırım teşvik belgesi başvurusunda bulunmayı ihmal etmeyiniz. Gültekin Güler Genel Sekreter
5.11.2021
İhale İlan Metni Hk.
Sayın Üyemiz, Ekli ilan metninde belirtilen Hazine adına kayıtlı taşınmazların 2886 sayılı Kanun hükümleri gereğince satışları yapılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
5.11.2021
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-05.11.2021
Sayın Üyemiz, 2021 Kasım ayına ait "Peşin Hububat ve Bakliyat Satışları (Genel ve Sözleşme Bazında)" konulu satış duyurusu ekte bilgilerinize sunulmuştur. Gültekin Güler Genel Sekreter
5.11.2021
"BİGG SPOR Ödülleri" Yarışma Duyurusu Hk.
Sayın Üyemiz, Gençlik ve Spor Bakanlığı ile Sanayi ve Teknoloji Bakanlığı arasında yapılan iş birliği protokolü doğrultusunda1 Ekim 2021tarihinde TÜBİTAK tarafından açılan1.000.000 TLödüllü "BİGG SPOR Ödülleri"başlıklıyarışmanın başvuru son tarihi30 Kasım 2021’e uzatılmıştır. Spor teknolojileri alanında yaratıcı, yenilikçi, rekabet özelliklerine sahip, özgün farklılıkları olan, ulusal teknolojik birikime katkısağlayan ürünler yarışma sonucunda ödüllendirilecek ve kamuoyuna tanıtılacaktır. Yapılacak değerlendirmeler sonrasında belirlenecek girişimcilere toplam1.000.000 TLödül verilecektir. Yarışmaya duyuruda belirtilen spor teknolojileri alanında ürün sunan ve geliştirmekte olan Türkiye de yerleşik tüm firmalareteydeb.tubitak.gov.tr adresi üzerinden başvurabilecektir. Çağrı kapanış tarihi30 Kasım 2021, saat 23.59 olarak güncellenmiştir. Yarışmaya duyuruda belirtilen spor teknolojileri alanındaürün sunan ve geliştirmekte olanTürkiye’de yerleşik tüm firmalareteydeb.tubitak.gov.tradresi üzerindenbaşvurabilecektir. Yarışmaya ilişkin detaylara aşağıdaki duyuru linkinden ulaşabilmektedir. tubitak.gov.tr/sites/default/files/26723/bigg-spor_odulleri_duyuru_metni.pdf Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.11.2021
Burkina Faso/ Corail Industrie Firma Talebi
Sayın Üyemiz, Vagadugu Büyükelçiliğimizden alınan yazıya atfen, Burkina Faso da yerleşik Corail Industrie firması temsilcilerinin domates ürünlerinin işlenmesine yönelik ekipman, teknoloji transferi ve know-how sağlayabilecek Türk firmalarının desteklerini bekledikleri ve bu konuda katkı sağlayabilecek Türk firmalarının irtibat bilgilerini talep ettikleri belirtilmektedir. Yazıda devamla, Corail Industrie firmasının en geç 30 Kasım 2021 tarihi itibariyle ülkemizden bir şirket ile müzakereleri neticelendirerek söz konusu tesisin açılışını 27-28 Ocak 2022 tarihlerinde Koudougou da düzenlenmesi öngörülen III. Uluslararası Pamuk ve Tekstil Fuarı kapsamında gerçekleştirmeyi arzu ettikleri belirtilmektedir. Bilgilerinizi, ilgili üyelerinize duyurulmasını ve ilgilenen firmaların bilgilerinin ekteki tabloya işlenerek 5 Kasım 2021 tarihine kadar, Ticaret Bakanlığı na iletilmek üzere, Borsamıza (egemenakbulut@esktb.org.tr) gönderilmesini rica ederiz. Gültekin Güler Genel Sekreter
4.11.2021
SIAL Canada 2022
Sayın Üyemiz, Ülkemiz ihracatının ana lokomotiflerinden gıda sektörümüze yeni ihracat imkânları temin etmek amacıyla, İstanbul Ticaret Odası tarafından SIAL Gıda Fuarlarına iştirak edildiği belirtilmektedir. Yazıda devamla, Kanada nın Montreal şehrinde 20-22 Nisan 2022 tarihleri arasında düzenlenecek SIAL Canada 2022 Fuarı Türkiye milli iştiraki nin İstanbul Ticaret Odası tarafından düzenleneceği ve Türkiye milli iştiraki m2 katılım bedeli tüm ana hizmetler dahil 8.800 TL/m2 olarak belirlendiği kaydedilmektedir. SIAL Canada 2022 Türkiye milli iştirakine ilişkin duyuru metni ve sözleşme ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.11.2021
Karantina Tedbirleri - Moskova
Sayın Üyemiz, Moskova Ticaret Müşavirliğinden alınan yazıya atfen, Rusya Federasyonu nda COVID- 19 pandemisinde 4 üncü dalga sürecinde 24 Ekim 2021 tarihinde günlük vaka sayısında rekor kırılarak 37.930 seviyesine ulaşıldığı, Moskova şehrinde ise 8 bin seviyesine tekrar yaklaşılmasını müteakip muhtelif karantina tedbirlerinin tekrar uygulamaya geçirilmeye başlandığı belirtilmektedir. Yazıda devamla, Moskova şehrinde COVID-19 pandemisiyle mücadele kapsamında; 28 Ekim - 7 Kasım 2021 döneminin (bu tarihler dahil) tatil ilan edildiği, anılan tarihlerde ayrıca; restoran ve kafelerde (gel-al ve eve teslimat siparişleri hariç) hizmet verilmemesi, okullarda eğitime ara verilmesi ve geniş katılımlı tüm eğlence, spor, tanıtım ve kültür aktivitelerinin yasaklandığı ifade edilmektedir. Diğer yandan, tiyatro ve müzelerde %50 kapasiteyle QR kod uygulaması çerçevesinde hizmet verilebileceği, otellerdeki restoranların ise kendi müşterilerine hizmet vermelerinde (dışarıdan müşteri almamak kaydıyla) bir engel bulunmadığı belirtilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.11.2021
Şirket Değerlemesi Eğitimi
Sayın Üyemiz, Şirket sahibi, yöneticisi ve çalışanlarına yönelik olarak internet üzerinden "Şirket Değerlemesi Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. İlgili eğitimde şirket değeri, şirket değerini etkileyen faktörler ve şirket değerinin tespit edilme yöntemleri anlatılacaktır. Konuya ilişkin bilgileri içeren not ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.11.2021
Mahsul Buğday İhalesi
Sayın Üyemiz, İşletmemizde 16.11.2021 tarihinde yapılacak olan mahsul buğday satış ihalesine ait ilan metni ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
4.11.2021
Tacikistan e-sohbet Toplantısı
Sayın Üyemiz, 4 Kasım 2021 Perşembe günü 14.00-15.30 saatleri arasında Tacikistan da görev yapmakta olan Ticaret Müşavirimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantısının gerçekleştirileceği bildirilmektedir. Toplantıya ilişkin detayların yer aldığı doküman ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.11.2021
Devlet Destekli Alacak Sigortası’nda Değişiklik
Sayın Üyemiz, Üyelerimizden gelen talepler ve Birliğimizin girişimleri sonucunda 14 Ekim 2021 tarih ve 31628 sayılı Resmi Gazete´de "Küçük ve Orta Ölçekli İşletmelere Yönelik Devlet Destekli Ticari Alacak Sigortası Tarife ve Talimat Tebliğinde Değişiklik Yapılmasına Dair Tebliğ" yayınlanmıştır. Konuya ilişkin yeni düzenlemeleri içeren bilgi notu ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.11.2021
7. Dünya Helal Zirvesi ve 8. İİT Helal Fuarı
Sayın Üyemiz, Dünyanın en büyük helal organizasyonu olan7. Dünya Helal Zirvesi ve 8. İslam İşbirliği Teşkilatı (İİT) Helal Fuarı, 25-28 Kasım 2021’de “Yeni Çağın Yeni Normalleri: Helal Üretim ve Tüketimin Vazgeçilmezliği” konu başlığı ile İstanbul Kongre Merkezi’nde gerçekleştirilecektir. İslam Ticareti Geliştirme Merkezi (ICDT) ve İslam Ülkeleri Standartlar ve Metroloji Enstitüsü (SMIIC) iş birliğiyle ve 25’ten fazla ülkeden milli ve bireysel katılımlarla gerçekleştirilecek olan fuar; gıda, kozmetik, finans ve turizm gibi helal alanıyla ilgili pek çok sektör temsilcilerinin yanı sıra lojistik, yayıncılık, ambalaj, eğitim gibi farklı sektörlerden de kuruluşlara ev sahipliği yapacaktır. Fuarla eş zamanlı olarak SMIIC ana paydaşlığında ve başta Ticaret Bakanlığı ile Kurumumuz olmak üzere ülkemizin ilgili kurum ve kuruluşlarının katkılarıyla düzenlenen 7. Dünya Helal Zirvesi ise dünyanın dört bir yanından alanlarında profesyonel akademisyenler, araştırmacılar, iş insanları ve sektör öncülerini bir araya getirecektir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.11.2021
Belarus 11. Dönem KEK Toplantısı
Sayın Üyemiz, Türkiye-Belarus Hükümetlerarası Karma Ekonomik Komisyonu 11. Dönem Toplantısı nın 6-8 Aralık 2021 tarihinde Minsk te gerçekleştirilmesinin planlandığı bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Belarus ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 22 Kasım 2021 Pazartesi günü 12.00’ye kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi gerekmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.11.2021
Tacikistan da Gerçekleştirilebilecek Yatırımlar
Sayın Üyemiz, 11-13 Ekim 2021 tarihleri arasında Duşanbe de gerçekleştirilen Türkiye-Tacikistan Karma Ekonomik Komisyon 11. Dönem Toplantısı kapsamında, Tacik tarafınca, 2023 yılı itibarıyla ham madde ihracının yasaklanarak ürünlerin ithal ikameci anlayış çerçevesinde ülkede işlenmesinin hedeflendiği, Tacikistan ın ana gelir kaynaklarından işlenmemiş alüminyum ve pamuk satışlarının önümüzdeki dönemde azaltılarak, söz konusu ürünlerin Tacikistan da işlenmesine yönelik bir strateji geliştirileceği ve bu çerçevede özellikle pamuk ve alüminyum işleme sahalarında Türk yatırımlarının beklendiği ifade edilmektedir. Yazıda ayrıca, Tacik tarafınca tekstil, tarım/seracılık, işlenmiş gıda üretimi, hastane ekipmanı ve ilaç üretimi gibi sektörlerde de ülkemizden yatırımcı beklendiği ifadelerine yer verilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.11.2021
İş Yerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, Birliğimiz organizasyonunda, 3 Kasım 2021 Çarşamba günü saat 14.00’te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.11.2021
Türkiye - Kongo Demokratik Cumhuriyeti 2. KEK Toplantısı
Sayın Üyemiz, Türkiye - Kongo Demokratik Cumhuriyeti (KDC) Karma Ekonomik Komisyon (KEK) 2. Dönem toplantısının 1-3 Aralık 2021 tarihlerinde Kinşasa da gerçekleştirilmesinin planlandığı bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere KDC ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 4 Kasım 2021 Perşembe günü saat 12.00 ye kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederiz. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.11.2021
Türk Ticaret ve Sanayi Odası İş Forumu
Sayın Üyemiz, Türk Konseyi 8. Liderler Zirvesi 12 Kasım 201 tarihinde İstanbul da gerçekleştirilecektir. Türk Konseyi faaliyetleri kapsamında Türk Ticaret ve Sanayi Odası kurulmuş olup, bahse konu Oda nın Başkanlığı Birliğimiz Başkanı Sn. M. Rifat HİSARCIKLIOĞLU tarafından yürütülmektedir. Türk Ticaret ve Sanayi Odası İş Forumu, Türk Konseyi Liderler Zirvesi yan etkinliği olarak 10 Kasım 2021 Çarşamba günü İstanbul da gerçekleştirilecektir. İş Forumu na Azerbaycan, Kazakistan, Kırgızistan, Özbekistan ve Macaristan dan çeşitli sektörlerde faaliyet gösteren firma temsilcilerinin katlımı beklenmektedir. İş Forumu kapsamında, belirtilen ülkelerden katılacak firmalarla ikili iş görüşmeleri yapılabilecektir. Etkinliğe katılacak yabancı firma bilgileri, teyit veren katılımcılarımıza iletilecektir. Türkçe-Rusça ve İngilizce simultane tercüme hizmetinin sağlanacağı etkinlik saat 14.00-17.30 arasında gerçekleştirilecek olup taslak program ekte sunulmaktadır. Katılım için 2 doz aşı (2. dozun üzerinden en az 15 gün geçmiş olması gerekmektedir.) ya da son 48 saatte yapılmış negatif PCR testi ibraz edilmesi zorunludur. Katılım için lütfen formu eksiksiz doldurun: https://anket.tobb.org.tr/#/anket/turk-ticaret-ve-sanayi-odasi-is-forumu Son başvuru tarihi: 8 Kasım 2021 Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.11.2021
Tarımsal Desteklemelere İlişkin Kararda Yapılan Değişiklik
Sayın Üyemiz, 2020 yılında yapılacak tarımsal desteklere ilişkin kararda değişiklik yapılmasına dair karar Resmi Gazetede yayınlanarak yürürlüğe kondu. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.10.2021
Tarım Sigortaları Prim Desteği Oranlarında Değişiklik
Sayın Üyemiz; Tarım Sigortaları Havuzu tarafından 2021 yılında kapsama alınacak riskler, ürünler ve bölgeler ile prim desteği oranlarına ilişkin kararda değişiklik yapılmasına dair karar Resmi Gazete de yayınlanarak yürürlüğe konmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.10.2021
Hayvancılık Desteklerinde Düve Yaş Sınırı Artırıldı
Sayın Üyemiz, Hayvancılık desteği verilecek düvelerin yaş sınırında revizyona gidildi. Konuya ilişkin 2020 Yılında Yapılacak Tarımsal Desteklemelere İlişkin Kararda Değişiklik Yapılmasına Dair Cumhurbaşkanı Kararı Resmi Gazete de yayımlandı. Kararla hayvancılık destekleri kapsamında buzağı-malak ve dişi manda desteğine ilişkin hüküm değiştirildi. Buna göre, desteklerden yararlanılması için 4 ay ve üzeri yaştaki düvelerin ilkine buzağılama yaş sınırı en fazla 810 günden 870 güne çıkartılırken ineklerde de iki buzağılama arasındaki süre en fazla 450 günden 510 güne yükseltildi. Karara göre, söz konusu düve ve ineklerin buzağılarına hayvan başına 370 lira, etçi veya kombine ırk boğaların sperması ile suni tohumlamasından veya bu ırakların Tarım ve Orman Bakanlığınca izinli boğaları ile tabi tohumlamasından doğan buzağılarına hayvan başına 600 lira destek ödeniyor.Karar, 1 Ocak 2020 den itibaren geçerli olmak üzere yürürlüğe girdi. Öte yandan Tarım ve Orman Bakanlığının Hayvancılık Desteklemeleri Uygulama Tebliğinde Değişiklik Yapılmasına Dair Tebliği de Resmi Gazete te yayımlanarak yürürlüğe girdi. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.10.2021
VERGİ USUL KANUNU İLE BAZI KANUNLARDA DEĞİŞİKLİK YAPILMASINA DAİR KANUN
Sayın Üyemiz, "Kamu kurum ve kuruluşları tarafından yapılan tarımsal destekleme ödemeleri gelir vergisinden müstesnadır." maddesinin yer aldığı kanun, 26 Ekim 2021 tarihli Resmî Gazete’de yayınlandı. https://www.resmigazete.gov.tr/eskiler/2021/10/20211026-1.htm Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.10.2021
Ayçiçeği Yağı ve Aspir ithalatında gümrük vergisinin 31 Aralık 2021’e kadar sıfırlanması hk
Sayın Üyemiz, Ayçiçeği Yağı ve Aspir ithalatında gümrük vergisinin 31 Aralık 2021’e kadar sıfırlanmasına ilişkin 4634 sayılı Cumhurbaşkanlığı Kararı, 26 Ekim 2021 tarihli Resmî Gazete’de yayınlandı. https://www.resmigazete.gov.tr/eskiler/2021/10/20211026-4.pdf Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.10.2021
Ortak Küme Girişimleri
Sayın Üyemiz, KOSGEB Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığından alınan 13.10.2021 tarih ve E-60014838-746.99-7157 sayılı ve "Ortak Küme Girişimleri (EUROCLUSTERS) Çağrısı" proje teklif çağrısı konulu yazı ektedir. Söz konusu çağrıya yönelik olarak, ekli gündem doğrultusunda 25-26 Ekim 2021 tarihlerinde, online eğitim düzenlenecektir. Eğitime, https://cosme.kosgeb.gov.tr adresinden erişilebilecek kayıt formu aracılığıyla gerekli bilgiler girilerek katılım sağlanacaktır. Çağrı için özet bilgiye; https://cosme.kosgeb.gov.tr/cosme-cagrilari, detaylı bilgiye ise https://ec.europa.eu/easme/en/section/cosme/cosme-open-calls-proposals adresi aracılığıyla ulaşılabilir Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
22.10.2021
Tüm Yönleriyle Teknik İflas ve Alınması Gereken Önlemler Eğitimi
Sayın Üyemiz, İş dünyasının temsilcileri, bireysel ve kurumsal yatırımcılara yönelik olarak internet üzerinden "Tüm Yönleriyle Teknik İflas ve Alınması Gereken Önlemler Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. Bu eğitim ile iflas hakkında genel mahiyette kısa bilgiler verildikten sonra; iflas nedenleri, kimlerin iflasa tabi olduğu, iflas yolları (takipli ve doğrudan iflas), iflas kararı ve kararın borçlu ve alacaklılar bakımından ne gibi sonuçlar doğuracağı, iflas masasının oluşması, masaya alacak yazdırılması, iflasta rehinli alacaklıların durumu, iflas idaresi, alacaklara ilişkin sıra cetveli ve buna karşı koyma yolları, iflasın kaldırılması ve kapanması ile iflas takibi başlamadan ya da iflas davası açılmadan önce iflastan korunma yolları ile iflas ve konkordato ilişkisi üzerinde durulacaktır. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
22.10.2021
TMO MISIR SATIŞLARI
Sayın Üyemiz; TMO web sitesinden yapılan açıklamadalinktebilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
21.10.2021
Türkiye-Bulgaristan İş Forumu, 1 Kasım 2021
Sayın Üyemiz, Birliğimiz ve Bulgaristan Ticaret ve Sanayi Odası işbirliğinde, 1 Kasım 2021 tarihi, 11:00-13:15 saatleri arasında, zoom üzerinden, Pandemi Sonrası Ekonomik İlişkilerin Canlandırılması temalı Türkiye-Bulgaristan İş Forumu gerçekleştirmesi planlanmaktadır. Taslak programı ekte iletilen İş Forumu nda, Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu ve Bulgaristan Ticaret ve Sanayi Odası Başkanı Tsvetan Simeonov un yanı sıra, iki ülkenin Büyükelçileri de katılımcılara hitap edecektir. Etkinliğin katılım formu aşağıda verilen internet adresinde yer almaktadır. İş Forumu nun son oturumunda söz almak isteyen firmalar kendilerini tanıtabilecek ve soru-cevap kısmında sorularını iletebileceklerdir. Bilgilerinizi rica ederim. Saygılarımla, Katılım için: tobb-org.zoom.us/webinar/register/WN_Cbzstw7lSmq2wDXYnSYGRw
21.10.2021
Yurt İçi fuar Duyuruları
Sayın Üyemiz, 2022 Yılı Ana Fuar Takvimi 18 Ekim 2021 tarihli Ticaret Sicil Gazetesinde ve Birliğimizin internet sayfasında yayımlanmıştır. Ayrıntılı bilgiye https://www.tobb.org.tr/FuarlarMudurlugu/Sayfalar/AnaSayfa.php adresinden ulaşılabilmektedir. Bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
19.10.2021
Gürcistan - Rusya Sınırındaki İnşaat Çalışmaları hk.
Sayın Üyemiz, Gürcistan - Rusya arasındaki Zemo-Larsi gümrük geçiş noktasının Rusya tarafında gerçekleştirilen inşaat çalışmaları nedeniyle Rusya nın yeterli sayıda yük taşıtının geçiş işlemini gerçekleştiremediği bildirilerek Türk nakliye firmalarının alternatif gümrük geçiş noktalarını (Tsiteli Khidi - Siniq Korpu Kırmızı Köprü ve/veya Lagodekhi - Mazimchay) kullanmalarının tavsiye edildiği belirtilmektedir. Söz konusu notada yer verilen hususların Ticaret Bakan Yardımcısı Rıza Tuna TURAGAY ın 8 Ekim 2021 tarihinde İzmir de Gürcü ve Azerbaycanlı muhataplarıyla yaptığı toplantıda gündeme getirildiği, söz konusu görüşmeler çerçevesinde Azerbaycan Devlet Gümrük Komitesi Başkanı Safar MEHDİYEV in, Gürcistan dan Rusya ya geçişte yaşanan sorunların çözümüne yardımcı olmak adına Azerbaycan Cumhuriyeti olarak Türk taşımacıların ve ihracatçıların Gürcistan yerine Azerbaycan rotasını kullanmaları hususunda gerekli yardımı ve desteği sağlamaya hazır olduklarını ifade ettiği bildirilmektedir. Ayrıca söz konusu hususun, Ticaret Bakanlığımız tarafından Rus yetkili makamlarıyla yapılan ve yapılacak olan toplantılarda da gündeme getirilmekte olduğu ifade edilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
19.10.2021
Tek Pazar Programı – Ortak Küme Girişimleri (EUROCLUSTERS) Çağrısı
Sayın Üyemiz, Tek Pazar Programı–Ortak Küme Girişimleri (EUROCLUSTERS) Çağrısı ile ilgili yazı ekte yer almaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
19.10.2021
Türkiye-Yunanistan Ticari ve Ekonomik İşbirliği Çalışma Grubu
Sayın Üyemiz, Ülkemiz ile Yunanistan arasında Ticari ve Ekonomik İşbirliği Çalışma Grubu Toplantısı nın 26 Ekim 2021 tarihinde düzenleneceği bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Yunanistan ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 19 Ekim 2021 Salı günü mesai bitimine kadar Birliğimize (sila.kozanli@tobb.org.tr) iletilmesi gerekmektedir. Saygılarımızla, Gültekin GÜLER Genel Sekreter
19.10.2021
İspanya Hak. Görüş
Sayın Üyemiz, Türkiye-İspanya 7. Hükümetler arası Zirve nin, Sayın Cumhurbaşkanımız eş başkanlığında 17-18 Kasım 2021 tarihlerinde ülkemizde düzenleneceği bildirilmektedir. Bu itibarla, bahse konu toplantının hazırlıklarında kullanılmak üzere, İspanya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin varsa görüşlerinizin en geç 26 Ekim 2021 Salı günü saat 12.00’ye kadar Borsamıza (E-posta: egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederiz. Saygılarımızla, Gültekin GÜLER Genel Sekreter
19.10.2021
Türk KOBİ’leri için Enerji Verimliliği Eğitimi
Sayın Üyemiz, Türk KOBİ’lerine yönelik TEBD Enerji Verimliliği Eğitimi; 21 Ekim 2021 tarihinde Türkiye-Avrupa Birliği İş Diyaloğu (TEBD) Projesi kapsamında; Türkiye Odalar ve Borsalar Birliği (TOBB) ile Avrupa Ticaret ve Sanayi Odaları Birliği (EUROCHAMBRES) tarafından Avrupa Birliği ülkelerindeki deneyimli uzmanlar ile iş birliğinde düzenlenecektir. Etkinlik, enerji verimliliği konusunda farkındalık yaratmak amacı ile Türk Odaları için gerçekleştirilen TEBD Enerji Verimliliği Denetimi programının devamı niteliğinde düzenlenecektir. TEBD enerji verimliliği eğitimi; KOBİ lere enerjinin verimli kullanımından bahsederek nasıl daha rekabetçi konuma gelecekleri konusunda tavsiyelerde bulunacak, enerji verimliliğinin örnekleri, yasal gereklilikleri ve çok daha fazlası gündeme getirilecek. Program ve kayıt linki; https://us06web.zoom.us/webinar/register/WN_nZcMGgciScy6GCUymsblhg PROGRAM • 10:00 – 10:05 TRT – Açılış • 10:05 – 10:10 TRT – Enerji Verimliliği Uzman Ekibinin Tanıtılması • 10:10 – 11:30 TRT – Enerji Verimliliği Hakkında Bilinmesi Gerekenler • 11:40 – 12:30 TRT – Avrupa’da Enerji Verimliliği Etkinlik boyunca Türkçe ve İngilizce simultane çeviri yapılacaktır. Saygılarımızla,
15.10.2021
Akkuyu Nükleer Santrali İhaleleri Bilgilendirme Semineri
Sayın Üyemiz; "Akkuyu Nükleer Santrali İhaleleri Bilgilendirme Semineri" 26 Ekim 2021 Salı günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Enerji ve Tabii Kaynaklar Bakanlığı, Türkiye Odalar ve Borsalar Birliği ve Akkuyu Nükleer Santrali A.Ş. işbirliğinde gerçekleştirilecek olan; "Akkuyu Nükleer Santral Projesi nde İhalelerin Takibi ve Tedarikçi Olmak İçin Yapılması Gerekenler" konulu seminerde; projede yerli katkının artırılması açısından potansiyel Türk tedarikçilerin Akkuyu NGS Projesi ve ihale kurallarıyla ilgili bilgilendirilmesi ve ana yüklenici ile bir araya getirilmesi amaçlanmaktadır. Seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.10.2021
Helal Belgelendirme Destekleri
Sayın Üyemiz; Dünya genelinde helal belgelendirmesi alanında güvenilir bir akreditasyon mekanizması kurulması, ihracatçıların pazara güvenilir ürünlerle girmesi ve "Türk Malı" ibareli ürünlerin itibar kazanmasını teminen yapılan çalışmalar neticesinde Helal Akreditasyon Kurumu tarafından akredite helal belgeleri, Ticaret Bakanlığı nın 2014/8 sayılı "Pazara Giriş Belgelerinin Desteklenmesine İlişkin Karar"ı kapsamına alınmıştır. Helal Akreditasyon Kurumu tarafından akredite edilmiş kurum ve kuruluşların listesine Ticaret Bakanlığı nın pazara giriş desteklerine ilişkin internet adresinden (ticaret.gov.tr/destekler/ihracat-destekleri/tebligbazinda-destek-mevzuati/2014-8-sayili-pazara-giris-belgelerinin-desteklenmesine-iliskin-karar/destek-1-pazara-giris-belgeleri) erişim sağlanabilmektedir. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.10.2021
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)-14.10.2021
Sayın Üyemiz, İlgi : 01.10.2021 tarihli ve E-10823049-202.01.01-536854 sayılı yazı. İlgi yazımızın genel hükümler kısmında Ekim ayı satışları için "TMO ELEKTRONİK SATIŞ PLATFORMU üzerinden satışı yapılacak ürünler ile Şube Müdürlükleriniz kanalıyla dağıtımı yapılacak ürünler için Tarihleri 04 Ekim – 12 Ekim (dahil) 2021 (Saat 17.00 a kadar) arasında talep toplanacaktır" denilmektedir. Bu defa sadece besici ve yetiştiricilere yapılacak olan arpa satışlarında son başvuru tarihi 14 Ekim 2021 tarihi saat 17.00 olarak yeniden belirlenmiştir. Diğer hususlarda cari talimatımızda belirtilen fiyat, usül ve esaslar dâhilinde hareket edilecektir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
14.10.2021
"Türk Patent ve Marka Vekilliği Dünyasının Geleceği" Webinarı - 22 Ekim saat 14.30
Sayın Üyemiz; Türkiye Odalar ve Borsalar Birliği Türkiye Patent ve Marka Vekilleri Meclisi tarafından22 Ekim 2021 tarihinde saat 14.30 da"Türk Patent ve Marka Vekilliği Dünyasının Geleceği" isimli bir seminer gerçekleştirilecektir. Toplantıyahttp://webinar.tobb.org.tradresinde yer alan linkten erişim sağlanabilecektir. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.10.2021
Tedarikçi Yönetimi ve Tedarikçi Risk Yönetimi Semineri
Sayın Üyemiz; TOBB Tedarikçi Geliştirme Programı kapsamında, Tedarikçi Yönetimi ve Tedarikçi Risk Yönetimi Toplantısı 21 Ekim 2021 Perşembe günü saat 14:00 te internet üzerinden gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; iş dünyasının beklentilerine katkıda bulunmak amacıyla tedarik zinciri yönetimi prensipleri ve iyi uygulamaları, tedarik zinciri yönetim uygulamalarındaki ihtiyaçlar anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.10.2021
Yeşil Dönüşüme Nasıl Ayak Uyduracağız? -Webinar (Tarım ve Hayvancılık)
Sayın Üyemiz, Birliğimiz ve Horizon danışmanlık firması işbirliği ile gerçekleştirilecek olan "Yeşil Dönüşüme Nasıl Ayak Uyduracağız?" webinarı 14 Ekim 2021 tarihinde saat 14:00 te tarım ve hayvancılık sektörü özelinde gerçekleştirilecektir. Konuyla ilgili ayrıntılı bilgiyewebinar.tobb.org.tr/ adresinden ulaşılabilmektedir. Bilgilerinize sunarız. Saygılarımızla,
14.10.2021
MESLEKİ EĞİTİM MERKEZİ AÇILMASI
Sayın Üyemiz, İlimizdeki sanayi,ticaret ve esnaf kuruluşları başta olmak üzere kurum ve kuruluşlarımızın ihtiyaçlarının karşılanması ve mesleki eğitimin yaygınlaştırılması amacıyla Milli eğitim Bakanlığı nın onayı ile Gazi Mesleki ve Teknik Anadolu Lisesi bünyesinde Mesleki eğitim merkezi programı açılmıştır. Okulda, tüm kişi, kurum ve işletmelerin ihtiyaçlarını karşılamaya yönelik olarak çıraklık, kalfalık, usta öğreticilik eğitimleri, mesleki kurslar, kalfalık, ustalık sınavları faaliyetleri başlamıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
12.10.2021
İran a ait Eyalet Tanıtım Kartları
Sayın üyemiz, İran da bulunan 31 eyaletin (Ostan) tamamı için Tebriz ve Urumiye Ticaret Ataşeliklerimizin de katkılarıyla, Ostan (İran Eyaleti) Tanıtım Kartları oluşturulduğu ifade edilmektedir. Ostan Tanıtım Kartları nda her bir eyaletin nüfusu, sosyoekonomik gelişmişlik seviyesi, sanayi bölgeleri, hizmet sektörleri, dış ticaretindeki önde gelen ürün ve ülkeler bulunmakta olup kartların İran daki yatırımcılarımızın çalışmalarını kolaylaştırması, eyaletlere yatırım veya iş seyahati yapmak isteyenler için genel bir perspektif vermesinin hedeflendiği belirtilmektedir. Söz konusu kartlara ticaret.gov.tr/yurtdisi-teskilati/guney-asya/iran/raporlar/musavirlik-raporlariadresinden ulaşılabilir. Bilgilerinize sunarız.
12.10.2021
HepsiTürkiye den Eğitim Programı
Sayın Üyemiz, Yöresel ürünlerimizin; ticarete kazandırılması, tüketimlerinin yaygınlaştırılması, katma değerlerinin artırılması ve coğrafi işaret ile tescil edilerek standartlarının oluşturulması gibi amaçlarla "Sizin Oraların Nesi Meşhur" sloganıyla bu yıl on birincisini düzenleyeceğimiz YÖREX-Yöresel Ürünler Fuarı 20-24 Ekim 2021 tarihlerinde ANFAŞAntalya Fuar ve Kongre Merkezi nde gerçekleştirilecektir. TOBB ve Hepsiburada iş birliğiyle gerçekleştirilen coğrafi işaretlerin e-ticaretine yönelik HepsiTürkiye den projesi kapsamında coğrafi işaret üreticileriyle bir araya gelinerek proje hakkında bilgilendirme yapılacak ve eğitim verilecektir. "HepsiTürkiye den Eğitim Programı" 22-23-24 Ekim tarihlerinde her gün saat 11:00 ve 14:00 de Anfaş Fuar Merkezi Hall 1 Etkinlik alanında gerçekleştirilecektir. Bilgilerinize rica ederiz. Program içeriği; - Yerelden Ulusala e-ticaret desteği - HepsiTürkiye den hedefleri - Dijital Dönüşüm Desteği - Coğrafi İşaretli Ürünler - HepsiTürkiye den lansman özel fırsatları - Hepsiburada ile e-ticaret adımları
12.10.2021
Soğuk Zincir Finansal Kiralama Destek Programı
Sayın üyemiz, Sebze ve meyve zayiatının azaltılması için soğuk zincir oluşturulmasını temin etmek amacıyla Bakanlığımız ile Hazine ve Maliye Bakanlığı arasında yürütülen çalışmalar sonucunda, Küçük ve Orta Ölçekli İşletmeleri Geliştirme ve Destekleme İdaresi Başkanlığı tarafından toptancı hallerinde faaliyet gösteren tüccar, komisyoncu meslek mensupları ile sebze ve meyve taşımacılığı yapan lojistik firmalarının desteklenmesi kapsamında “Sebze ve Meyve Soğuk Zincir Finansal Kiralama Destek Programı” yürürlüğe konulmuştur. Söz konusu destek programı kapsamında, “Küçük ve orta ölçekli işletmelerin, sebze ve meyve zayiatını azaltmak üzere soğuk zincir oluşturmaları sürecinde, finansal kiralama yöntemiyle temin edecekleri, yerli malı ve yeni soğuk hava ünitesi ve/veya soğutucu frigorifik kasa/ünite yatırımları için finansal kiralama faiz/ kâr payı masraflarına katkı sağlanması.” amaçlanmakta olup, desteğe başvuru kosgeb.gov.tr internet adresi üzerinden yapılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.10.2021
Port Sudan Limanı nın ve Hartum a Bağlanan Karayolunun Kapanması
Sayın üyemiz, Doğu Sudan ın Beja Kabileleri üyelerinin, bölgedeki siyasal otorite boşluğu ve kötü ekonomik koşulları protesto etmek için Port Sudan Limanı ndaki faaliyetlerin durmasına sebebiyet verecek şekilde bir isyan başlattıkları bildirilmektedir. Anılan isyan çerçevesinde, Hartum a bağlanan anayolu kapattıkları ve söz konusu limanın kapanmasından önce limana indirilmiş konteynerlerin gümrük işlemlerinin gerçekleştirilememesi nedeniyle büyük miktarlarda demuraj masraflarının oluştuğu bildirilmektedir. Yazıda devamla, ihracatçılarımızın, mal teslimi yapan acentalar ile mücbir sebep durumundan dolayı yeniden bir değerlendirme yapılmasını talep etmelerinde ve Sudan daki durumu takip ederek yükleme yapmalarında fayda görüldüğü belirtilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
11.10.2021
ICC SME360X” KOBİ’ler için Çevre Üzerindeki Etkilerini Ölçme ve Değerlendirme Platformu
Sayın üyemiz, Türkiye Odalar ve Borsalar Birliği (TOBB) çatısı altında faaliyet göstermekte olan Milletlerarası Ticaret Odası (ICC) Türkiye Milli Komitesi, 1934 yılından bu yana, ülkemizde ICC nin temsilciliğini üstlenmektedir. ICC nin küresel ağı, 100 den fazla ülkede 6 milyonun üzerindeki teşebbüs, ticaret odaları ve meslek birliklerini kapsamaktadır. 92 ülkede Milli Komitesi bulunan ICC nin en etkili Milli Komitelerinden biri olan Türkiye Milli Komitesi güçlü ve köklü bir Milli Komite olarak uzun yıllardır faaliyetlerini sürdürmektedir. Türkiye nin önde gelen hukuk büroları, bankaları, firmaları, iş dünyası kuruluşları ve ticaret odaları dahil olmak üzere 250 den fazla üyeyi temsil etmektedir. ICC Türkiye Milli Komitesi, Türk iş dünyasının uluslararası çalışmalarına katkı sağlamak hedefiyle, başta tahkim, bankacılık, gümrük, rekabet, dijitalleşme, fikri mülkiyet ve dış ticaret olmak üzere ICC nin faaliyet gösterdiği alanlarda faaliyetlerini sürdürmektedir. ICC nin bir girişimi olarak, Sürdürülebilir Kalkınma Hedefleri (SDG) İş Dünyası Forumu yla eş zamanlı olarak SME360X Platformunun açılışı yapılmıştır. KOBİ ler için Çevre Üzerindeki Etkilerini Ölçme ve Değerlendirme Platformu; KOBİ lerin dijital ekonomiye dahil edilmesi ve büyümelerine, ticaret yapmalarına ve dirençli olmalarına yardımcı olmayı amaçlamaktadır. SME360X; KOBİ lerin çevre üzerindeki etkilerini ölçmeleri ve değerlendirmeleri için dijital bir değerlendirme aracıdır. Bir KOBİ, temel ortam verilerini SME360X e girdikten sonra, platform otomatik olarak küresel bir kıyaslama sistemine dayalı olarak tahmini bir sürdürülebilirlik puanı ve değerlendirme sağlamaktadır. KOBİ lerin daha çevreci ve daha rekabetçi olmasını amaçlayan SME360X platformunun tanıtım broşürü ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
8.10.2021
Teknoloji Odaklı Sanayi Hamlesi Programı Dijital Dönüşüm Çağrısı Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz organizasyonunda, 12 Ekim 2021 Salı günü saat 14:30 da internet üzerinden, "Teknoloji Odaklı Sanayi Hamlesi Programı Dijital Dönüşüm Çağrısı Bilgilendirme Webinarı" düzenlenecektir. Seminere ilişkin davet ekte sunulmaktadır. Sanayi ve Teknoloji Bakanlığı, Türkiye Odalar ve Borsalar Birliği ve Organize Sanayi Bölgeleri Üst Kuruluşu iş birliğinde gerçekleştirilecek olan webinarda Teknoloji Odaklı Sanayi Hamlesi Programı kapsamında teknoloji tedarikçilerine yönelik olarak ilan edilen ve dijital dönüşüm alanında 188 ürün ve 54 yenilikçi teknoloji yatırımını destekleyen Dijital Dönüşüm Çağrısı anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
8.10.2021
11.YÖREX İkili İş Görüşmeleri
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nin desteğinde Antalya Ticaret Borsası organizasyonunda 20-24 Ekim 2021 tarihlerinde Antalya da 11.YÖREX–Yöresel Ürünler Fuarı düzenlenecektir. Coğrafi işaretli ve yöresel ürünlerin ekonomiye kazandırılması, iş bağlantılarının kurulması ve geliştirilmesi amacı ile YÖREX in düzenlendiği fuaye alanında yer alan Türkiye Odalar ve Borsalar Birliği ile ulusal market zincirleri, e-ticaret siteleri ve restoran zincirlerinin stantlarında yapılacak olan ikili iş görüşmeleri (B2B eşleştirme) programına katılmak isteyen üyelerinizin /katılımcılarınızın/ ziyaretçilerin https://yorex.com.tr/b2b/adresinde yer alan başvuru formunu doldurmaları gerekmektedir. Görüşmeye katılacak firmalar: CARREFOURSA MİGROS METRO ÖZDİLEK TRENDYOL PTT AVM HEPSİBURADA GİTTİGİDİYOR GETİR ONEDİO Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.10.2021
Yöneticiler İçin Vergi Eğitimi
Sayın üyemiz, İş dünyasının temsilcileri, bireysel ve kurumsal yatırımcılara yönelik olarak internet üzerinden "Yöneticiler İçin Vergi Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. Bu eğitim ile güncel vergi düzenlemeleri hakkında bilgi sahibi olunmasının sağlanması, mevzuatta yer alan önemli ve özellikli konuların incelenerek uygulamada karşılaşılabilecek sorunların çözümüne katkıda bulunulması, olası vergi incelemeleri öncesinde ve sonrasında süreç yönetiminin aktarılması amaçlanmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.10.2021
Türkiye-Macaristan 5. Dönem YDSK Toplantısı
Sayın Üyemiz, Türkiye-Macaristan 5. Dönem Yüksek Düzeyli Stratejik İşbirliği Konseyi (YDSK) Toplantısının, Cumhurbaşkanımız Sayın Recep Tayyip Erdoğan ve Macaristan Başbakanı Sayın Viktor Orban eşbaşkanlıklarında 11 Kasım 2021 tarihinde ülkemizde gerçekleştirilmesi planlandığı ve söz konusu toplantıya Ticaret Bakanımız Sayın Mehmet Muş un da iştirak etmesi öngörüldüğü belirtilerek, toplantının hazırlık çalışmalarında yararlanılmak üzere, ülkemiz ile Macaristan arasındaki ilişkilere dair Birliğimizin görev ve yetki alanına giren konular ile ilgili güncel bilgi notuna ihtiyaç duyulduğu ifade edilmektedir. Bu itibarla, bahse konu toplantının hazırlıklarında kullanılmak üzere, Macaristan ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin görüşlerinizin en geç 18 Ekim 2021 Pazartesi günü saat 12.00 ye kadar Borsamıza (E-posta:egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederim. Gültekin Güler Genel Sekreter
7.10.2021
ABD - İran Yaptırımları Hk. Güncel Bilgi Notu
Sayın Üyemiz, Amerika Birleşik Devletleri Ankara Büyükelçiliği nin ilgide kayıtlı e-posta yazısında yer alan ve ABD nin İran a uyguladığı yaptırımları konu alan bilgi notunun ilgili bölümleri ekte iletilmektedir. Konuyla ilgili Ticaret Bakanlığımızdan alınan görüşte, ülkemizi hukuken yalnızca Birleşmiş Milletler kararları bağlamakla birlikte, ABD nin yaptırım kararlarının denizaşan etkilerinin de söz konusu olabileceği ifade edilmektedir. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
7.10.2021
Rusya Federasyonu Tula Bölgesi temsilcilerinin ziyareti
Sayın Üyemiz, Rusya Federasyonu Tula Bölgesi Ekonomik Kalkınma Bakanı Pavel Tatarenko ile Sanayi ve Ticaret Bakanı Vyacheslav Romanov un, 21 Ekim 2021 Perşembe günü Ankara ya bir ziyaret düzenleyeceği belirtilmektedir. Tula Bölgesi, Moskova ya 180 kilometre mesafede konumlanması sebebiyle stratejik, lojistik ve ulaşımı kolay konuma sahip olmakla birlikte, 1.5 milyon nüfusu ve eğitimli iş gücüyle ülke ekonomisinin önemli lokomotiflerinden biridir. Tula Bölgesi özellikle sanayi üretimiyle ön plana çıkmakta olup, Bölgede makine inşası, kimya endüstrisi, metalürji, gıda sanayi, kömür madenciliği ve askeri-sanayi kompleks inşası setkörlerinde büyük aktörler yer almaktadır. Bu çerçevede, Birliğimizce, 21 Ekim 2021 Perşembe günü, 11.00-12.00 saatleri arasında, TOBB Sosyal Tesisler Toplantı Salonu nda, Tula Bölgesi Tanıtım Etkinliği düzenlenecektir. Etkinlikte Türkçe-Rusça tercüme hizmeti bulunacak olup, etkinliğe katılmayı arzu edenlerin ekteki katılım formunu Birliğimize eposta (kaan.gaffaroglu@tobb.org.tr) ile iletmeleri gerekmektedir. Etkinliğe katılmak için 2 aşı olunduğunu belirten belge veya 72 saatlik PCR testi talep edilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.10.2021
TMO YEM REGÜLASYON ÇALIŞMASI-KAMUOYU AÇIKLAMASI
Sayın Üyemiz, TMO Yem Regülasyon Çalışmasına dair yapılan kamuoyu açıklamasına ulaşmak için tıklayınız. Saygılarımızla,
7.10.2021
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında) - 04.10.2021
SAYIN ÜYEMİZ, TMO ESKİŞEHİR ŞUBE MÜDÜRLÜĞÜNDEN ALINAN DUYURU EKTEDİR. BİLGİLERİNİZE SUNULUR.
4.10.2021
Sayın Cumhurbaşkanımızın Togo Ziyareti
Sayın Üyemiz, Sayın Cumhurbaşkanımızın 20 Ekim 2021 tarihinde Togo ya resmi bir ziyaret gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bahse konu ziyaretin hazırlık çalışmalarında yararlanılmak üzere Togo ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 4 Ekim 2021 Pazartesi günü mesai bitimine kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederim. Genel Sekreter Gültekin Güler
1.10.2021
Temel Göstergeler Işığında Türkiye Ekonomisi ve Finansal Piyasaları Eğitimi
Sayın Üyemiz, İş dünyasının temsilcileri, bireysel ve kurumsal yatırımcılara yönelik olarak internet üzerinden "Temel Göstergeler Işığında Türkiye Ekonomisi ve Finansal Piyasaları Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. Türkiye piyasalarına yabancı girişlerinin tekrar başladığı bir dönemde, iş dünyasının ve yatırımcıların dikkat etmesi gereken hususlar üzerinde durulacaktır. Böyle bir konjonktürde; iş dünyasının ve yatırımcıların ekonomik göstergeleri doğru okuması, finans piyasalarının mekanizmasını anlamaları büyük önem arz etmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
1.10.2021
Birleşik Krallık a İhracatta Karşılaşılan İhracat Engellerinin İhracat Performansı Üzerindeki Etkisi Üzerine Yürütülen Anket Çalışması
Sayın Üyemiz, Birleşik Krallık a ihracat yapan "Motorlu Araçlar ve Aksam Parçaları", "Makine, Elektrikli Makine, Kablo", "Tekstil Hazır Giyim", "Kıymetli Metaller", "Plastik ve Mamulleri", "Mobilyalar, Aydınlatma Cihazları", "Tıbbi Cihazlar" başta olmak üzere ilgili tüm sektörlerde yer alan ihracatçı firmaların karşılaştığı ihracat engellerinin belirlenerek, ihracat performansı ile arasındaki ilişkinin bir anket çalışması ile ortaya konulmasının amaçlandığı ifade edilmiştir. E-postada devamla, anketin işletme yöneticisi ya da ihracat birim sorumlusu tarafından değerlendirilerek, en uygun olan cevabın işaretlenmesi talep edilmektedir. Ayrıca, anket soruları üzerinden güvenilir sonuçlara ulaşılabilmesi için cevapların gerçeği yansıtır nitelikte ve eksiksiz olmasının gerektiği vurgulanmıştır. Bu itibarla, Odanızın/Borsanızın ilgili üyelerinin https://anketler.ticaret.gov.tr/index.cfm?ID=95 linki üzerinden 22 Ekim 2021 tarihine kadar anketi eksiksiz olarak doldurması gerekmektedir. Bilgilerinizi ve gereğini rica ederiz. Not-1: Cevaplar toplu olarak değerlendirileceğinden lütfen isim ve iletişim bilgilerini belirtmeyiniz. Not-2: Firefox veya Google Chrome kullanarak anket sorularını görüntüleyebilirsiniz. Not-3:Çalışma ile ilgili herhangi bir sorunuz olması durumunda sakalsize@ticaret.gov.tr e-posta adresine tüm sorularınızı iletebilirsiniz. Gültekin Güler Genel Sekreter
29.09.2021
YYS Elektronik Başvuru İşlemleri
Sayın Üyemiz, Gümrük İşlemlerinin Kolaylaştırılması Yönetmeliğinin 11 inci maddesi kapsamında yetkilendirilmiş yükümlü sertifikasına ilişkin e-Devlet Kapısı aracılığıyla yapılacak başvuru işlemlerini daha detaylı açıklamak üzere "YYS Elektronik Başvuru İşlemleri" konulu 2021/24 sayılı Genelge hazırlandığı ve söz konusu Genelgeye ve ekinde yer alan yetkilendirme formu ile kılavuza www.ticaret.gov.tr/gumruk-islemleri/yetkilendirilmis-yukumlu-statusu/belgeleradresi üzerinden ulaşılmasının mümkün olduğu belirtilmiştir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
29.09.2021
Slovak Matchmaking Fair 2021
Sayın Üyemiz, Slovak Ticareti ve Yatırımı Geliştirme Ajansı (SARIO) tarafından, Slovakya Ekonomi Bakanlığının himayesinde ve açılışını Başbakan Yardımcısı ve Ekonomi Bakanı Richard Sulik in gerçekleştireceği Slovak Eşleştirme Fuarı 2021 in (Slovak Matchmaking Fair) 21 Ekim 2021 tarihinde çevrimiçi olarak düzenleneceği bildirilmektedir. Yazıda devamla, on beş yıldır Slovak Eşleştirme Fuarı nın, Slovak ve uluslararası girişimciler ile kurumların ilgi duyduğu bir platform haline geldiği, Fuar ın, güncel endüstri konularını etkin bir şekilde kapsadığı, doğrudan yeni iş bağlantıları kurmak ve potansiyel iş birliklerini güvence altına almak için fırsatlar sunduğu belirtilmektedir. Söz konusu Fuar a ilişkin detaylı bilgilere www.sario.sk/en/events-projects/slovak-matchmaking-fair- 2021-online-0adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
28.09.2021
Kalite Değerleri Bakımından Öne Çıkan Buğday Çeşitleri
Borsamıza işlem görmesi için getirilen 2021 yılı hasadı buğdaylarda laboratuvarımızda yapılan satış öncesi analizlerin sonuçlarına göre “kalite değerleri bakımından öne çıkan çeşitler” aşağıda verilmektedir. Halen ilimizde ekiliş alanı bulunan buğday çeşitlerinden bazılarının potansiyellerinin altında kalite değerleri verdiği görülmüştür. Bu durumun; 2020 sonbaharında başlayan ve 2021 yılında da devam eden kurak koşulların etkisiyle çeşidin kendi genetik yapısından kaynaklanma olasılığı olduğu gibi, ilkbahar üst gübrelemesinde uygulanan azotlu gübre miktarının azaltılması da neden olabilmektedir. Bilgilerinize sunulur. Gültekin GÜLER GENEL SEKRETER RUMELİ ENERGO EKİZ SÖNMEZ 2001 KATE A-1 HÜSEYİNBEY KRASUNIA ODESKA UKRAYNA ESPERIA DROPIA AHMETAĞA HÜNKAR SYRENA ODESKA FLAMURA 85 ALMERIA BEZOSTAJA 1 ENOLA REİS NACİBEY YUNUS
23.09.2021
Fashion Eskişehir Moda Tasarım Yarışması
Sayın Üyemiz, Fashion Eskişehir – Eskişehir Moda Tasarım YarışmasıEskişehir Ticaret Odası tarafından, Eskişehir Teknik Üniversitesi işbirliği ve T.C. Ticaret Bakanlığı desteğiyle bu yıl ilk kez düzenlenen bir moda tasarım yarışmasıdır. Gelinlik, abiye ve günlük kıyafet kategorilerinde hem genç tasarımcı adaylarını; hem de sektörde yer alan profesyonelleri bir araya getirecek bir platform olanFashion Eskişehir, sağlayacağı ödül ve yurtdışında öğrenim imkanlarıyla tasarımcılar için önemli kaynakları bir araya getirecektir. Yarışma, 10 Eylül – 15 Ekim 2021 tarihleri arasında başvuru kabul etmekte olup, potansiyel yarışmacıların bu tarih aralığında başvuru için hazır olmaları beklenmektedir. Detaylı bilgiyewww.fashioneskisehir.comadresinden ulaşabilirsiniz. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
23.09.2021
İşyerlerinde Covid-19 tedbirleri
Sayın Üyemiz, Çalışma ve Sosyal Güvenlik Bakanlığı tarafından işverenlerin işçilerinden isteyeceği PCR testi ve işçilerini Covid-19 riskleri ve tedbirleri konusunda bilgilendirmesini içeren 2/9/2021 tarihli genel yazı 81 il valiliğine gönderilmiş ve Birliğimizle de paylaşılmıştır. Söz konusu yazının kamuoyunda duyulmasını müteakip, konu yazılı ve görsel medyada hukukçu ve uzmanlar tarafından değerlendirilmeye başlanmış, birçok farklı görüş dile getirilmiştir. Hukukçu ve uzmanların konu hakkında farklı görüş belirtmeleri nedeniyle ortaya çıkan bilgi kirliliğine bağlı olarak uygulamada sorunlar oluşmuştur. Bu sorunların açıklığa kavuşturulmasını teminen, özellikle aşı yaptırmayan ve PCR testi ibraz etmeyen çalışanların iş sözleşmelerinin geçerli veya haklı sebep ile sona erdirilmesi veya bu kişilerin işyerlerine alınmaması durumunda çalıştırılmadıkları sürelerde ücretlerinin ödenip ödenmeyeceği konularında çalışma mevzuatında açık hükümler bulunmadığından, Çalışma ve Sosyal Güvenlik Bakanlığının görüş ve değerlendirmeleri istenmiştir. Konu ile ilgili olarak Çalışma ve Sosyal Güvenlik Bakanlığı (Çalışma Genel Müdürlüğü) tarafından Birliğimize gönderilen 17.09.2021 tarihli ve E-41515602-000-38611 sayılı yazı ekte sunulmuştur. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
23.09.2021
Sayın Cumhurbaşkanımızın Angola ve Burkina Faso Ziyaretleri
Sayın Üyemiz, Sayın Cumhurbaşkanımızın; 17-18 Ekim 2021 tarihlerinde Angola Cumhuriyeti ne,20 Ekim 2021 tarihinde Burkina Faso ya resmi bir ziyaret gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bahse konu ziyaretlerin hazırlık çalışmalarında yararlanılmak üzere Angola ve Burkina Faso ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 24 Eylül 2021 Cuma günü saat 12:00 ye kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederiz. Gültekin Güler Genel Sekreter
21.09.2021
Engelli Eğitim ve İstihdam Çalıştayı
Sayın Üyemiz, Engelli Eğitim Kültür Sağlık Spor Vakfı tarafından 16-20 Kasım 2021 tarihleri arasında Ankara da "Engelli Eğitim ve İstihdam Çalıştayı" düzenleyecekleri belirtilerek, çalıştay kapsamında hazırlanmış olan ve https://www.handicappeconference.org/internet adresinde bulunan işveren anketine katkı sağlanması talep edilmektedir. Bilgilerinize sunarız. Gültekin Güler Genel Sekreter
17.09.2021
İş Yerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, Birliğimiz organizasyonunda, 6 Ekim 2021 Çarşamba günü saat 14:00 te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
17.09.2021
Akıllı KOBİ Platformu Lansman Toplantısı (İnternet Üzerinden)
Sayın Üyemiz, İşini dijitale taşımak ve dijital dönüşümünü gerçekleştirmek isteyen KOBİ lerin ihtiyaç duyduğu ürün ve hizmetlerin tek bir noktadan ulaşılabilir olmasını sağlamak ve bu konuda rehberlik ve eğitim hizmetleri sunmak amacıyla Birliğimiz ve Visa iş birliğinde Akıllı KOBİ platformu çalışmalarının başlatıldığı ilgi yazı ile tarafınıza iletilmişti. Bu kapsamda platformun açılışını yapmak üzere Akıllı KOBİ Platformu Lansman Toplantısı Sanayi ve Teknoloji Bakanı Sn. Mustafa Varank, Birliğimiz Başkanı Sn. M. Rifat Hisarcıklıoğlu ile Visa Türkiye Genel Müdürü Sn. Merve Tezel in katılımıyla 17 Eylül 2021 Cuma günü saat 16:00 da gerçekleştirilecek olup, lansmana ilişkin program ekte sunulmaktadır. Katılımınız önemle rica olunur. Gültekin Güler Genel Sekreter
17.09.2021
Ticaret Müşavirlerimizle Elektronik Sohbetler-Mısır
Sayın Üyemiz, 16 Eylül Perşembe günü 14.00-15.30 saatleri arasında Mısır da görev yapmakta olan Ticaret Müşavir ve Ataşelerimizin katılımıyla "Mısır da Yatırım, Ticaret ve Yeni Gümrük Sistemi: Gönderi Ön Bilgilendirme (Advance Cargo Info-ACI)" konulu bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Toplantıya ilişkin detayların yer aldığı doküman ekte sunulmaktadır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.09.2021
Türkiye-Almanya JETCO II. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Almanya II. Dönem Ortak Ekonomi ve Ticaret Komitesi (JETCO) Toplantısının 13 Ekim 2021 tarihinde video konferans yöntemiyle gerçekleştirileceği bildirilmekte ve söz konusu toplantıya yönelik hazırlık çalışmalarında yararlanılmak ve Mutabakat Zaptında yer almak üzere Türkiye-Almanya ticari ve ekonomik ilişkileri hakkında ele alınmasında fayda görülen konulara ilişkin bilgi notu talep edilmektedir. Bu itibarla, hazırlanacak Birliğimiz görüşünde yer almak üzere, Almanya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik işbirliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin varsa görüşlerinizi içeren bir bilgi notunun en geç 24 Eylül 2021 Cuma günü saat 12.00 ye kadar Borsamıza (E-posta: egemenakbulut@esktb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
16.09.2021
Yeşil Dönüşüme Nasıl Ayak Uydurucağız? Webinar Daveti
Sayın Üyemiz, Birliğimiz bünyesinde yürütülen Avrupa Yeşil Mutabakatı çalışmaları kapsamında, "Yeşil Dönüşüme Nasıl Ayak Uyduracağız?" başlıklı bir webinar dizisi başlatılmıştır. 16 Eylül 2021 tarihinde saat 14.00 te gıda, içecek ve perakende sektörleri özelinde gerçekleştirilecek webinarın konu başlıklarından bazıları aşağıda yer almaktadır. · Şirketiniz 2030 a hazır mı? · Karbon ayak izinizi biliyor musunuz? · Şirketinizin iklim karnesi nedir? · Fit For 55 nedir? · Sınırda Karbon Düzenlemesi ne getiriyor? · Türk ihracatçısı için tehditler-fırsatlar nelerdir? · Şirketler ne yapmalı? Webinar programı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.09.2021
Suriye Hibe Un Hibesi
Sayın Üyemiz; Suriye de yaşayan ve bu ülkedeki olaylardan zarar gören sivil halka yardım amacıyla ekmeklik buğday karşılığı 17.500 ton (± %20 TMO opsiyonunda) çuvallı unun temin ihalesi, 17.09.2021tarihi saat 10.30 da TMO Genel Müdürlüğünde yapılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.09.2021
7326 sayılı Kanun tanıtımı
Sayın Üyemiz, 7326 sayılı Bazı Alacakların Yeniden Yapılandırılmasına İlişkin Kanunun 9 Haziran 2021 tarihinde Resmi Gazete de yayımlanarak yürürlüğe girmiş, Kanunla başta vergi borçları olmak üzere kamuya ait borçların (Motorlu taşıtlar vergisi, trafik para cezası, idari para cezaları, öğrenim ve katkı kredisi ve ecrimisil gibi) yapılandırılması ile matrah ve vergi artırımı, işletme kayıtlarının düzeltilmesi gibi mükelleflere ve vatandaşlara büyük kolaylık ve imkanlar sağlanmıştır. Kanunun son başvuru süresi olan 30 Eylül 2021 tarihine kadar ülke ekonomimiz açısından önemli olan bu düzenlemenin tanıtılması ve hatırlatılması, daha çok mükellefe ve vatandaşa ulaştırılabilmesi amacıyla beş adet farklı içeriklerde hazırlanan "TV Spotları" aşağıdaki linkte yer almaktadır. Bilgilerinize sunulur. 7326 Sayılı Kanun TV Spotları linki: drive.google.com/drive/folders/1DVNe6qqg16sbE_HWMk3sgKASLQWWfaAd
15.09.2021
EUROCHAMBRES: Avrupa yı Canlandırmak Etkinliği
Sayın Üyemiz, Birliğimizin üyesi olduğu ve Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu nun Başkan Vekilliğini yürüttüğü Avrupa Ticaret ve Sanayi Odaları Birliği (EUROCHAMBRES) tarafından 12-14 Ekim 2021 tarihleri arasında Avrupa daki bütün yerel/bölgesel odaların davetli olduğu "Reviving Europe" adlı etkinlik düzenlenecektir. Etkinliğin amacı; ekonomik toparlanmayı hızlandırmak, işletmelerin istediği Avrupa hakkında somut fikirler sağlamak ve katılımcılara Avrupa nın zorlukları ve önceliklerini tartışma fırsatı sunmaktır. Birlik Başkanı M. Rifat Hisarcıklıoğlu 14 Ekim 2021 de 11.00 -12.15 (TSİ) saatleri arasında "Komşuluk ve Genişleme" politikası kapsamında "Batı Balkanlar, Türkiye ve Doğu Ortaklığı ülkelerinde toparlanma için kilit faktörler" oturumuna katılım sağlayacaktır. Etkinliğin ve 3 gün boyunca yapılacak bütün oturumların dili İngilizce olup çeviri imkânı bulunmamaktadır. Etkinliğe https://chambers4eu.eu adresinden kayıt yapılabilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
15.09.2021
Mısır ile İlişkilerde Yaşanan Sorunlar
Sayın Üyemiz, Birliğimiz çalışmalarında yararlanılmak üzere, Mısır ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 20 Eylül 2021 Pazartesi günü mesai bitimine kadar Birliğimize (sila.kozanli@tobb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
14.09.2021
Autoshow 2021 Mobility fuarı
Değerli Üyelerimiz, Dijital ortamda, Otomotiv Distribütörleri Derneği (ODD)ev sahipliğinde gerçekleştirilenAutoshow 2021 Mobilityfuarı ziyarete açıldı. ODD web sitesinden tek adımla giriş yaparak dünyanın ilk dijital Autoshowunu sizler de ziyaret edebilirsiniz.http://www.odd.org.tr/autoshow2021/ 14-26 Eylül tarihleri arasında 2021 yılının bu en heyecanlı dijital etkinliğini, 7/24 mobil ve masa üstü tüm cihazlardan ziyaret edebilir, bu yepyeni teknolojiyi sizler de deneyimleyebilirsiniz. Saygılarımızla,
14.09.2021
2021-2022 EĞİTİM DÖNEMİ BURS BAŞVURU ŞARTLARI
T.C. Eskişehir Ticaret Borsası nın 2021-2022 öğretim yılında üniversite öğrencileri için sağlayacağı karşılıksız burs için başvuru koşulları ve başvuru formu ekte yer almaktadır. Bilgilerinize sunarız.
9.09.2021
Yeşil Dönüşüme Nasıl Ayak Uydurucağız? Webinar Daveti
Sayın Üyemiz, Birliğimiz bünyesinde yürütülen Avrupa Yeşil Mutabakatı çalışmaları kapsamında, "Yeşil Dönüşüme Nasıl Ayak Uyduracağız?" başlıklı bir webinar dizisi başlatılmıştır. 9 Eylül 2021 tarihinde saat 14.00 te otomotiv sektörleri özelinde gerçekleştirilecek webinarın konu başlıklarından bazıları aşağıda yer almaktadır. · Şirketiniz 2030 a hazır mı? · Karbon ayak izinizi biliyor musunuz? · Şirketinizin iklim karnesi nedir? · Fit For 55 nedir? · Sınırda Karbon Düzenlemesi ne getiriyor? · Türk ihracatçısı için tehditler-fırsatlar nelerdir? · Şirketler ne yapmalı? Webinar programı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
8.09.2021
AB’nin Dijital Kovid-19 Sertifika Sistemine Ülkemizin Dâhil Edilmesi
Sayın Üyemiz, Dışişleri Bakanlığı nın yazısına atfen, Avrupa Birliği nin (AB) "Dijital Kovid-19Aşı Sertifikası Sistemi"ne ülkemizin de dâhil edilmesi ve ülkemiz tarafından tanzim olunan aşı sertifikalarına eşdeğerlik verilmesine yönelik bir basın açıklaması yapıldığı ve konuyla ilgili bir Yeterlilik Kararı yayımlandığı bildirilerek, bahsi geçen basın açıklamasında; ülkemizin, Avrupa Birliği nin sertifika sistemine dâhil edileceği ve ülkemiz tarafından düzenlenen Dijital Aşı Sertifikalarının Avrupa Birliği tarafından düzenlenen sertifikalara denk olacağı ifade edilmekle birlikte, Kovid-19 salgını döneminde, AB ile ülkemiz, Kuzey Makedonya ve Ukrayna arasındaki güvenli seyahatin kolaylaştırılacağı belirtilmiştir. Yazıda devamla, bununla birlikte, 20.08.2021 tarihinde Avrupa Birliği Resmi Gazetesi nde yayımlanan Karar da; 26 Temmuz 2021 tarihinde yapılan değerlendirme neticesinde ülkemizin Kovid-19 kapsamındaki aşı, test ve iyileşme sertifikalarının 2021/953 sayılı Tüzükte belirtilen şartları taşıdığının tespit edildiği ve bu kararla birlikte, ülkemizin "Avrupa Birliği Dijital Kovid-19 Aşı Sertifikası Sistemi"ne dâhil edildiği ve Türkiye Cumhuriyeti tarafından "Health Pass" sistemine göre düzenlenen Kovid-19 aşı, test ve iyileşme sertifikalarının (sadece AB de onaylı Covid-19 aşıları için geçerlidir) Birlik içinde serbest dolaşım hakkının kolaylaştırılması amacıyla 2021/953 sayılı Tüzük uyarınca düzenlenen sertifikalara eşdeğer olduğunun kabul edildiği belirtilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
8.09.2021
Hububat ve Bakliyat İthalatında Gümrük Vergisi Sıfırlandı
Resmî Gazete’de yayınlanan karar ile buğday, arpa, çavdar, yulaf, mısır, mercimek, nohut ithalatında 31 Aralık 2021 tarihine kadar gümrük vergisi sıfırlandı. Resmi Gazete nin bugünkü sayısında yayımlanan ve ithalat rejimi kararında değişiklik yapan Cumhurbaşkanı kararı ekinde yer alan listeye göre, nohut, yeşil ve kırmızı mercimek, buğday, mahlut, tohumluk çavdar, beyaz ve maltlık arpa, tohumluk yulaf, mısır ve buğdaygiller ailesinden bir yem bitkisi olan sorgum tohumu ithalatında gümrük vergisi 31 Aralık a kadar sıfır olarak uygulanacak. Aynı gazetede yayımlanan ve ithalat rejimi kararında değişiklik yapan diğer Cumhurbaşkanı kararına göre ise kahve ithalatının gümrük vergisi AB ve EFTA ülkeleri için yüzde 11 den yüzde 6 ya, Kosova için yüzde 13 den yüzde 8 e, D-8 ülkeleri için yüzde 10 dan yüzde 8 e, ve diğer ülkeler için yüzde 13 den yüzde 8 e düşürüldü. Bu ürünün en az gelişmiş ülkelerden yapılan ithalatında ise gümrük vergisi yüzde 11 den yüzde 6 ya indirildi. Ayrıntılar için tıklayınız. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
8.09.2021
Endonezya - Merkez ve Doğu Avrupa İş Forumu
Sayın Üyemiz, Cakarta Ticaret Müşavirliğinden alınan yazıya atfen, Endonezya Dışişleri Bakanlığı tarafından 07 Ekim 2021 tarihinde 10:30-15:45 saatleri arasında (Türkiye saati ile) hibrit formatta "Endonezya - Merkez ve Doğu Avrupa İş Forumu"nun (Indonesia- Central and Eastern Europe Business Forum, INA-CEE) düzenleneceği bildirilmektedir (Endonezya Dışişleri Bakanlığınca Türkiye Avrupa ülkeleri arasında değerlendirilmektedir). Anılan yazıda devamla, "Doing Business with Indonesia: Asia s Economic Power House" teması iledüzenlenmesi planlanan INA-CEE platformuna iş dünyasının katılımcı veya ziyaretçi olarak katılım sağlayarak iş ilişkilerinin kurulması, paydaşlarla iletişim sağlanması ya da kendi ürünlerinin tanıtımı için kullanılabileceği ifade edilmektedir. Detaylı bilgi için organizasyon komitesi ile ina-cee@kemlu.go.id e-posta adresinden temasa geçilebileceği bildirilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
7.09.2021
Mahsul Yağlık Ayçiçeği Satış İhalesi.
Sayın Üyemiz, Dalaman Tarım İşletmesinin 2021 yılı istihsali 1.245.380 Kg. yağlık ayçiçeği mahsulü satış ihalesi 16.09.2021 Perşembe günü saat 14.00’ de Dalaman Tarım İşletmesinde yapılacak olup, ihaleye ait ilan ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
7.09.2021
Rusya Federasyonu ile E-Ticaret hk.
Sayın Üyemiz, Moskova Ticaret Müşavirliği nden alınan bir yazıya atfen, Rusya nın en önde gelen e-ticaret ve epazaryeri siteleri arasında yer alan OZON firması (https://corp.ozon.com) yetkilileri ile bir toplantı yapıldığı, anılan toplantıda firma yetkilileri tarafından gerçekleştirilen sunumda COVID-19 pandemisi sürecinde 2020 yılında Rusya da e-ticaret hacminin %59 oranında artarak 3,2 trilyon Rubleye (43,7 Milyar ABD Doları) ulaştığı, toplam satışların %86 sının ise yurt içi e-ticaret sitelerinden gerçekleştirildiği belirtilmiştir. Yazıda devamla, firma yetkililerince yabancı ülkelere yönelik olarak OZON web portalında ülke sayfalarının oluşturulduğu, anılan ülke sayfalarında ülkemiz firmalarının bir örneği EK-1 de yer alan tabloda belirtilen komisyon ücretleri dâhilinde öncelikle elektronik, sağlık ve bakım, hazır giyim, ev tekstili, kuru/sert kabuklu meyve ve diğer gıda ürünlerini (çabuk bozulabilen yaş meyve sebze, süt ve muhtelif et ürünleri hariç) doğrudan tüketiciye satabileceği, ilgili firmalarımız için gümrük/lojistik işlemlerinin ifası sırasında profesyonel bir aracı firma üzerinden destek sağlanabileceği ve söz konusu işlem bedellerine EK-2 de yer alan tablo üzerinden ulaşılabileceği ve bu doğrultuda ihracatçı firmalarımızdan daha çok ürün tedariki yapılmasının talep edildiği belirtilmiştir. Ayrıca, Moskova Ticaret Müşavirliğimizce de ülkemiz firmalarının OZON ile doğrudan iletişime geçebilmesini teminen, ilgili firma yetkililerinin iletişim bilgilerinin paylaşılmasının önemli olduğu, OZON firması yetkililerinin katılımıyla düzenlenecek olan bir "webinar" ile OZON da ürün satılırken dikkat edilmesi gereken hususlar hakkında bilgilendirme yapılmasının faydalı olacağı belirtilmiştir. Konuyla ilgilenen firmaların EK 3 te yer alan Firma Bilgileri Tablosu nu kendi taleplerine istinaden vebilgileri dahilinde doldurmaları halinde, söz konusu tablo Moskova Ticaret Müşavirliğimizce paylaşılmak üzere Ticaret Bakanlığımıza iletilecektir. Konuyla ilgili firmaların, Birliğimize (kaan.gaffaroglu@tobb.org.tr) bilgi vermelerini rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
7.09.2021
Türkiye-Kırgızistan İş Forumu
Sayın Üyemiz, Ağustos ayında yapılması planlanan ancak ülkemizdeki doğal afetler nedeniyle ertelenen "Türkiye-Kırgızistan Hükümetlerarası Karma Ekonomik Komisyonu (KEK) 10. Dönem Toplantısı"nın 10-11 Eylül 2021 tarihlerinde Bişkek te gerçekleştirilmesi planlanmaktadır. KEK Eş Başkanı T.C. Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay ın bu vesileyle yapacağı Kırgızistan ziyareti kapsamında, 10 Eylül 2021 tarihinde Türkiye-Kırgızistan İş Forumu Bişkek te düzenlenecektir. Sayın Cumhurbaşkanı Yardımcımız ve Kırgız Cumhuriyeti Bakanlar Kurulu Başkanı Sayın Ulukbek Maripov un teşrifleri ile gerçekleştirilmesi öngörülen İş Forumuna katılmayı arzu eden firma ve kurum temsilcilerinin 7 Eylül 2021 Salı günü saat 12.00 ye kadar portal.deik.org.tr/KatilimFormu/1305/17316 linkinden kayıt oluşturmaları gerekmektedir. Detaylı bilgi için (Elnur Osmanov, DEİK/Türkiye-Avrasya İş Konseyleri Koordinatörü, Tel.: 0212 339 50 67, eposta: eosmanov@deik.org.tr ) ile iletişime geçilebilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
7.09.2021
PEŞİN HUBUBAT SATIŞLARI (GENEL VE SÖZLEŞME BAZINDA)
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden alınan hububat satışları ile ilgili yazı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.09.2021
YANGIN/SEL FELAKETİ YARDIM KAMPANYASI
Sayın Üyemiz, Malumunuz olduğu üzere; son zamanlarda Türkiye nin farklı bölgelerinde yaşanan orman yangınları nedeni ile yardım kampanyası başlatılmış; daha sonra sel felaketi için de toplanacak yardımlar bu kampanyaya dahil edilmiştir. Söz konusu kampanyaya gösterilen yoğun ilgi üzerine Ankara Valiliğinden alınan izin ile kampanyanın süresi 01.10.2021 tarihinde son bulacak şekilde 1 ay uzatılmıştır. Diğer taraftan, kurumlar vergisi mükelleflerinin 13.08.2021 tarihli Resmi Gazete de yayımlanan 4372 sayılı Cumhurbaşkanlığı kararı ile açıklanan yardım kampanyası kapsamında yapmış oldukları bağışların Kurumlar Vergisi Kanununun 10 uncu maddesinin birinci fıkrasının e bendi kapsamında kurum kazancının tespitinde indirim konusu yapılabilecektir. Bu nedenle tüzel kişilerin göndereceği yardım için dekonta mümkün olduğunca adres ve telefon numaralarını eklemesi gerekmektedir. Yardım için açılan banka hesapları ektedir. Bilgilerinize rica olunur. Gültekin Güler Genel Sekreter
6.09.2021
Bölgesel Kalkınma, Yatırım İşbirliği Forum ve Fuarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği, Şanlıurfa Ticaret ve Sanayi Odası, Şanlıurfa Ticaret Borsası, Şanlıurfa Valiliği, Şanlıurfa Büyükşehir Belediyesi, GAP Bölge Kalkınma İdaresi Başkanlığı, Harran Üniversitesi ve Karacadağ Kalkınma Ajansı işbirliğinde düzenlenecek Bölgesel Kalkınma, Yatırım İşbirliği Forum ve Fuarı 2-3 Eylül tarihlerinde Şanlıurfa Uluslararası Fuar ve Kongre Merkezinde gerçekleştirilecektir. Fuar kapsamında aşağıdaki etkinlikler düzenlenecektir: Girişim Sermayeleri Anadolu Buluşmaları Bölgesel Kalkınma Sürecinde Kalkınma İdareleri ve Kalkınma Ajanslarının Rolü ve Önemi Paneli Gelişen ve Değişen Sektörün Yatırımcı ve Girişimcilere Sağladığı Kolaylıklar Paneli Akıllı Tarım Uygulamaları ve Kırsal Kalkınma Paneli Kalkınma Sürecinde Ulusal ve Küresel Fon Kuruluşlarının Rolü ve Sürdürülebilir Finans Uygulamaları Paneli Yöresel Kalkınmada E-Ticaretin Rolü Oturumu Türkiye Malzeme Ofisi (TMO) Bölgesel Sektör Toplantısı Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.08.2021
TÜBİTAK 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz organizasyonunda, 08 Eylül 2021 Çarşamba günü saat 10:00 da internet üzerinden, "TÜBİTAK 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı Bilgilendirme Semineri" düzenlenecektir. Seminere ilişkin davet ekte sunulmaktadır. TÜBİTAK, TOBB, TOBB ETÜ işbirliğinde internet üzerinden gerçekleştirilecek olan seminerde ilk çağrısı 2020 yılında yapılan, Türkiye de patent lisanslamaya bir kültür oluşturmak adına uygulamaya alınan ve müşteri kuruluşa 2 Milyon TL ye kadar %75 e varan destek sağlayan 1702 Patent Tabanlı Teknoloji Transferi Destekleme Çağrısı anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
31.08.2021
ÇİĞ SÜT DESTEĞİ VE SÜT PİYASASININ DÜZENLENMESİ UYGULAMA TEBLİĞİ (TEBLİĞ NO: 2021/22)’NDE DEĞİŞİKLİK YAPILMASINA DAİR TEBLİĞ (TEBLİĞ NO: 2021/32)
Sayın Üyemiz; 31.08.2021 tarih ve 31584 sayılı Resmi Gazetede yayımlananÇÇİĞ SÜT DESTEĞİ VE SÜT PİYASASININ DÜZENLENMESİ UYGULAMATEBLİĞİ (TEBLİĞ NO: 2021/22)’NDE DEĞİŞİKLİK YAPILMASINADAİR TEBLİĞ (TEBLİĞ NO: 2021/32)aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
31.08.2021
Kamu Alacaklarının Yapılandırma Süresi 1 Ay Uzatıldı
Sayın Üyemiz, Bazı kamu alacaklarının yapılandırmasını düzenleyen 7326 sayılı kanunda, 31 Ağustos 2021 olan son başvuru ve ilk taksit ödeme süresi 1 ay uzatıldı. Resmi Gazete nin 27 Ağustos 2021 gün 31581 no lu sayısında yer alan Cumhurbaşkanı kararına göre; bazı kamu alacaklarının yeniden yapılandırılması için ön görülen son başvuru ve ilk taksit ödeme süresi 31 Ağustos 2021 tarihinden 1 ay sonrasına ertelendi. Karar, 7326 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılmasına İlişkin Kanun kapsamında yer alan; bazı vergi ve vergi cezaları, gecikme faizi ve gecikme zamları, idari para cezaları, sigorta primi, emeklilik keseneği, işsizlik sigortası primi, sosyal güvenlik destek primi ile bunlara bağlı gecikme cezası ve gecikme zammı alacakları, belediyelerin bazı alacaklarının yeniden yapılandırılmasını kapsıyor. İlgili karara ulaşmak için tıklayın. Genel Sekreter Gültekin Güler
31.08.2021
NAKDİ BAĞIŞLARIN KURUM KAZANCINDAN İNDİRİLMESİ
Sayın Üyemiz, Ankara Valiliği nin 2/8/2021 ve 17/8/2021 tarihli olurları ile orman yangınlarından ve sel felaketlerinden etkilenen afetzedelerin zararlarının karşılanmasına katkı amacıyla Birliğimizce 3/8/2021 tarihinde kampanya başlatılmıştır. Yardım kampanyası oda ve borsaların yanı sıra üyelerin de değerli katkılarıyla halen sürmektedir. Kampanyaya değerli katkılarıyla destek veren kurumlar vergisi mükelleflerinin, nakdi bağışlarının kurum kazancından indirim konusu yapılabilmesiyle ilgili olarak Gelir İdaresi Başkanlığı ndan Birliğimizce talepte bulunulmuştur. Gelir İdaresi Başkanlığı cevabi yazısında, 5520 sayılı Kurumlar Vergisi Kanunu nun 10/1-e maddesi uyarınca Cumhurbaşkanı nca başlatılan yardım kampanyalarına makbuz karşılığı yapılan ayni ve nakdî bağışların tamamının vergi yükümlülerince beyanname üzerinden indirim konusu yapılabileceğine işaret etmiştir. Yazıda belirtildiği üzere; kampanya kapsamında duyurulan banka hesaplarına, aktarılan bağış tutarlarının, Birliğimizce 4372 sayılı Cumhurbaşkanı Kararı nın yürürlük tarihi olan 13/8/2021 tarihinden sonra (bu tarih dahil), bu karar kapsamındaki Acil ve Afet Yönetimi Başkanlığı nca duyurulan hesaplara aktarılması kaydıyla, kurumlar vergisi matrahının tespitinde indirim konusu yapılabilmesi mümkün bulunmaktadır. Bu kapsamda her bir mükellefe ilişkin bilgiler ile yapılan bağış tutarının ayrı ayrı gösterildiği makbuz veya banka dekontlarının indirimin tevsiki için muhafazası gerektiğinden, ilgili belgeler Birliğimizce bağış yapan kurumlar vergisi mükelleflerine iletilecektir. Kurumlar vergisi mükellefi üyelerimizin bilgilerine sunulur. Gültekin Güler Genel Sekreter
31.08.2021
CEYLANPINAR TARIM İŞLETMESİ MÜDÜRLÜĞÜ NE AİT 2021 YILI 2.000 TON MAHSUL YAĞLIK AYÇİÇEĞİ SATIŞI PAZARLIK
Sayın Üyemiz, 27.08.2021 cuma günü saat 10.00’da Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 2.000 ton mahsul yağlık ayçiçeği 7 (yedi) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.08.2021
CEYLANPINAR TARIM İŞLETMESİ MÜDÜRLÜĞÜ NE AİT 50.000 DEKAR PARSELDE MISIR SAPI SATIŞI PAZARLIK
Sayın Üyemiz, 27.08.2021 cuma günü saat 11.00’de Ceylanpınar Tarım İşletmesinde 50.000 dekar parselde mısır sapı 2 (iki) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
26.08.2021
Hamburg Invest le tanışın
Sayın Üyemiz, Hamburg Yatırım Ajansı (HIW) adına düzenlenecek olan “Hamburg - Kuzey deki İş Metropolü ve Ticaret Bağlantı Noktası” etkinliğine sizleri davet etmekten mutluluk duyuyoruz. Etkinlikte, Hamburg da şirket kuruluşu ve fırsatlar hakkında bilgilendirme ve başarı hikâyelerinin sunumu yapılacaktır. HIW Ajansı, Hamburg eyaletinin resmi Kalkınma Ajansı olarak, şirketler ve yatırımlar için tüm hizmetleri tek noktadan sunmaktadır. Hamburg yüksek ekonomik gücü ve yaşam kalitesi sayesinde, Kuzey Avrupa nın “dünyaya açılan kapısı” ve ekonomik kalbi olarak kabul görmektedir. Avrupa Birliği nin en göz alıcı metropollerinden biri olmakla beraber her ülkenin önemli şirketleri, kurumları ve uzmanları için bir cazibe merkezidir. Hamburg, ticaret merkezi olarak bin yıllık bir geleneğe sahiptir ve dünyanın dördüncü büyük ekonomisi olan Almanya’nın en büyük ikinci şehridir. 830 yıl önce gerçekleşen liman kuruluşundan bu yana Hamburg da, kozmopolitlik, hoşgörü ve misafirperverlik sürekli olarak gelişmeye devam etmiştir. Günümüzde teknoloji, üretkenlik ve araştırma alanlarında önemli bir yere sahip olan Hamburg, bunu 18. yüzyılından itibaren önemli bir endüstri merkezi olmasına borçludur. Etkinliğe katılım ücretsizdir, ancak dijital bilgilendirme toplantısına kayıt yapmanız zorunludur. Güncel program akışınıburadabulabilirsiniz. Dijital bilgilendirme toplantısına kaydınızı aşağıdaki butondan oluşturabilirsiniz. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
26.08.2021
İşletme Değerlendirme Raporu (İDR)
Sayın Üyemiz, İşletmelerin mevcut durumlarını, sektörünün gelişimini, sektör içerisindeki konumlarını görebilmeleri ve ekonomik faaliyetlerinin yürütülmesinde alacakları kararlara yardımcı olması, ulusal ve uluslararası iş ilişkilerinde ve finans kuruluşlarında referans olarak kullanabilmeleri amacı ile 2016-2020 yıllarına ilişkin idari kayıtlar esas alınarak Türkçe ve İngilizce olarak hazırlanan, İşletme Değerlendirme Raporu (İDR) nin 2020 versiyonu e-devlet üzerinden işletmelerin erişimine ücretsiz olarak açılmış bulunmaktadır. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
26.08.2021
İşyerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, Birliğimiz organizasyonunda, 1 Eylül 2021 Çarşamba günü saat 14.00’te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
26.08.2021
Arjantin Hk.
Sayın Üyemiz, Eş başkanlığı Sanayi ve Teknoloji Bakanı Sayın Mustafa VARANK ile Arjantin Dışişleri, Uluslararası Ticaret ve Din İşleri Bakanlığı Uluslararası Ekonomik İlişkiler Devlet Sekreteri Jorge NEME tarafından yürütülen Türkiye-Arjantin Karma Ekonomik Komisyon IV. Dönem Toplantısı nın 29 Eylül-1 Ekim 2021 tarihleri arasında Ankara da düzenlenmesinin kararlaştırıldığı bildirilmektedir. Bu kapsamda, Ticaret Bakanlığı tarafından Türkiye-Arjantin KEK IV. Dönem Toplantısı na yönelik hazırlık çalışmalarında yararlanmak üzere, Türkiye - Arjantin ticari ve ekonomik ilişkilerinde yaşanan sorunlar ve çözüm önerilerine dair görüşlerinizin 7 Eylül 2021 Salı günü mesai bitimine kadar Borsamıza (Egemen Akbulut, eposta:egemenakbulut@esktb.org.tr) iletilmesini ricaederiz. Gültekin Güler Genel Sekreter
26.08.2021
Türkiye-Yunanistan Gümrük İdareleri Başkanları 3. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Yunanistan Gümrük İdareleri Başkanları 3. Toplantısı nın 9-10 Eylül 2021 tarihlerinde İstanbul da düzenlenmesi planlanmaktadır. Bu itibarla, anılan toplantı hazırlıklarında kullanılmak üzere Yunanistan ile ikili gümrük alanında gündeme getirilmesinde fayda görülen sorun, öneri ve yeni iş birliği imkanları yaratılması hususunda görüşlerinizin 31 Ağustos 2021 tarihine kadar Borsamıza (Egemen Akbulut, eposta:egemenakbulut@esktb.org.tr) iletilmesini rica ederiz. Gültekin Güler Genel Sekreter
26.08.2021
Bazı Faaliyetler İçin PCR Zorunluluğu
Sayın Üyemiz, İçişler Bakanlığı-İller İdaresi Genel Müdürlüğünce hazırlanan PCR zorunluluğu konulu yazıya ait detaylar aşağıdadır. Koronavirüs(Covid­19)salgınınıntoplumsağlığıvekamudüzeniaçısındanoluşturduğuriskinasgari seviyeyedüşürülmesiiçinsalgınlamücadelesürecinintemelprensipleriolantemizlik,maskevemesafe kurallarınınyanısırasalgınlamücadeledeelimizdekiengüçlüunsurgönüllülükesasınagöreyürütülen aşılamafaaliyetleridir. Ülkemizdeaşılamaçalışmalarındabüyükmesafealınmışolupaşıprogramınadahiledilenlerbaz alındığındabirincidozaşılamada%73,ikincidozaşılamadaise%55,5düzeyineulaşılmıştır.Aşılama faaliyetlerindeönemlibirivmeninyakalandığıbudönemdeaşılamasüreçlerinitamamlamışkişilerdesalgın kaynaklıvaka,hastavevefatsayılarınınoldukçadüşükseviyelerdeolduğugörülmektedir. Önümüzdekidönemdedesalgınlamücadeleninbaşarılıbirşekildesürdürülmesi,vaka,hasta,yoğun bakımvevefatsayılarınınasgariseviyeleredüşürülmesivesalgınınolumsuzekonomikvesosyaletkilerinin tamamenbertarafedilerekkalıcıvesürdürülebilirnormalleşmeninsağlanmasıaçısındantoplumunbazı kesimlerindemevcutolanaşılamayailişkintereddütleringiderilerekaşılamanıntoplumsalbağışıklığı sağlayacakdüzeyegetirilmesigiderekönemkazanmaktadır. Budoğrultuda,SayınCumhurbaşkanımızınbaşkanlığında19Ağustos2021tarihindetoplanan CumhurbaşkanlığıKabinesindesalgınınülkemizdekiseyri,aşılamafaaliyetlerindekatedilenmesafe,yerli aşıgeliştirilmesineyönelikçalışmalarveaşılamafaaliyetlerineilişkintoplumunbazıkesimlerindegözlenen tereddütkonularıSağlıkBakanlığıveKoronavirüsBilimKurulununtavsiyelerigözönündebulundurularak elealınmışveaşağıdakitedbirlerinhayatageçirilmesinekararverilmiştir. 1.Aşılamaçalışmalarıgönüllülükesasınagöreyürütülmeyedevamedilmeklebirlikteaşıyakarşı tereddütiçerisindeolankesimlerinkaygıvetereddütlerinigidermeyeyönelikbilgilendirmeverehberlik faaliyetlerinevalivekaymakamlarınkoordinasyonundaağırlıkverilecektir.Buamaçlailgilikamukurumve kuruluşlarının,yerelyönetimlerin,siviltoplumkuruluşlarının,muhtarlarınvekanaatönderlerininkatılımı vedesteğiylegeniştabanlıçalışmalaryürütülecektir. 2.6Eylül2021Pazartesigünündenitibarenaşıolmayankişilerin;konser,sinema vetiyatrogibi vatandaşlarımızıntopluolarakbulunduğufaaliyetlerekatılımındanegatifsonuçluPCRtestizorunluluğu getirilecektir.Buçerçevedeişletmeciler/organizatörlertarafındanetkinlikleregirişteHESkoduüzerinden kişilerinaşılı/geçirilmişhastalık(Covid­19hastalığısonrasıbilimselolarakbağışıkkabuledilensüreye göre)veyaazami48saatönceyapılmışnegatifPCRtestisorgulamasıyapılacaktır.Kişihastalığı geçirmemişveyaaşılıdeğilveyanegatifPCRtestiyokiseetkinliğekatılmasınamüsaadeedilmeyecektir. 3.Aşısızveyahastalığıgeçirmemişkişilerinözelaraçhariçuçak,otobüs, trenveyadiğertoplu ulaşımaraçlarıylagerçekleştireceklerişehirlerarasıseyahatleriçindenegatifsonuçluPCRtesti bulunmalıdır. Buçerçevede6Eylül2021Pazartesigünündenitibarenseyahatfirmalarınca aracakabul aşamasında HESkoduüzerindenkişilerinaşılı/geçirilmişhastalık(Covid­19hastalığısonrasıbilimsel olarakbağışıkkabuledilensüreyegöre)veyaazami48saatönceyapılmışnegatifPCRtestisorgulaması yapılacaktır.KişihastalığıgeçirmemişveyaaşılıdeğilveyanegatifPCRtestiyokisebukişilerinseyahatine müsaadeedilmeyecektir. 4. Valilikler/kaymakamlıklarcaillerinde/ilçelerindekişilerintopluolarakbulunduğudiğeretkinlikler veyafaaliyetlerdenfaydalanacakhastalığıgeçirmemişveyaaşısızkişileriçinİl/İlçeHıfzıssıhhaKurulu kararlarıylaHESkoduüzerindenPCRtestkontrolüzorunluluğugetirilebilecektir. 5.Salgınsüreciilebirliktemesafekuralıdoğrultusundaimtinaedilensarılmavetokalaşmabenzeri davranışlarınözelliklesondönemdetoplumiçerisindeyaygınlaştığıgörülmektedir.Kültürümüzünbir parçasıolmaklabirliktesalgınlamücadelesürecindesalgınınyayılımınıartırantokalaşma/sarılmagibi faaliyetlerdenbirmüddetdahauzakdurulmasınınönemininvatandaşlarımızahatırlatılmasınayönelik çalışmaların sürdürülmesigerekmektedir. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
25.08.2021
Binalarda Yenilenebilir Enerji - Solar ve Jeotermal ve Enerji Verimliliği
Sayın Üyemiz, Almanya dan ilgili firmaların katılımları ile 14 Eylül 2021 tarihinde elektronik ortamda "Binalarda güneş enerjisi ve jeotermal enerji odağında yenilenebilir enerji ve enerji verimliliği" konulu bir sempozyumun gerçekleştirilmesi öngörülmektedir. Sempozyum kapsamında, Türkiye den ve Almanya dan uzman konuşmacıların katılımıyla çerçeve koşulları, teknolojik gelişmeler ve iyi uygulama örneklerinin ele alınması planlanmaktadır. Sempozyumda Almanca-Türkçe simültane tercüme hizmeti sunulacaktır. Ayrıca, sempozyumu takiben, Türk ve Alman firma temsilcileri arasında elektronik ortamda görüşmeler düzenlenecektir. Sempozyuma kayıt yaptırmak, sempozyumda yer alacak Alman firmaların faaliyet ve ilgi alanlarına ilişkin detaylı bilgiye ulaşmak ve ikili görüşmelere katılmak için www.dtr-ihk.de/tr/etkinlikler/etkinlikbilgileri/erneuerbare-energien-und-energieeffizienz-in-gebaeuden-mit-fokus-auf-solar-und-geothermielinkinin ziyaret edilmesi gerekmektedir. Bilgilerinize önemle sunarız. Gültekin Güler Genel Sekreter
25.08.2021
CEYLANPINAR TARIM İŞLETMESİ MÜDÜRLÜĞÜ NE AİT 2021 YILI 3.840 TON MAHSUL YAĞLIK AYÇİÇEĞİ SATIŞI PAZARLIK
Sayın Üyemiz, 26.08.2021 perşembe günü saat 10.00’da Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 3.840 ton mahsul yağlık ayçiçeğinin 13 (on üç) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.08.2021
CEYLANPINAR TARIM İŞLETMESİ MÜDÜRLÜĞÜ NE AİT 2021 YILI 2.600 TON MAHSUL YAĞLIK AYÇİÇEĞİ SATIŞI PAZARLIK
Sayın Üyemiz, 25.08.2021 çarşamba günü saat 10.00’da Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 2.600 ton mahsul yağlık ayçiçeğinin 9 (dokuz) parti halinde pazarlık usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.08.2021
CEYLANPINAR TARIM İŞLETMESİ MÜDÜRLÜĞÜ NE AİT 5.000 TON BALYALI BUĞDAY SAPI SATIŞI
Sayın Üyemiz, 02.09.2021 perşembe günü saat 14:00 de Ceylanpınar Tarım İşletmesinde 5.000 ton balyalı buğday sapı 7 (yedi) parti halinde açık artırma usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
24.08.2021
Münster de FMO nun Türk Yatırımcılar Tarafından Ofis ve Lojistik Merkezi Olarak Kullanılması
Sayın Üyemiz, Münster Başkonsolosumuzun Kuzey Vestfalya Sanayi ve Ticaret Odası ile Münster-Osnabrück Havalimanı (FMO) yetkilileriyle gerçekleştirdiği görüşmeye ilişkin Dışişleri Bakanlığı nın bir yazısında özetle, pandemi sürecinden olumsuz etkilenen FMO nun yabancı yatırımcılar için bir ofis ve lojistik merkezi12 bin metrekare) haline getirilmek istendiği ve buna ilaveten 10 hektarlık alana 2 kiralama ya da satın alma yoluyla lojistik, kargo ve depolama alanlarının inşa edileceği, Münster in Kuzey-Güney (Köln-Hamburg) ve Doğu-Batı (Amsterdam-Berlin) ekseninde bir çok önemli kent ve limana kısa sürede ulaşım imkanı sunduğu belirtilmekte olup, yatırım yapmak isteyen Türk şirketleri için bölgenin avantajlı olduğu bildirilmektedir. Söz konusu yazıda ayrıca, FMO dan Corendon ve Sun Express şirketleri tarafından Ülkemizde Antalya,Adana, Ankara, İzmir, Kayseri ve Zonguldak olmak üzere altı şehre uçuşlar gerçekleştirildiği, FMO kullanan en büyük yolcu grubunu vatandaşlarımızın oluşturduğu, öte yandan THY nin FMO-İstanbul Havaalanıarasında sefer başlatmasının arzu edildiği kaydedilmektedir. Yazıda devamla, Almanya nın, Avrupa da hem en büyük ticaret ortağımız hem de önemli bir transit geçiş ülkesi olması nedeniyle ve de bölgede yaşayan Türk nüfusu dikkate alındığında, ikili ilişkilerimizin daha üst seviyeye çıkarılması açısından bölgeye yatırım yapılmasının önemli kazanç sağlayacağının düşünüldüğü ifade edilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
20.08.2021
Standardizasyon Sisteminin Geliştirilmesi ve Farkındalığın Artırılmasına Yönelik Teknik Yardım Projesi Bilgilendirme Semineri
Sayın Üyemiz, Avrupa Birliği ve Türkiye Cumhuriyeti ortak finansmanıylaTürk Standardları Enstitüsü (TSE)tarafından yürütülen "Standardizasyon Sisteminin Geliştirilmesi ve Farkındalığın Artırılmasına Yönelik Teknik Yardım Projesi"Standartlara Yön Ver!farkındalık kampanyası kapsamında düzenlenen bilgilendirme semineri25 Ağustos 2021 Çarşambagünü09.30- 15.30saatleri arasındaRamada Plaza by Wyndham Eskişehir’de düzenlenecektir. Projemiz, ülkemizdeki standardizasyon çalışmalarına çağdaş ve profesyonel bir yaklaşım getirmeyi amaçlamakta; bu kapsamda kurulum çalışmaları devam eden Çevrimiçi Standardizasyon Platformu yoluyla, standardizasyon sistemini ülke geneline yaymayı, etkinliğini, verimliliğini ve paydaş katılımını iyileştirerek standardizasyon konusunda kamuoyu bilincini oluşturmayı hedeflemektedir. Bu bağlamda, ürün ve hizmetlerin kalite standartlarını oluşturmak için tüketicilerin, sanayicilerin ve üniversitelerin katkısının önemini vurgulamak, görüş ve önerilerini almak ve söz konusu platformu tanıtmak amacıyla düzenlediğimiz seminerimize katılımınızdan büyük memnuniyet duyarız. Elektronik davetiyemiz ekte bilginize sunulmuştur. Ekin yüklenmemesi halindeburayatıklayarakdavetiyemizi görüntüleyebilirsiniz. Katılımınızı bildirmek içinanil.yazicilar@wygprojects.comveyailayda.karakapici@wygprojects.comadresine mail atabilir veya +90 549 800 64 76 numaralı telefonu arayabilirsiniz. Her türlü sorunuz için; Anıl Yazıcılar,anil.yazicilar@wygprojects.com,+90 549 800 64 76 İlayda Karakapıcı,ilayda.karakapici@wygprojects.com Gültekin Güler Genel Sekreter
20.08.2021
Yardım Kampanyası hk.
Sayın Üyemiz, Ülkemizde son günlerde yaşanan orman yangınları ve sel felaketlerinin meydana getirdiği tahribatın giderilmesi ve afetlerden zarar gören vatandaşlarımızın mağduriyetlerinin bir an evvel karşılanması için başlatılan insani yardım kampanyası kapsamında, Batı Karadeniz Sel Felaketi Ayni Yardım İhtiyaç Listesi ve Ayni Yardım Toplama Depoları ve İletişim Bilgileri ekte bilgilerinize sunulmuştur. Gültekin Güler Genel Sekreter
19.08.2021
AB nin Import One Stop Shop (IOSS) KDV Sistemi
Sayın Üyemiz, Avrupa Birliği nin (AB) sınır ötesi e-ticaret işlemlerinde uyguladığı yeni Katma Değer Vergisi (KDV) kurallarının, 1 Temmuz 2021 tarihinden itibaren yürürlüğe konacağıyla ilgili bilgi verilmişti. AB nin söz konusu kurallara dair işletmeden tüketiciye (B2C) satışlar özelinde, kıymeti 150 Avro yu aşmayan sevkiyatlarda geçerli olacak "Import One Stop Shop (IOSS)" adında yeni bir KDV sistemi kurduğu açıklanmıştır. Yazıda devamla, bahse konu sistemin işleyişi ile ilgili Ticaret Bakanlığı Gümrükler Genel Müdürlüğünce bir broşür hazırlandığı belirtilmiştir. İlgili broşür ekte yer almaktadır. Bilgilerinize sunarız. Genel Sekreter Gültekin Güler
19.08.2021
AB Sınırda Karbon Düzenleme Mekanizması Taslağı Geri Bildirim Süreci
Sayın Üyemiz, Bilindiği üzere, 11 Aralık 2019 tarihinde açıklanan Avrupa Yeşil Mutabakatı ile AB, 2030 yılına yönelik sera gazı emisyon azaltımını en az %55 oranına yükseltmeyi ve Avrupa’nın 2050 yılına kadar dünyanın ilk iklim-nötr kıtasına dönüştürülmesi hedefini ortaya koymuş ve AB’nin söz konusu hedeflerinin yasal çerçevesini oluşturan AB’nin ilk İklim Kanunu 9 Temmuz 2021 tarihinde AB Resmi Gazetesinde yayımlanmıştır. Avrupa İklim Kanunu ile yasalaşan hedeflere ulaşmak amacıyla Avrupa Komisyonu tarafından 14 Temmuz 2021 tarihinde bir dizi yasal düzenleme içeren “Fit for 55” yeşil paket taslağı sunulmuştur.“Fit for 55” isimli “yeşil paket” taslağının yasalaşması uluslararası ticaret için çok önemli sonuçlar doğuracaktır. Nitekim, anılan paket, mevcut AB Emisyon Ticareti Sisteminin sıkılaştırılarak deniz ve kara ulaştırmasına yansıtılması, sınırda karbon düzenlemesi, yenilenebilir enerji kullanımının artırılması, daha fazla enerji verimliliği, düşük emisyonlu ulaşım modlarının ve bunları destekleyecek altyapı ve yakıtların daha hızlı kullanıma sunulması, bu kapsamda motorlu araçlarda fosil yakıt kullanıma 2035 itibariyle son verilmesi, vergilendirme politikalarının Avrupa Yeşil Mutabakatı hedefleriyle uyumlu hale getirilmesi ve benzeri bir çok önlemi içermektedir. “Fit for 55” paket taslağı kapsamında yer alan düzenlemeler arasında, özellikle ihracatçılarımız tarafından yakından takip edilen Sınırda Karbon Düzenleme Mekanizması (SKD) kapsamında AB, öngörülen politika değişikliklerinin Avrupa sanayi üzerinde yaratacağı maliyet karşısında Avrupa’nın rekabetçiliğinin korunabilmesi ve üretimin emisyon azaltım hedefi AB’den az olan ülkelere kaymasının (karbon kaçağının) önlenmesini hedeflemektedir. Fit for 55 paket taslağı kapsamında birbiri ile bağlantılı ve birbirlerini tamamlayan politika tedbirlerine ve SKD taslağına ilişkin hazırlanan bilgi notu ekte sunulmaktadır. Bilindiği üzere, Avrupa Komisyonu tarafından “Sınırda Karbon Düzenlemesi” mekanizmasının içeriğinin belirlenmesi ve bundan etkilenebilecek tüm paydaşlarla birlikte etkilerinin ele alınabilmesi adına 4 Mart-1 Nisan 2020 tarihleri arasında bir “geri bildirim süreci” ile 22 Temmuz-28 Ekim 2020 tarihinde ise 3 aylık bir kamu danışma süreci yürütülmüştür. Bu çerçevede, ilgili özel sektör temsilcilerimiz ile kamu kurumlarımız tarafından Bakanlığımıza intikal ettirilen görüşler de dikkate alınarak ülke görüşlerimiz (https://ticaret.gov.tr/dis-iliskiler/avrupa-birligi/sinirda-karbon-duzenleme-mekanizmasi) hazırlanmış ve Avrupa Komisyonuna iletilmiş bulunmaktadır. Bu defa, Avrupa Komisyonu tarafından açıklanan sınırda karbon düzenleme mekanizmasıtaslağına ilişkin geri bildirim süreci başlatılmış olup; 5 Ekim 2021 tarihine kadar devam edecek süreç kapsamında Komisyona iletilecek geri bildirimlerin, Komisyon tarafından mevzuat çalışmaları çerçevesinde Parlamento ve Konseye iletileceği belirtilmektedir. Ülkemiz sektörlerinin de hem kendileri hem de AB’de yakın işbirliği içinde oldukları sektör/kullanıcı sektör kuruluşları aracılığıyla sınırda karbon düzenleme mekanizması taslağının nihai hale getirilmesine ilişkin bu süreçte görüşlerini mümkün olduğu ölçüde yansıtmalarının önem arz ettiği düşünülmektedir. Bu çerçevede, geri bildirimde bulunmak isteyen kuruluşlarımızın, https://ec.europa.eu/info/law/better-regulation/have-your-say/initiatives/12228-EU-Green-Deal-carbon-border-adjustment-mechanism-_en linki üzerinden görüşlerini iletmeleri mümkündür. Bu çerçevede, SKD taslağı metni de istifadeleri için ekte sunulmaktadır. Ayrıca, söz konusu geri bildirim kapsamında, varsa Komisyona iletilmesinde fayda görülen hususların Bakanlığımız ile de paylaşılması halinde, Avrupa Komisyonu nezdinde dikkate getirilmesi de mümkün olacaktır. Bilgilerinizi ve söz konusu geri bildirim süreci kapsamında varsa Bakanlığımıza iletilmesinde fayda görülen hususların en geç 3 Eylül 2021 tarihine kadar abtekpazar@ticaret.gov.tr adresine iletilmesi hususunda gereğini rica ederiz. Gültekin Güler Genel Sekreter
19.08.2021
Bangladeş le Ticaret Yapan Firmalarımıza Yönelik Uyarı
Sayın Üyemiz, Bangladeş te Md. Sakhawat Hossain isimli şahsın Türkçe bilmesinin avantajını da kullanarak Türk firmalarla kurmuş olduğu ilişkilerde kötü niyetli ve dolandırmaya yönelik davranışlar sergilediği yönünde şikayetler alındığı, son günlerde bazı Türk firmalarla denim/denim kumaşı ticareti yapacağı (veya yapmakta olduğu) bilgisi edinildiği bildirilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
19.08.2021
ETUYS Yetkilendirme KEP ile Evrak Gönderimi
Sayın Üyemiz, Borsamıza iletilen; Elektronik Teşvik Uygulama ve Yabancı Sermaye Bilgi Sistemi (E-TUYS) yetkilendirmesi için yapılacak başvurulara dair yazı ekte yer almaktadır. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
17.08.2021
Hibe Satışlar
Sayın Üyemiz, Filistin de yaşanan insani krize müdahale kapsamında ekmeklik buğday karşılığı 26.000 ton (±%20 TMO opsiyonunda) çuvallı unun temini ihalesi 19.08.2021 günü, saat 10.30 de TMO Genel Müdürlüğünde yapılacak olup konu ile ilgili detaylar ektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
17.08.2021
Helal Akreditasyon İşlemleri
Sayın Üyemiz, Helal Akreditasyon Kurumu tarafından Birliğimize iletilen 06.08.2021 tarih ve 66117731 sayılı "Helal Akreditasyon İşlemleri" konulu yazı kapsamında, "Personel Belgelendirme Kuruluşlarının Helal Akreditasyonu" ve "Helal Uygunluk Alanında Deney Yapan Laboratuvarların Akreditasyonu" olmak üzere iki yeni akreditasyon programının oluşturulduğu bilgisi iletilmekte olup bahsi geçen programlara yönelik oluşturulan temel uygulama dokümanlarınawww.hak.gov.tr/helal-akreditasyon/helal-akreditasyon-programlari adresi üzerinden erişilebildiği ifade edilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
16.08.2021
Kazakistan’da yaşanan işçi sorunları
Sayın Üyemiz, Dışişleri Bakanlığı ndan alınan yazıya atfen, Kazakistan da iş yapan bazı firmaların istihdam ettiği işçilerin hak edişlerinin ödenmesi ve yurda dönüşleri konusunda basına da yansıyan sorunlar yaşandığı; hem işçilerin mağduriyetine, hem genel olarak Türk firmalarının itibarının zedelenmesine yol açan bu tür sorunların çoğunlukla işçilerin çalışma vizesi ve/veya iş sözleşmesi bulunmadan Kazakistan a getirilmesinden ve kayıt dışı çalıştırılmasından kaynaklandığının bilindiği; işçilerin ise, bilgi eksikliği veya seçeneksizlik nedeniyle bu şartlarda istihdamı kabul ettikleri ifade edilmektedir. Söz konusu yazıda devamla, Nur-Sultan Büyükelçiliğimizin bu sorunların önlenmesi amacıyla; Kazakistan da proje üstlenen şirketlerimizin, projeyi üstlenme aşamasında yerel makamlardan ülkemizden işçi getirmelerine izin verileceğine ve bu işçilerin giriş-çıkış ve çalışma izinleri konusunda gerekli kolaylığın sağlanacağına dair yazılı taahhüt almalarını veya çalıştıracakları işçilere öncesinde uzun süreli çalışma vizesi temin etmelerini tavsiye ettiği belirtilmektedir. Bilgilerinize rica ederim. Gültekin Güler Genel Sekreter
13.08.2021
Türkmenistan ile Yaşanan Sorunlar
Sayın Üyemiz, Eşbaşkanlığını Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay tarafından deruhte edilen Türk-Türkmen Komisyonu (HEK) 6. Dönem toplantısının 9-10 Eylül 2021 tarihlerinde gerçekleştirileceği ifade edilerek, firmalarımızın Türkmenistan da yaşadıkları sorunlar ve bu sorunların aşılmasına yönelik olası çözüm önerilerine dair görüşler talep edildiği bildirilmektedir. Bilgilerinizi ve iki ülke arasında yaşanan sorunlara dair ilişkin görüşlerin derlenerek 16 Ağustos 2021 tarihi saat 14.00 e kadar Borsamıza (egemenakbulut@esktb.org.tr) adresine iletilmesini rica ederiz. Gültekin Güler Genel Sekreter
12.08.2021
Kuşak ve Yol Zirvesi Kayıt Kodu
Sayın üyemiz, Daha önceden duyurusunu yaptığımız Kuşak ve Yol Zirvesi nin kayıt koşullarında güncelleme olmuştur. Buna göre, kayıt aşamasında 06P30SOCGTUR kodunun girilmesi gerektiği, bu kod ile %30 indirimli fiyat uygulanacağı ve anılan kodun 20 Ağustos a dek geçerli olduğu kaydedilmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
12.08.2021
Kongo Demokratik Cumhuriyeti Bilgi Notu
Sayın Üyemiz, Kongo Demokratik Cumhuriyeti (KDC) Cumhurbaşkanı Félix Tshisekedi nin ülkemize yakın zamanda resmi bir ziyaret gerçekleştirmek istediği bildirilmektedir. Bu kapsamda, bahse konu ziyaretin hazırlık çalışmalarında yararlanılmak üzere Kongo Demokratik Cumhuriyeti ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 13 Ağustos Cuma gününe kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
12.08.2021
Sayın Bakanımızın Irak Ziyareti
Sayın Üyemiz, Ticaret Bakanımız Sayın Mehmet MUŞ tarafından 18-19 Ağustos 2019 tarihlerinde Irak a bir ziyaret gerçekleştirilmesinin planlandığı bildirilmektedir. Bu kapsamda, bahse konu ziyaretin hazırlık çalışmalarında yararlanılmak üzere Irak ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin 12 Ağustos 2021 Perşembe günü (bugün) saat 15.00 e kadar Borsamıza (egemenakbulut@esktb.org.tr) iletilmesi gerekmektedir. Bilgilerinize rica ederiz. Gültekin Güler Genel Sekreter
12.08.2021
CEYLANPINAR TARIM İŞLETMESİ MÜDÜRLÜĞÜ NE AİT 2021 YILI MAHSUL YAĞLIK AYÇİÇEĞİ SATIŞI AÇIK ARTIRMA
Sayın Üyemiz, 17.08.2021 salı günü saat 14.00’de Şanlıurfa ticaret borsası buğday pazarında 2021 yılı istihsali 2.600 ton mahsul yağlık ayçiçeğinin 9 (dokuz) parti halinde açık artırma usulü ile satışı yapılacaktır. İhale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
10.08.2021
Ukrayna Firma Sorunları
Sayın Üyemiz, Ticaret Bakanımız Mehmet Muş ile Ukrayna Ekonomi Bakanı Oleksiy Lyubçenko arasında Ağustos ayı içerisinde bir görüşmenin gerçekleştirilmesi planlandığı ve söz konusu görüşmede gündeme getirilmek üzere Ukrayna ile iş yapan (yatırım ve/veya ticaret) firmalarımızın karşılaştığı sorunlar ve varsa taleplere ilişkin bilgi notuna ihtiyaç duyulduğu bildirilmektedir. Bu itibarla, toplantının hazırlıklarında kullanılmak üzere,Ukrayna ile iş yaparken yaşanan sorunlar, çözüm önerileri ve varsa taleplerin en geç 11 Ağustos 2021 Çarşamba günü saat 15:00 e kadar Borsamıza (E-posta: egemenakbulut@esktb.org.tr) iletilmesi hususunda gereğini rica ederim. Genel Sekreter Gültekin Güler
10.08.2021
Dolandırıcılık hk.
Sayın Üyemiz, Pekin Ticaret Müşavirliği nin yazısına atfen, son dönemde birçok Türk firmasının hammadde/ara mamulleri piyasa ortalamasının oldukça altında fiyat taahhüdü ile Çinli firmalara peşin ödeme veya büyük ölçekli avans ödemesi yoluyla dolandırıldığı, son olarak "Shen Yang Beılıxın Import and Export Co. Ltd" isimli Çinli firmanın bir Türk firmasını benzer şekilde dolandırdığı, Ticaret Müşavirliği ile irtibata geçmeden diğer Türk firmalarının da alım yapma ihtimali göz önünde bulundurulduğunda, hem adı geçen firma hem de genel olarak dolandırıcılık faaliyetleri konusunda firmalarımızın bilgilendirilmesinde yarar görüldüğü ifade edilmektedir. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
10.08.2021
İkinci Afrika İçi Ticaret Fuarı
Sayın Üyemiz, 8-14 Aralık 2021 tarihleri arasında Kigali de düzenlenmesi öngörülen İkinci Afrika İçi Ticaret Fuarı nın (Intra-African Trade Fair-IATF2021) lojistik kısıtlamalar nedeniyle 15-21 Kasım 2021 tarihlerinde Durban da (GAC) düzenlenmesine karar verildiği bildirilmektedir. Yazıda devamla, IATF2021 in Afrika Kıtasal Serbest Ticaret Bölgesi Anlaşması (AfCFTA) kapsamında ticareti kolaylaştıracak bir platform sunarak; kıtasal ve küresel alıcı ve satıcıları bir araya getireceği belirtilmekte olup, Afrika ve başka coğrafyalardan 55 ten fazla ülkeden 10.000 ziyaretçinin katılımının öngörüldüğü,"IATF2021 Virtual" adı altında çevrimiçi olarak katılım imkanı da sağlanacağı ifade edilmektedir. İlgili Fuara ilişkin Afrika Birliği nden alınan Nota ekte sunulmakta olup, ayrıntılı bilgi ve kayıt için https://www.intrafricantradefair.com/en internet sitesinin kullanılması mümkünüdür. Bilgilerinize rica ederiz. Genel Sekreter Gültekin Güler
9.08.2021
Kuşak ve Yol Zirvesi
Sayın Üyemiz, Hong Kong Ticaret Ataşeliğinin görev alanı Hong Kong da, resmi niteliği haiz çatıkuruluşu olan Hong Kong Ticareti Geliştirme Konseyi (HKTDC) organizasyonunda 2016 yılından beri Kuşak ve Yol Hong Kong Zirvesi düzenlendiği, anılan Zirve nin temel amacının, Kuşak ve Yol güzergah ülkelerinde yer alan yatırım projelerine, Hong Kong da yerleşik finansman kuruluşları aracılığı ile fon sağlanması ve Hong Kong un finans merkezi olduğu belirtilmektedir. Zirve nin Hong Kong hükümeti tarafından da desteklendiği ve 2021 yılında koronavirüs pandemisine bağlı olarak 01-02 Eylül 2021 tarihlerinde dijital platform üzerinden düzenlenmesi planlanan Zirve ye dair genel bilgiler paylaşılmaktadır: I. Fiziken en son 2019 yılında düzenlenen Zirve ye, o dönemde 67 ülkeden 5000 in üzerinden ziyaretçi katılım sağlamıştır. Yine son düzenlenen fiziki organizasyonlarında, Zirve kapsamında 200 ün üzerindeki yatırım projesine 700 den fazla ticari eşleştirme programı tertip edilmiştir. İlk defa 2020 yılında pandemi gerekçesi ile dijitalde düzenlenen Zirve de, yine 80 nin üzerinde ülkeden ülkenin katılım sağladığı ve 250 nin üzerinde ticari eşleştirme programı düzenlendiği ilan edilmiştir. II. Temel hedefi Kuşak ve Yol güzergah ülkelerindeki yatırım projelerine fon sağlamak olan Zirve ye katılım sağlayan finansman kuruluşları Anakara Çin ağırlıklıdır. Yatırım projeleri bağlamında ele alındığında ise, Avrupa başta olmak üzere finansman arayışı bulunan tüm dünyadan yatırımcıların Zirve de aktif olarak yer aldıkları görülmektedir. III. Ülkemizden katılımcıların seneler itibari ile Zirve ye iştirakinde artış olduğu görülmek ile birlikte, firmalarımızın ticari eşleştirme programında yer almadıkları bilinmektedir. Bu kapsamda, yatırım projeleri için finansman arayışı bulunan firmalarımızın Zirve kapsamında düzenlenen ticari eşleştirme programlarına katılımında büyük yarar görülmektedir. İlgilenen firmalarımızın https://www.beltandroadsummit.hk/en/ üzerinden kayıt olmaları, kayıt esnasında ise Ticaret Ataşeliğimze tahsis edilen "03P30SOCGTUR" kodu üzerinden sağlanan kod (indirimli fiyat uygulanacağı ana organizatör tarafından beyan edilmiştir.) ile giriş yapmaları önerilmektedir. Zirve nin dijital katılım ücreti her bir kayıt için 390 HKD ( yaklaşık 50 ABD Doları) olarak belirlenmiştir. IV. Ticari eşleştirme organizasyonlarının yanı sıra Bölgesel Kapsamlı Ekonomik Ortaklık (Regional Comprehensive Economic Partnership RCEP) başta olmak üzere uluslararası ticaret gündemine dair tematik forumların da düzenleneceği Zirve nin program akışına resmi web portalından erişim sağlanması mümkündür. V. Zirve ye katılımdan bağımsız olarak, proje finansmanı arayışında olan şirketlerin, HKTDC ye ait https://beltroad.hktdc.com/ web portalında "Türkiye" başlığı altında yatırım projelerine ait detayları ücretsiz yayımlatma imkanı bulunmaktadır. VI. Zirve ye dair katılımı değerlendiren firmalarımızın, daha detayda bilgileri, HKTDC de ilgili irtibat kişisi olarak belirtilen pamela.cn.wong@hktdc.org üzerinden edinmeleri mümkündür. Bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
9.08.2021
IsDBG Özel Sektör Forumu
Sayın Üyemiz, İslam Kalkınma Bankası (IsDB) Grubu nun, 46. Yönetim Kurulu Toplantısı vesilesiyle 2 Eylül 2021 Perşembe günü 09:30-16:30 saatleri arasında "IsDBG Özel Sektör Forumu" düzenleneceği bildirilmektedir. Yazıda devamla, Taşkent te gerçekleştirilecek olan ilgili Forum un amaçlarının; üye ülkelerdeki yatırım, ticaret ve sigorta alanında IsDB Grubu faaliyetlerini, hizmetlerini, girişimlerini ve ortak çözümlerini vurgulamak, üye ülkelerin ilgili deneyimlerini, başarı öykülerini ve en iyi uygulamalarını paylaşmak ve iş dünyası temsilcileri arasında ortaklıklar kurulması için bir platform sağlamak olduğu belirtilmektedir. İlgili Forumun konuşmacı listesi ekte sunulmakta olup, ayrıntılı bilgiye aşağıdaki iletişim adresleri üzerinden ulaşmak mümkündür: İnternet sitesi: www.IsDBG-PSF.org Hassan Khalifa email: hkhalifa@isdb.org , telefon: +966569326822 Mohamed Al Saati email: mfs@isdb.org , telefon: +966554315181 Bilgilerinizi rica ederiz. Gültekin Güler Genel Sekreter
9.08.2021
TMO Arpa Satışlarına İlave Olarak Kanatlı Hayvan Yetiştiricilerine Yönelik Buğday Satışlarına da Başlamıştır
Sayın Üyemiz, TMO Genel Müdürlüğünden yapılan açıklamada: "Kuruluşumuz02 Ağustos 2021tarihi itibarı ile1.950 TL/Tonfiyatla peşin bedel mukabili olarak BESİCİ VE YETİŞTİRİCİLERİMİZ ile YEM FABRİKALARINA yönelik arpa satışlarına devam etmektedir. Buğday satışlarımız ise2.440TL/Tonfiyatla peşin bedel mukabili olarak KANATLI HAYVAN BESİCİ VE YETİŞTİRİCİLERİNE (beyaz et, yumurta vs.) yönelik olarak başlamıştır. Arpa ve buğday satışlarımız için başvurular02 Ağustos 2021 - 13 Ağustos 2021(dahil) tarihleri arasında; Liman işyerlerimizden besici ve yetiştiricilerimize yapılacak arpa satışları “ELEKTRONİK SATIŞ PLATFORMU” üzerinden, iç merkezlerdeki arpa satışlarımız için ise TMO ŞUBE MÜDÜRLÜKLERİ vasıtasıyla yapılacaktır. Yem fabrikalarına yapılacak arpa satışlarımız “YEM FABRİKALARI ELEKTRONİK SATIŞ PLATFORMU” üzerinden yapılacaktır. Liman işyerlerimizden yapılacak buğday satışlarımızda ise “ELEKTRONİK SATIŞ PLATFORMU” üzerinden başvuru alınacaktır. Tahsis sonuçlarının açıklanmasını müteakip satışı yapılan stoklar içinpara yatırma süresi26 Ağustos 2021,ürün teslimleri 15 Eylül 2021tarihi mesai bitiminde sona erecektir. Kuruluşumuzca piyasalar yakından takip edilmektedir. TMO iştigal alanına giren ürünlerde stoklarını takviye edecek, uygun fiyatla kullanıcılarına yönelik hammadde tedarikine devam edecek ve görev alanındaki ürünlerde ilgili kamu kurum ve kuruluşlarıyla işbirliği içerisinde piyasa istikrarı temin edilecektir." denilmektedir. Ayrıntılı bilgi için tıklayınız. Genel Sekreter Gültekin Güler
6.08.2021
Yapılandırma Duyurusu
Sayın Üyemiz; 7326 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanunun 09.06.2021 tarihli Resmi gazetede yayımlanmış olup ve Kanun içeriğine ilişkin açıklamalar aşağıda yer almaktadır. 1.KAPSAM Kanun`un 10 uncu maddesinin 4 inci fıkrası uyarınca 30.04.2021 tarihi itibarıyla ödenmesi gerektiği hâlde bu Kanunun yayımı tarihine kadar ödenmemiş olan; - Üyelerimizin borsamıza olan aidat ve borsa tescil ücreti borç asılları, Kanun kapsamında yapılandırmaya tabi tutulabilecektir. Bu çerçevede üyelerimizin borsamıza olan 2021 yılı aidat ödemeleri yapılandırma kapsamında değildir. Bununla birlikte üyelerimizin borsamıza olan 2020 yılı ve öncesi dönemlere ait aidat ödemeleri yapılandırma kapsamında olacaktır. 2.VERGİ MÜKELLEFİYETİ SİLİNEN ÜYELER 17.11.2020 tarihinde yürürlüğe girmiş olan 7256 sayılı Kanun kapsamında yer alan, "vergi mükellefiyeti sona ermiş üyelerin, vergi mükellefiyetinin sona erdiği tarihten sonraki borç asıl ve faizlerinin re`sen silinmesi" uygulamasına, 7326 sayılı Kanunda yer verilmemiştir. Bu nedenle vergi mükellefiyeti sona ermiş üyeler bakımından, 7326 sayılı Kanun kapsamında tesis edilmesi gereken bir işlem bulunmamaktadır. 7256 sayılı Kanun gereği olarak vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetinin sona erme tarihi ile 17.11.2020 tarihi arasındaki borç asıl ve faizleri re`sen silinmiştir. Bu kapsamdaki üyelerin 17.11.2020 tarihinden sonra tahakkuk etmiş ancak vadesi gelmiş bir borçları da bulunmadığından, Yapılandırma kapsamında olmadıkları değerlendirilmektedir. Öte yandan vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetlerinin sona erme tarihinden önceki borçlarının asılları, 7326 sayılı kanun kapsamında yapılandırılabilmektedir. 3. BORÇ SİLİNMESİ ve ÖDEME Yapılandırma kapsamındaki borç asıllarının tamamının kanunda belirtilen şekilde ödenmesi halinde faiz, gecikme faizi, gecikme zammı gibi fer`i alacakların tahsilinden vazgeçilir. Bununla birlikte yapılandırma kapsamında olan ve Kanunun yayımı tarihinden önce kısmen veya tamamen ödenmiş olan borç asıllarına isabet eden faiz, gecikme faizi, gecikme zammı gibi fer`i alacakların da tahsilinden vazgeçilir. Kanun kapsamındaki borçlar için yapılandırmaya başvuranların, borç taksitlerinin birincisini Kanunun yayımlandığı tarihi takip eden dördüncü ayın sonuna kadar (31.10.2021), kalanını ise aylık dönemler hâlinde ve azami toplam altı eşit taksitte (son taksit tarihi 31.03.2022) ödemesi gerekmektedir. Azami altı taksite kadar olan yapılandırma hakkının ne şekilde kullanılacağını üye başvurusunda belli edecektir. Üye tarafından belirlenecek olan taksit adedi, ödenecek toplam borç tutarını değiştirmeyecektir. Üyeler, toplam anapara borç tutarını yukarıda belirtilen taksit sürelerini geçmemek üzere kredi kartına da taksitlendirebileceklerdir. Üyelerimiz, Kanunun yayımlandığı tarihi takip eden üçüncü ayın sonuna kadar (30/09/2021) başvuruda bulunabileceklerdir. Yapılandırmaya başvuru anında askıya alınmış olan üyeler, ilk taksit ödemeleri ile beraber askıdan indirilecektir. Ancak bu şekilde askıdan indirilen üye, herhangi bir taksiti ödemeyerek yapılandırmayı bozması halinde yeniden askıya alınacaktır. 4. MUHASEBE İŞLEMLERİ Bu fıkra kapsamında ödenmesi gereken tutarların fıkrada öngörülen süre ve şekilde kısmen veya tamamen ödenmemesi hâlinde, ödenmemiş alacak asılları ile bunlara ilişkin faiz, gecikme faizi, gecikme zammı gibi fer`i alacaklar ilgili mevzuat hükümlerine göre tahsil edilir. Bu ana kadar yapılan tahsilatlar Bütçe ve Muhasebe Yönetmeliğinin 58 inci maddesinde belirtilen sıralamaya göre borçtan düşülür ve kalan kısma 6183 sayılı Amme Alacaklarının Tahsil Usulü Hakkında Kanun uyarınca günlük gecikme zammı tahakkuk ettirilmeye devam edilir. 5. UYUŞMAZLIK KONUSU ALACAKLAR Yapılandırmadan faydalanacak kişilerin, yapılandırmaya konu borçlarına dava açmamaları, açılmış davalardan vazgeçmeleri şarttır. Bu Kanunun yayımı tarihinden önce dava konusu edilmiş ve/veya mahkemece hükme bağlanmış ve kesinleşmiş olanlar dâhil olmak üzere icra takibi başlatılmış alacaklar için, borçlunun bu fıkra hükümlerinden yararlanmak üzere başvuruda bulunması hâlinde davalar ve/veya icra takipleri sonlandırılır. Bu kapsamda, tamamı ödenen alacaklara ilişkin yargılama giderleri ile icra masrafları ve vekâlet ücretleri karşılıklı olarak talep edilmez. 6.7256 SAYILI KANUN KAPSAMINDA YAPILANDIRILAN ALACAKLAR Üyelerimizin 7256 sayılı Kanun kapsamında yapılandırmış olduğu alacaklar kural olarak 7326 sayılı Kanun kapsamında değildir. Bu bakımdan 7256 sayılı Kanun kapsamında yapılandırması devam eden ve taksitlerini vadesinde ödemeye devam eden üyelerin mevcut yapılandırmalarına uygun davranmaları gerekmektedir. 7256 sayılı Kanun kapsamında taksitlerden herhangi birisini ödemediği için yapılandırması bozulan ve ödenmemiş anapara, faiz ve fer`isi yeniden tahakkuk ettirilen üyelerin 7326 sayılı Kanun kapsamında yapılandırmaya başvurması mümkündür.” Aidat Yapılandırma Başvuru Dilekçesi ektedir. Üyelerimize önemle duyurulur. Saygılarımızla, GÜLTEKİN GÜLER GENEL SEKRETER
5.08.2021
Sri Lanka tarafından turizm konusunda düzenlenen etkinlik - güncel link
Sayın Üyemiz, Asya da İşbirliği ve Güven Arttırıcı Önlemler Konferansı" (AİGK) (Conference on Interaction and Confidence Building Measures in Asia - CICA) Sekretaryasından alınan yazıya atfen, Sri Lanka Turizm Tanıtım Bürosu nun 17 Ağustos 2021 tarihinde "Turizm işbirliğini geliştirmek amacıyla AİGK Üye Devletleri ile sanal B2B oturumu" (Virtual business to business (B2B) interactive session with CICA Member States to enhance tourism cooperation) başlıklı etkinliğinin düzenlemeyi planladığı bildirilmişti. Dışişleri Bakanlığı ndan gelen ilgi (b) de kayıtlı yazı ile söz konusu etkinliğinin güncel kayıt linki iletilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
5.08.2021
PEŞİN HUBUBAT SATIŞLARI (GENEL VE SÖZLEŞME BAZINDA)
Sayın Üyemiz, TMO Eskişehir Şube Müdürlüğünden alınan hububat satışları ile ilgili yazı ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
3.08.2021
Türkmenbaşı Limanı
Sayın Üyemiz, Türkmenistan ın Türkmenbaşı Liman İşletmesi yetkililerinden elde edinilen bilgiye göre; Limanın 27 Temmuz 2021 - 10 Ağustos 2021 tarihleri arasında, 5-6 Ağustos 2021 tarihlerinde yapılacak Orta Asya Devlet Başkanlarının İstişare Toplantısı, Orta Asya Kadınlarının Diyaloğu ve Orta Asya Ülkelerinin Milli Ürünlerinin Uluslararası Fuarı etkinlikleri dolayısıyla, gemi trafiğine ve gemi operasyonlarına kapalı olacağı ifade edilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.08.2021
Co-Matching İkili İş Görüşmeleri Etkinliği
Sayın Üyemiz, Kocaeli Ticaret Odası nın ilgide kayıtlı yazısı ile, Avrupa İşletmeler Ağı kapsamındaki Kocaeli Ticaret Odası ve Doğu Marmara ABİGEM işbirliğinde Co-Matching İkili İş Görüşmeleri etkinliğinin 25 Ağustos 2021 Çarşamba günü online olarak gerçekleştirileceği bildirilmektedir. Yazıda devamla, bu yıl dördüncüsü düzenlenecek olan Co-Matching ikili iş görüşmeleri kapsamında dünyanın çeşitli ülkelerinden firma temsilcilerinin, Türkiye pazarında stratejik ortaklar bulmak, yatırım ve ticaret ortamını değerlendirmek üzere sanal ortamda ülkemizden firmalarla bir araya geleceği ve yerli firmaların, ürün, proje ve hizmetlerini sunma, yurtdışı bağlantıları ile iş ağlarını geliştirme, yeni ticari ve teknolojik işbirlikleri ve proje ortaklıkları kurma imkanı bulacakları belirtilmektedir. Söz konusu etkinliğe başvurmak isteyen şirketlerimiz co-matching-2021.b2match.io/ adresinden detaylı bilgilere ulaşabilmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
3.08.2021
KTO KARATAY ÜNİVERSİTESİNDE BORSAMIZ ÜYELERİNE ÖZEL İNDİRİM
Sayın Üyemiz, KTO Karatay Üniversitesi ile gerçekleştirdiğimiz protokol kapsamında Eskişehir Ticaret Borsası üyelerimizin, birinci derece yakınlarının ve eşlerinin KTO Karatay Üniversitesi Lisans veya Ön lisans programlarına Üniversitesine kayıt yaptırmaları halinde öğrenim ücretinden %15 oranında ahilik bursu sağlanacak ve 8 eşit taksitte ödeme imkanı sağlanacaktır. Protokol gereği; 2021-2022 akademik yılında Üniversiteye kayıt yaptıran öğrenciler için geçerli olup, Bu protokol kapsamında lisans ve ön lisans programlarına kayıt hakkı elde eden üyelerimiz, birinci derece yakınlarına ve eşlerine ahilik bursu, Üyelerimizin Borsamızdan güncel tarihli yetki belgesi aslını getirmesi ile bu yetki belgesini her akademik yılbaşında yenilemesi ve birinci derece yakınların ilgili Nüfus Müdürlüğünden alacakları vukuatlı nüfus kaydı belgesinin aslını ibraz etmeleri şartı ile sağlanmaktadır. İş dünyasının üniversitesi olan KTO Karatay Üniversitesi hakkında ayrıntılı bilgi almak içinhttp://tanitim.karatay.edu.tradresini ziyaret edebilirsiniz. Bilgilerinize rica ederiz. Saygılarımızla, Genel Sekreter Gültekin GÜLER
2.08.2021
Küçük İşletmeler için Dijital Şampiyonlar: "ICC, WTO ve ITC Yarışması"
Sayın Üyemiz, Covid-19 pandemisi, dünyanın her yerindeki her büyüklükteki işletme için dijital ekonominin önemini bir kez daha göstermiştir. Daha fazla KOBİ’yi dijital ekonomiye dahil edilmesi; büyümelerine, ticaret yapmalarına ve dirençli olmalarına yardımcı olmak için çok önemlidir. Bu bağlamda,Milletlerarası Ticaret Odası (ICC), Uluslararası Ticaret Merkezi (ITC), Dünya Ticaret Örgütü nün Mikro KOBİ Grubu, yarışma sponsorlarıGoogle ve Zoomile birlikte, KOBİ’lerin dijitalleşmelerine yardımcı olarak uluslararası ticarete katılımlarını destekleyecek projeler için teklif çağrısında bulunmaktadırlar. Yarışmanın ev sahibi ve sponsor kuruluşlarının desteği ve netwörkü ile geliştirilebilecek ve/veya ölçeklenebilecek dijital merkezli teklifler aranmaktadır. Yarışma; Ticaret Odaları, Sanayici Dernekleri ve Sivil Toplum Kuruluşlarına açıktır. Kazananlar, 30 Kasım – 3 Aralık 2021 tarihlerinde Cenevre’de düzenlenecek olan 12. DTÖ Bakanlar Konferansı’nda açıklanacaktır. Google ve Zoom’un sponsorluğundaki ödüller, kazananların ihtiyaçlarına göre şekillendirilecektir. Proje çağrısındayer alan bazı bilgiler aşağıda sunulmaktadır. GİRİŞİMİN HEDEFLERİ: •Dijitalleşmelerine yardımcı olarak mikro KOBİ lerin uluslararası ticarete katılımının desteklenmesi •Dijital ticaretle ilgili -siber güvenlik tehditleri ve düzenleyici gerekliliklere uygunluk gibi-, KOBİ lerin karşılaştığı zorluklar konusunda İş dünyası ve politikacılar nezdinde farkındalık yaratılması •Küçük işletmelerin dijitalleşmesine yardımcı olan ve uluslararası ticarete katılımlarını teşvik eden en iyi uygulamaların vurgulanması NE TÜR PROJE TEKLİFLERİARANIYOR?: •Teklifler; farkındalık yaratma kampanyaları, yarışmalar, kapasite geliştirme, eğitim ve rehberlik programlarına odaklanabilir. •Teklifler; teklifi yapan kuruluş tarafından yapılacak şekilde tasarlanmalı ve DTÖ müzakerelerine veya DTÖ kurallarında önerilen değişikliklere odaklanmamalıdır. •Başarılı teklifler; ICC, ITC ve DTÖ Mikro KOBİ Grubu ile sponsorlar olan Google ve Zoom netwörkleri tarafından desteklenecektir. PROJE TEKLİFLERİ NASIL TESLİM EDİLECEK? Teklifler; mikro KOBİ ve dijitalleşme odaklı Ticaret Odaları, Sanayici Dernekleri ve Sivil Toplum Kuruluşlarının katılımına açıktır. •Teklif hazırlanırken kapsamı, amaçları, zaman çizelgeleri ve diğer bilgileri uygun şekilde detaylandırılması gerekmektedir. •Teklifler, üç sayfadan uzun olmamalıdır. •Word veya PDF formatındaDigitalchampions@wto.orge-posta adresine15 Eylül 2021tarihine kadar gönderilmelidir. PROJE TEKLİFİNDE YER ALMASI GEREKEN TEMEL BİLGİLER: • Kuruluşun adı • İrtibat kişisi (isim, telefon, e-posta) • Kuruluşun kısa açıklaması • Projeyi uygulayan kişilerin kısa özgeçmişleri • Önerilen projenin adı • Projenin zaman çizelgesi • Karşılaşılan sorun/ele alınması gereken konu • Organize edilecek faaliyetler de dahil olmak üzere projenin kısa açıklaması • Projenin amaç(lar)ı (Herhangibir özel sonuç/çıktı dahil) • ICC, ITC ve DTÖ Mikro KOBİ Grubunun projenin uygulanmasına nasıl katkıda bulunabileceğine dair öneriler SEÇİM SÜRECİ Proje tekliflerinin seçimi; DTÖ Mikro KOBİ Grubunun Üyeleri ve ICC, ITC ve DTÖ ile sponsor kuruluşlar olan Google ve Zoom temsilcileri tarafından yapılacaktır. Kazananlar, 30 Kasım – 3 Aralık 2021 tarihlerinde Cenevre’de düzenlenecek olan 12 DTÖ Bakanlar Konferansı’nda açıklanacaktır. ÖDÜL Google ve Zoom’un sponsorluğundaki ödüller, kazananların ihtiyaçlarına göre şekillendirilecektir. Ödül sayısı, başvuran proje tekliflerine göre belirlenecektir. Girişimin Açılış Videosunu izlemek için tıklayınız. Proje Çağrısına ulaşmak için tıklayınız. Saygılarımızla, Genel Sekreter Gültekin Güler
30.07.2021
Nefes Kredisi Hk.
Sayın Üyemiz, Hazine ve Maliye Bakanlığı koordinasyonunda KGF ve bankalar ile imzalanan protokol çerçevesinde Nefes Kredisi projesi 30 Temmuz 2021 Cuma günü mesai bitimi itibarıyla yeni başvurulara kapatılacaktır. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
30.07.2021
Zambiya da İş Ortamı ve Yatırımlara Yönelik Teşvikler
Sayın Üyemiz, Zambiya da iş ortamı ve yatırımlara yönelik teşvikler hakkında Zambiya Büyükelçiliğimiz tarafından hazırlanan bilgi notu iletilmektedir. Söz konusu bilgi notu ekte sunulmakta olup, sorular için Lusaka Ticaret Müşaviri Cem Emre Özköse (Email:lusaka@ticaret.gov.tr, Telefon: +260 211 259 012) ile irtibata geçilmesi mümkündür. Bilgilerinize rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
29.07.2021
Türkiye-Çin Kültür ve İş Geliştirme Forumu
Sayın Üyemiz, Çin Halk Cumhuriyeti Ankara Büyükelçiliği rehberliğinde Türkiye-Çin İş Geliştirme ve Destekleme Derneği ve Çin Sanayi ve İş Adamları Derneği işbirliğinde, 5-7 Ağustos 2021 tarihlerinde, Congresium Ankara da Türkiye-Çin Kültür ve İş Geliştirme Forumu nun düzenleneceği bildirilmekte ve 3 gün boyunca sürecek Fuarın yanı sıra maden, altyapı, teknoloji, bilişim, gıda, tarım turizm ve sağlık sektörlerinde paneller düzenleneceği ifade edilmektedir. Söz konusu Forum a ilişkin detaylı bilgilereturkiyecinisgelistirme.com/index adresinden ulaşılabilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
28.07.2021
EgyMedica Medikal Fuarı
Sayın Üyemiz, Mısır da 19 -21 Mayıs 2022 tarihlerinde EgyMedica medikal fuarının düzenleneceği bildirilmektedir. Fuara ilişkin broşür ekte sunulmakta olup, ayrıntılı bilgi için Green Land Organizing International Exhibitions & Conferences Başkan Yardımcısı Adel Fahmy Fahmy ile aşağıda yer alan iletişim bilgileri üzerinden iletişime geçilmesi mümkündür: Telefon: (+2) (02) 20822108 - 20822109 - 20822137 Fax: (+2) (02) 208221008 E-mail: info@egymedica.com , egymedica@greenlandexpo.net Web sitesi: www.egymedica.com Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
27.07.2021
Rusya Federasyonu Pskov Bölgesi Yatırım Fırsatları Sunum
Sayın Üyemiz, Rusya Federasyonu Pskov Bölgesi ndeki Yatırım Fırsatları na ilişkin bir toplantının, 4 Ağustos 2021 tarihinde saat 11.00-12.30 arasında, online olarak gerçekleştirileceği bildirilmektedir. Toplantıya ilişkin gündem ve notlar ekte iletilmektedir. Toplantı linki, kayıt gerçekleştirildikten sonra iletilecektir. Kayıt için ankara@minprom.gov.ru adresine mail atılması veya +90 552 648 13 69 nolu telefondan Anna Sherstneva ile görüşülmesi gerekmektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin GÜLER
27.07.2021
Bangladeş ten İhale Teklifleri (Kırmızı Mercimek İthalatı)
Sayın Üyemiz, Bangladeş Ticaret Kurumu (Trading Corporation of Bangladesh) tarafından standart sentetik aylon file veya jüt file torbada, her biri 25/30/40 kg veya herhangi bir standart ağırlıkta paketlenecek şekilde 3.000 metrik ton (± %10) soğan ile 25/50 kg polipropilen torbalarda 3.000 metrik ton (±%5) kırmızı mercimek ithal edileceği belirtilmektedir. İhaleler ile ilgili detaylı bilgilere ve daha çok sayıda güncel ihale bilgisine www.tcb.gov.bd adresinden ulaşılabilir. Bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
27.07.2021
Türk - Kırgız İş Forumu
Sayın Üyemiz, Türkiye-Kırgız Cumhuriyeti Hükümetlerarası Karma Ekonomik Komisyonu (KEK) Eş Başkanı T.C. Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay ın KEK 10. Dönem Toplantısı vesilesiyle yapacağı Kırgızistan ziyareti kapsamında 6 Ağustos 2021 tarihinde Kırgız Cumhuriyeti nin başkenti Bişkek te TürkiyeKırgızistan İş Forumu nun düzenlenmesi planlanmaktadır. Birliğimiz ve Dış Ekonomik İlişkiler Kurulu işbirliğinde, Sayın Cumhurbaşkanı Yardımcımız ve Kırgız Cumhuriyeti Bakanlar Kurulu Başkanı Sayın Ulukbek Maripov un teşrifleri ile gerçekleştirilmesi öngörülen İş Forumuna katılmayı düşünen üyelerinizin katılım teyitlerini en geç 3 Ağustos 2021, saat 12.00 ye kadar Birliğimize (Adem Kula, Tel: 0212 324 95 42, E-posta: adem.kula@tobb.org.tr ) bildirmeleri gerekmektedir. Bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
27.07.2021
İş Dünyası İçin Erasmus+ Fırsatları Bilgilendirme Etkinliği
Sayın Üyemiz, 26 Temmuz2021 tarihinde, AB Başkanlığı Mali İşbirliği ve Proje Uygulama Genel Müdürü Sayın Bülent ÖZCAN’ınev sahipliğinde, Avrupa Birliği Eğitim ve Gençlik Programları Merkezi Başkanlığı (Ulusal Ajans) tarafındanErasmus+ Programı kapsamında iş dünyasına yönelik fırsatlarözelinde bir tanıtım etkinliği düzenlenecektir. 2021-2027 döneminde 26,2 milyar avroluk bir bütçeye sahip olan Erasmus+ Programı, faydalanıcıların faaliyet gösterdikleri sektörlerdeki yenilikçi ve iyi uygulamaları tecrübe etmelerini, uygulamalarını, yurt dışındaki muadilleri ile bir arada kurumsal kapasitelerini artırmalarına ve uluslararasılaşmalarına yardımcı olmaktadır. Etkinliğe ilişkin resmi yazı, gündem ve bilgi notu ekte dikkatinize sunulmuş olup çevrim içi olarak gerçekleştirilecek bu etkinlik bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
26.07.2021
Fuar Başvuruları
Sayın Üyemiz, Yurt İçinde Fuarların Düzenlenmesine Dair Usul ve Esasların 14 üncü maddesinin birinci fıkrasına göre Ana fuar takviminde yer almak üzere yapılacak fuar düzenleme başvuruları, fuarın düzenleneceği yıldan bir önceki yılın Ağustos ayının 1 inci günü sonuna kadar yapılabilmektedir. Bu seneye mahsus olmak üzere, 2022 yılı Ana fuar takvimi başvurularının 2021 yılının Eylül ayının 1 inci günü sonuna kadar yapılması halinde başvurularının kabul edilmesine karar verilmiştir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.07.2021
Türkiye-Nijerya Karma Ekonomik Komisyonu 5. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Nijerya Karma Ekonomik Komisyonu (KEK) 5. Dönem Toplantısı nın 7-8 Eylül 2021 tarihlerinde Ankara da gerçekleştirileceği bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Nijerya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 27 Temmuz 2021 Salı günü mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederim. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.07.2021
Kurban Hizmetleri Toplantısı
Sayın Üyemiz, Tarım ve Orman Bakanlığı ndan alınan ilgi yazı ekte gönderilmektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.07.2021
BUĞDAY VE ARPA SAPI İHALESİ
Sayın Üyemiz, Geçit Kuşağı Tarımsal Araştırma Enstitüsü MüdürlüğüNe ait Sap Satış ihalesi ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.07.2021
TEDEPORT - Teşvik ve Destek Portalı
Sayın Üyemiz, Alman Federal Ekonomik İşbirliği ve Kalkınma Bakanlığı tarafından finanse edilen Ekonomik Fırsatların Desteklenmesi Programı kapsamında; Alman Uluslararası İş Birliği Kurumu ve Gaziantep Sanayi Odası iş birliği ile yürütülen "Gaziantep te Kalıcı Gelir İçin İstihdam Projesi" bünyesinde TEDEPORT - Teşvik ve Destek Portalı oluşturulduğu belirtilmektedir. Ayrıntılı bilgi ektedir. Bilgilerinize sunulur. Genel Sekreter Gültekin Güler
16.07.2021
Türk Gıda Kodeksi Meyve Şarabı Tebliği Hakkında Görüş Talebi
Sayın Üyemiz, Türk Gıda Kodeksi Hazırlama Yönetmeliği çerçevesinde hazırlanmış olan "Türk Gıda Kodeksi Meyve Şarabı Tebliği"ne ait taslak metin ve görüş tablosunun Bakanlığın web sayfasında (www.tarimorman.gov.tr) görüşe açıldığı bildirilmektedir. Bilgilerinizi ve taslağa ilişkin görüşlerinizin, taslak metinle birlikte web sayfasında yer alan tablo formatına uygun olarak, en geç 28 Temmuz 2021 tarihine kadar eskisehirtb@tobb.org.tr mail adresine bildirilmesini rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
16.07.2021
RESMİ GAZETEDE YAYIMLANAN TARIM VE HAYVANCILIK TEBLİĞLERİ
Sayın Üyemiz, 15 Temmuz 2021 tarih ve 31542 sayılı Resmi Gazete de yayımlananHAYVANCILIK DESTEKLEMELERİ UYGULAMA TEBLİĞİ(TEBLİĞ NO: 2020/32)’NDE DEĞİŞİKLİK YAPILMASINA DAİR TEBLİĞ(TEBLİĞ NO: 2021/25) ileKIRSAL KALKINMA DESTEKLERİ 13. ETAP KAPSAMINDA TARIMADAYALI YATIRIMLARIN DESTEKLENMESİ HAKKINDA TEBLİĞ(TEBLİĞ NO: 2019/30)’DE DEĞİŞİKLİK YAPILMASINADAİR TEBLİĞ(TEBLİĞ NO: 2021/27)aşağıdalki linklerde bilgilerinize sunulmuştur. HAYVANCILIK DESTEKLEMELERİ UYGULAMA TEBLİĞİ(TEBLİĞ NO: 2020/32)’NDE DEĞİŞİKLİK YAPILMASINA DAİR TEBLİĞ(TEBLİĞ NO: 2021/25) KIRSAL KALKINMA DESTEKLERİ 13. ETAP KAPSAMINDA TARIMADAYALI YATIRIMLARIN DESTEKLENMESİ HAKKINDA TEBLİĞ(TEBLİĞ NO: 2019/30)’DE DEĞİŞİKLİK YAPILMASINADAİR TEBLİĞ(TEBLİĞ NO: 2021/27) Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
16.07.2021
Fransa ya İhracatta Karşılaşılan Dolandırıcılık Teşebbüsleri
Sayın Üyemiz, Liyon Ticaret Ataşeliğimizden alınan bir yazıya atfen, son zamanlarda ihracatçılarımızla Fransa dan irtibata geçen bazı kişilerin, Fransa da yerleşik ünlü perakende zincirleri veya köklü ve tanınmış firmalar adına kendilerinden ürün alacaklarını, ancak ödemeyi sadece kendi belirledikleri şekilde yapacaklarını ifade ettikleri bildirilmektedir. Ayrıca, Fransa nın en büyük perakende zincirlerinin veya tanınmışfirmalarının adını kullanarak ve kendilerini söz konusu firmaların satış müdürü olarak gösteren kişilerin firmalarımızla irtibata geçerken, Fransa da kayıtlı telefon numaraları üzerinden arama yaptıkları, ancak Liyon Ticaret Ataşeliği tarafından yapılan araştırmalar neticesinde söz konusu numaraların başka ülkeler üzerinden alındığının tespit edilmiş olduğu belirtilmektedir. Bahsi geçen zincir marketlerden birinin satış müdürü ile yapılan telefon görüşmesinde birçok yerden bu tarz bilgilerin kendilerine iletildiği ve konuyu polise yansıttıkları ifade edilmektedir. Yazıda devamla, şimdiye kadar ayakkabı, sıvı yağ ve kırtasiye sektörlerimizde faaliyet gösteren firmalarımızdan alım yapmak isteyen söz konusu kişilere karşı firmalarımızın dikkatli olmasının, bu çerçevede firmalarımızın, Fransız firmalarının veya ünlü perakende zincirlerinin ismini kullanarak kendilerine ulaşan ve ürün almak isteyen kişilerin, belirtilen Fransız firmasının genel merkezini arayarak, çalışanları olup olmadığını ve siparişin ismi kullanılan kişi tarafından verilip verilmediğini kontrol etmelerinin büyük önem arz ettiği ifade edilmektedir. Firmalarımızla iletişime geçen kişilerce kullanılan eposta adresinin Fransız firmasının ismini taşıyan bir uzantısının olmasına, Fransız firmasının resmi evraklarının kendilerine iletilmesine (bilanço vb.), yapılan tekliflerde veya sözleşmelerde Fransız firmasının mührünün kullanılmasına dikkat edilmesinin bundan sonra firmalarımızın kayıplar yaşamaması açısından önemli olduğu bildirilmektedir. Bilgilerinize önemle sunulur. Genel Sekreter Gültekin Güler
14.07.2021
Deneyap Teknoloji Atölyesi
Sayın Üyemiz, Milli Teknoloji Hamlesi nde rol alacak gençlerin gelişimlerini sağlamak üzere; gençlerin ihtiyaç duyacakları fiziki imkanları, donanımları, eğitimleri ve atmosferi ülke genelinde yaygın bir şekilde sağlayabilmek amacıyla Sanayi ve Teknoloji Bakanlığı, Gençlik ve Spor Bakanlığı, TÜBİTAK ve T3 Vakfı arasında 7 Kasım 2018 tarihinde "81 ilde kurulacak 100 Deneyap Atölyesine ilişkin İşbirliği Protokolü" imzalanmıştır. Bu kapsamda 3. fazda açılacak olan 27 ildeki 36 Deneyap Teknoloji Atölyesi nde verilecek "Tasarım & Üretim", "Robotik & Kodlama" ve "Elektronik Programlama & Nesnelerin İnterneti" dersleri için eğitmenlik başvuru süreci başlamıştır. Söz konusu sürece ilişkin bilgi notu, şartname ve duyuru afişleri ekte dikkatinize sunulmuştur. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
14.07.2021
İHALELİ SATIŞLAR
Sayın Üyemiz, Et ve Süt Kurumu Genel Müdürlüğünden alınan yazı ektedir. Bilgilerinize sunulur.
14.07.2021
2021 Üye Memnuniyet Anketi
Sayın Üyemiz, Borsamızın verdiği hizmetleri değerlendirip, hizmetlerimize istek ve talepleriniz doğrultusunda yön verebileceğiniz anketimize aşağıdaki linkten ulaşabilirsiniz. https://forms.gle/mcaojSUHJGTRJmnRA Saygılarımızla, Gültekin Güler Genel Sekreter
14.07.2021
Türk-Rus 17. Dönem KEK Toplantısı, 28- 30 Temmuz 2021
Sayın Üyemiz, Türk-Rus 17. dönem KEK Toplantısı nın 28-30 Temmuz 2021 tarihlerinde Rusya da gerçekleştirilecektir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Rusya ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 16 Temmuz 2021 Cuma günü saat 14.00 e kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi hususunda gereğini rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
14.07.2021
YARDIM KAMPANYASI
Sayın Üyemiz, Bilindiği gibi, SMA (Spinal Musküler Atrofi) hastası çocukların tedavisi önemli maddi olanaklar gerektirmektedir. Bu gereklilikleri sosyal dayanışmaya uygun şekilde karşılayabilmek amacıyla, camiamızın kapsayıcı bir şekilde destek vereceği muhakkaktır. Bu kapsamda, camiamızın değerli mensubu Ömer ÖZER in (Siirt TSO - Personel) kızı Eflin Lina ÖZER, SMA hastalığı nedeniyle değerli katkılarınıza ihtiyaç duymaktadır. Aşağıda yer alan IBAN numarasına (valilik onaylı) destek olmak isteyen üyelerimize destekleri için şükranlarımızı sunarız. Saygılarımızla, Gültekin Güler Genel Sekreter Türkiye İş Bankası - Siirt Şubesi IBAN: TR42 0006 4000 0018 7001 0849 75 Alıcı: Ömer ÖZER
14.07.2021
ESKİŞEHİR İLİ HAYVAN SAĞLIK ZABITASI KOMİSYON KARARI
Sayın Üyemiz, 07.07.2021 tarih ve 2021/02 karar no.lu Eskişehir İli Hayvan Sağlık Zabıtası Komisyon Kararı ekte bilgilerinize sunulmuştur. Gültekin Güler Genel Sekreter
13.07.2021
Vergi usul kanunu tebliğiyle bildirim zorunluluğu düzenlemesi
Sayın Üyemiz, 13 Temmuz 2021 tarih ve 31540 sayılı Resmi Gazete de yayımlanan Vergi Usul Kanunu Genel Tebliği ile vergi kaçakçılığı ile mücadele kapsamında bildirim zorunluluğu getirilen mükelleflerin kapsamı ve bildirimlerin usul ve esasları belirlendi. Düzenlemeye göre şirketlerin "Gerçek Faydalanıcı Bilgisi Verme" yükümlülüğü 1 Ağustos ta başlayacaktır. Ayrıntılı bilgi ektedir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
13.07.2021
Elektronik İhale Yöntemiyle Yapılan İhalelerde Elektronik Geçici Teminat Mektubunun Kullanılması
Sayın Üyemiz, 06/01/2021 tarihli ve 31376 sayılı Resmî Gazete’de yayımlanan mevzuat ile; Mal Alımı İhaleleri Uygulama Yönetmeliği, Hizmet Alımı İhaleleri Uygulama Yönetmeliği, Yapım İşleri İhaleleri Uygulama Yönetmeliği ve Elektronik İhale Uygulama Yönetmeliğinin “Uygulanmaya başlama süresi” başlıklı geçici maddelerinde değişiklik yapılarak, elektronik ihale yöntemiyle yapılan ihalelerde yalnızca Elektronik İhale Uygulama Yönetmeliğinin 21’nci maddesine göre düzenlenen elektronik geçici teminat mektuplarının sunulabileceğine ilişkin 30.09.2020 tarihli ve 31260 sayılı Resmi Gazete’de yayımlanmış olup değişikliklerin, gerekli teknik altyapının tamamlandığının tespitine yönelik Kurul tarafından alınacak kararın 15 gün sonrasına kadar uygulanmayacağı hükme bağlanmıştır. Bu çerçevede, 24.05.2021 tarih ve 2021/DK.D-116 Kurul kararı ile, ilan veya duyuru tarihi 08.06.2021 ve bu tarihten sonra olan ve elektronik ihale yöntemiyle yapılan ihalelerde geçici teminat mektubu olarak yalnızca Elektronik İhale Uygulama Yönetmeliğinin 21’nci maddesine göre düzenlenen elektronik geçici teminat mektuplarının sunulabileceğine karar verilmiştir. Bu bağlamda, ilan veya duyuru tarihi 08.06.2021 ve bu tarihten sonra olan ve elektronik ihale yöntemiyle yapılan ihalelerde geçici teminat mektubu olarak yalnızca elektronik geçici teminat mektupları sunulabilecektir. Bilgilerinize rica olunur. Gültekin Güler Genel Sekreter
13.07.2021
TMO Satış Duyurusu
Sayın Üyemiz, Toprak Mahsulleri Ofisi Genel Müdürlüğünden Birliğimize intikal eden Elektronik Ürün Senetli (ELÜS) stokları ile ithal ve bazı yerli ürünlerin satış işleminin web tabanlı "TMO ELEKTRONİK SATIŞ PLATFORMU" üzerinden yapılmasına ilişkin yazı ektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
13.07.2021
LEADS 2021 Etkinliği
Sayın Üyemiz, Hindistan Ticaret ve Sanayi Odaları Federasyonu (FICCI) tarafından, Hindistan Dışişleri Bakanlığı desteği ile 14-15 Eylül 2021 tarihlerinde Yeni Delhi de "LEADS 2021: Reimagine the World" adlı etkinliğinin düzenleneceği bildirilmektedir. Yazıda devamla, sanal ve yüz yüze katılım seçeneği sunan söz konusu etkinliğin ana teması "Future for Partnerships" olacağı ifade edilmektedir. LEADS, FICCI tarafından dünyadaki ekonomik büyüme hakkında küresel liderlerin görüş alışverişinde bulunabileceği bir platform olarak tasarlanmıştır. Geçen sene Ekim ayında düzenlenen LEADS 2020 etkinliğine 98 ülkeden 2600 den fazla dinleyici ve 27 ülkeden 78 konuşmacı katılım sağlamıştır. FICCI LEADS 2021 etkinliği ile ilgili detaylı bilgilere https://www.ficcileads.in adresinden ulaşılabilmektedir. Etkinliğe kayıt olmak için ise https://registrations.ficci.com/FICCILEADS2021/onlineregistration.asp adresini ziyaret etmeniz gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
9.07.2021
COVID-19 Pandemisiyle Mücadele Kapsamında Moskova da Alınan Tedbirler
Sayın Üyemiz, Rusya Federasyonu nda COVID-19 pandemisinde üçüncü dalga sürecinde 28 Haziran 2021 tarihinde günlük vaka sayısında 20.616 seviyesine ulaşıldığı, Moskova şehrinde ise özellikle Haziran ayının ortalarına doğru 9 bin seviyesinin aşılmasını müteakip muhtelif karantina tedbirlerinin tekrar uygulamaya geçirilmeye başlandığı bildirilmektedir. Yazıda devamla, Moskova da COVID-19 pandemisiyle mücadele kapsamında; 28 Haziran 2021 tarihinden itibaren kafe ve restoranlara sadece aşılanmış, son 6 ayda hastalığı geçirmiş veya son 3 günde yapılan PCR testi negatif çıkanların alınması yönünde bir düzenlemeye gidildiği, (Girişlerde QR kod talep edilmektedir) söz konusu uygulamanın, kafe ve restoranların veranda benzeri dış bölümleri için 12 Temmuz da yürürlüğe konulmasının öngörüldüğü, ayrıca, otelde ikamet edenlerin de, otel yerleşkesindeki mevcut restoran ve kafelerde (dışarıdan girişlere yönelik kısıtlama mevcut değilse) yine QR kod uygulamasına tabi tutulduğu, karantina tedbirinin Moskova da (turistler de dahil olmak üzere) titizlikle uygulanmakta olduğu ve QR kod teminine yönelik ilgili resmi internet sunucusunda ise üçüncü ülke vatandaşlarına (Rusya da çalışma iznine sahip olanlar hariç) matuf bir hizmet verilmediğinin müşahede edildiği ifade edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
9.07.2021
AB nin Yeni KDV Sistemi
Sayın Üyemiz, Avrupa Birliği nin (AB) sınır ötesi e-ticaret işlemlerinde uyguladığı yeni Katma Değer Vergisi (KDV) kurallarının 1 Temmuz 2021 tarihinden itibaren yürürlüğe konacağı belirtilerek, AB ye yönelik gerçek değeri 150 Avro yu aşmayan sevkiyatlarda da geçerli olacak yeni sistem kapsamında, 22 Avro nun altındaki değerler için uygulanan KDV muafiyetinin tamamen kaldırılacağı açıklanmıştır. Yazıda devamla, ticari numunelerin gümrük işlemlerine ilişkin KDV ve Gümrük Vergisi istisnası veya sadece gümrük vergisi istisnasının uygulanacağı gümrük beyannamesi seçeneklerinin sunulacağı ifade edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
6.07.2021
İş Yerleri için Afet Farkındalık Eğitimi
Sayın Üyemiz, 7 Temmuz 2021 Çarşamba günü saat 14:00 te internet üzerinden " İş Yerleri için Afet Farkındalık Eğitimi" düzenlenecektir. Eğitim programına ilişkin davet ekte sunulmaktadır. Türkiye Odalar ve Borsalar Birliği ile AFAD iş birliğinde gerçekleştirilecek olan webinarda 2021 Türkiye Afet Eğitim Yılı çerçevesinde afetler kapsamında iş yerlerindeki riskler, afet ve acil durum öncesi hazırlıklar, afet ve acil durum sonrası ilk saatlerde yapılması gerekenler ile afet acil durum sırasında doğru davranışlar anlatılacak olup program sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
6.07.2021
Kaliforniya Sanal Ticaret Heyeti - İptal Duyurusu
Sayın Üyemiz, 7 Temmuz 2021 tarihinde gerçekleştirilmesi planlanan Kaliforniya Sanal Ticaret Heyeti etkinliği iptal edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
6.07.2021
Kadın Girişimciler için Yapay Zeka Webinarı ve Eğitimi
Sayın Üyemiz, TOBB, TOBB ETÜ ve Global Al Hub iş birliğinde yürütülen Yapay Zeka Eğitim ve Farkındalık Projesi kapsamında; 8 Temmuz 2021 Perşembe günü 15:30 - 17:30 saatleri arasında "Kadın Girişimciler için Yapay Zeka" etkinliğinin açılış webinarı gerçekleştirilecektir. Söz konusu webinar sonrasında tüm katılımcılar, Global AI Hub platformu üzerinden Yapay Zekaya İlk Adım ve Herkes için Hiperotomasyon eğitimlerine devam edebilecek olup eğitimleri başarıyla tamamlayanlara İsviçre standartlarında sertifikaları ücretsiz olarak verilecektir. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.07.2021
Almanya nın Yeni Tedarik Zinciri Yasasının Tanıtımı
Sayın Üyemiz, Alman Federal Meclisi tarafından yeni bir tedarik zinciri yasası ("Lieferkettensorgfaltsgesetz") kabul edildiği ve gelecek yılın başında yürürlüğe gireceğini belirtilerek, yeni yasanın yurtdışındaki Alman şirketleri ve dünyanın farklı bölgelerindeki iş ortakları için neler içerdiğinin detaylı inceleneceği bir bilgilendirme toplantısı düzenleneceği bildirilmektedir. 7 Temmuz 2021 tarihinde 15:00-16:30 saatleri arasında sanal ortamda düzenlenecek toplantıya https://www.dtr-ihk.de/tr/etkinlikler/etkinlik-bilgileri/bilgilendirme-toplantisi-almanyanin-yenitedarik-zinciri-yasasinin-tanitimi linkinden kayıt yaptırmak mümkündür. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
6.07.2021
Üretimde Yapısal Dönüşüm Çağrısı Bilgilendirme Semineri
Sayın Üyemiz, Birliğimiz organizasyonunda, 5 Temmuz 2021 Pazartesi günü saat 14:00 te internet üzerinden, "Üretimde Yapısal Dönüşüm Çağrısı Bilgilendirme Semineri" düzenlenecektir. Seminere ilişkin davet ekte sunulmaktadır. Sanayi ve Teknoloji Bakanlığı, Türkiye Odalar ve Borsalar Birliği ve Organize Sanayi Bölgeleri Üst Kuruluşu iş birliğinde gerçekleştirilecek olan webinarda Teknoloji Odaklı Sanayi Hamlesi Programı kapsamında ilan edilen, orta-yüksek ve yüksek teknolojili ilgili sektörlerdeki 149 ürün ve 4 yenilikçi teknoloji başlığı (Servo Teknolojileri, Robotik ve Otomasyon Sistem Bileşenleri, Eklemeli İmalat Makineleri, Otonom/Yarı Otonom Endüstriyel ve Hizmet Robotları) altında 29 yenilikçi teknoloji alanındaki projeleri destekleyen Üretim Yapısal Dönüşüm Çağrısı anlatılacak olup, seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Bilgilerinize sunulur. Gültekin Güler Genel Sekreter
2.07.2021
Ürdün Sanal Yatırım Konferansı
Sayın Üyemiz, Ürdün Yatırım Komisyonu nun, Ürdün Başbakanı Dr. Bisher Al Khasawneh in himayesinde, 12-13 Temmuz 2021 tarihlerinde Ürdün Sanal Yatırım Konferansı nı gerçekleştireceği bildirilmektedir. Yazıda devamla, ilgili konferans kapsamında, Ürdün de ve küresel çapta yatırım ortamı ve gelecekteki eğilimlerin tartışılacağı belirtilmekte olup, etkinliğe yönelik detaylı bilgi için aşağıdaki iletişim bilgilerip paylaşılmaktadır. Telefon: +962 (6) 5608400 Fax: +962 (6) 5608416 Email: info@jic.gov.jo İnternet sitesi: https://events.jic.gov.jo/ Bahse konu etkinliğin programı ekte sunulmaktadır. Bilgilerinize rica ederiz. Gültein Güler Genel Sekreter
2.07.2021
KARAYOLU TAŞIMA YÖNETMELİĞİNDE DEĞİŞİKLİK YAPILMASINA DAİR YÖNETMELİK
Sayın Üyemiz; 02.07.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlanan"KARAYOLU TAŞIMA YÖNETMELİĞİNDE DEĞİŞİKLİK YAPILMASINA DAİR YÖNETMELİK"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
2.07.2021
BOZULABİLİR GIDA MADDELERİNİN TAŞIMACILIĞINDA KULLANILACAK ÖZEL EKİPMANLAR HAKKINDA YÖNETMELİK
Sayın Üyemiz; 02.07.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlanan"BOZULABİLİR GIDA MADDELERİNİN TAŞIMACILIĞINDA KULLANILACAK ÖZEL EKİPMANLAR HAKKINDA YÖNETMELİK"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
2.07.2021
PERAKENDE TİCARETTE UYGULANACAK İLKE VE KURALLAR HAKKINDA YÖNETMELİKTE DEĞİŞİKLİK YAPILMASINA DAİR YÖNETMELİK
Sayın Üyemiz; 02.07.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlanan"PERAKENDE TİCARETTE UYGULANACAK İLKE VE KURALLAR HAKKINDAYÖNETMELİKTE DEĞİŞİKLİK YAPILMASINA DAİR YÖNETMELİK"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
2.07.2021
Varlık Barışı
Sayın Üyemiz, Resmi Gazete de yayımlanan Cumhurbaşkanlığı kararıyla varlık barışı başvuruları 6 ay uzatıldı. Varlık barışı başvuruları 2021 sonuna uzatıldı. https://www.resmigazete.gov.tr/eskiler/2021/06/20210630-6.pdf Geçici Madde 93 – (Ek:11/11/2020-7256/21 md.) Yurt dışında bulunan para, altın, döviz, menkul kıymet ve diğer sermaye piyasası araçlarını, bu maddedeki hükümler çerçevesinde, 30/6/2021 tarihine kadar Türkiye’deki banka veya aracı kuruma bildiren gerçek ve tüzel kişiler, söz konusu varlıkları serbestçe tasarruf edebilirler. Birinci fıkra kapsamına giren varlıklar, yurt dışında bulunan banka veya finansal kurumlardan kullanılan ve bu maddenin yürürlük tarihi itibarıyla kanuni defterlerde kayıtlı olan kredilerin en geç 30/6/2021 tarihine kadar kapatılmasında kullanılabilir. Bu takdirde, defter kayıtlarından düşülmesi kaydıyla, borcun ödenmesinde kullanılan varlıklar için Türkiye’ye getirilme şartı aranmaksızın bu madde hükümlerinden yararlanılır. Bu maddenin yürürlük tarihi itibarıyla kanuni defterlerde kayıtlı olan sermaye avanslarının, yurt dışında bulunan para, altın, döviz, menkul kıymet ve diğer sermaye piyasası araçlarının bu maddenin yürürlüğe girmesinden önce Türkiye’ye getirilmek suretiyle karşılanmış olması hâlinde, söz konusu avansların defter kayıtlarından düşülmesi kaydıyla bu madde hükümlerinden yararlanılır. 213 sayılı Vergi Usul Kanunu uyarınca defter tutan mükellefler, bu madde kapsamında Türkiye’ye getirilen varlıklarını, dönem kazancının tespitinde dikkate almaksızın işletmelerine dâhil edebilecekleri gibi aynı varlıkları vergiye tabi kazancın ve kurumlar için dağıtılabilir kazancın tespitinde dikkate almaksızın işletmelerinden çekebilirler. Gelir veya kurumlar vergisi mükelleflerince sahip olunan ve Türkiye’de bulunan ancak kanuni defter kayıtlarında yer almayan para, altın, döviz, menkul kıymet ve diğer sermaye piyasası araçları ile taşınmazlar, 30/6/2021 tarihine kadar vergi dairelerine bildirilir. Bildirilen söz konusu varlıklar, 30/6/2021 tarihine kadar, dönem kazancının tespitinde dikkate alınmaksızın kanuni defterlere kaydedilebilir. Bu takdirde, söz konusu varlıklar vergiye tabi kazancın ve kurumlar için dağıtılabilir kazancın tespitinde dikkate alınmaksızın işletmeden çekilebilir. Bu fıkra kapsamında bildirilen taşınmazların ayni sermaye olarak konulmak suretiyle işletme kayıtlarına alınması hâlinde, sermaye artırım kararının bildirim tarihi itibarıyla alınmış olması ve söz konusu kararın bildirim tarihini izleyen onuncu ayın sonuna kadar ticaret siciline tescil edilmesi kaydıyla, bu madde hükümlerinden faydalanılabilir. Türkiye’ye getirilen veya kanuni defterlere kaydedilen varlıkların elden çıkarılmasından doğan zararlar, gelir veya kurumlar vergisi uygulaması bakımından gider veya indirim olarak kabul edilmez. Bu madde kapsamında bildirilen varlıklar nedeniyle hiçbir suretle vergi incelemesi ve vergi tarhiyatı yapılmaz. Bu hükümden faydalanılabilmesi için birinci fıkra uyarınca bildirilen varlıkların, bildirimin yapıldığı tarihten itibaren üç ay içinde Türkiye’ye getirilmesi veya Türkiye’deki banka ya da aracı kurumlarda açılacak bir hesaba transfer edilmesi şarttır. Cumhurbaşkanı, bu maddede yer alan süreleri, bitim tarihlerinden itibaren her defasında altı ayı geçmeyen süreler hâlinde bir yıla kadar uzatmaya; Hazine ve Maliye Bakanlığı, madde kapsamına giren varlıkların Türkiye’ye getirilmesi ve bildirimi ile işletmeye dâhil edilmelerine ilişkin hususları, bildirime esas değerlerin tespiti, bildirimin şekli, içeriği ve ekleri ile yapılacağı yeri, maddenin uygulanmasında kullanılacak bilgi ve belgeler ile uygulamaya ilişkin usul ve esasları belirlemeye yetkilidir Gültekin GÜLER Genel Sekreter
30.06.2021
Gönderi Ön Bilgilendirme-Advanced Cargo Information (ACI-ACID)
Sayın Üyemiz, Kahire Ticaret Müşavirliği nden alınan bir yazıya atfen Mısır daki iş çevrelerinin ve çok uluslu şirketlerin talepleri doğrultusunda, Mısır Maliye Bakanlığı tarafından 23/06/2021 tarihli ve 2021/328 sayılı Karar ın yayımlandığı ifade edilerek, ACI-ACID uygulaması başlama tarihinin 3 ay ertelendiği belirtilmiştir. Yazıda, 1 Ekim 2021 tarihinden itibaren sadece sisteme dahil kargoların ilgili ülke gümrük limanlarında kabul edileceği ve başka bir erteleme yapılmayacağı da vurgulanmıştır. Bilgilerinize sunarız. Saygılarımızla, Gültekin Güler Genel Sekreter
30.06.2021
Ar-Ge Süreçleri ve Ar-Ge Destekleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden "Ar-Ge Süreçleri ve Ar-Ge Destekleri Eğitimi" gerçekleştirilecektir. Günümüzde Türkiye ve dünyada Ar-Ge sonucunda oluşan ürünler en yüksek seviyesine ulaşmıştır. Ancak kurulan küçük şirketlerin %50 si ilk 5 yılda, kalanın %50 si de ikinci 5 yılda kapanmak durumundakalmaktadır. Şirketi ayakta tutabilecek, sürdürülebilir, doğru Ar-Ge ye nasıl başlanır ve nasıl finansman sağlanır, Ar-Ge süreçleri nelerdir, doğru ekip nasıl kurulur ve geliştirilir, ürünü ne zaman piyasaya sürmek gerekir, doğru finansman kaynakları nelerdir, bu kaynaklara nasıl erişilebilir. Bu eğitimde bu sorulara cevaplar bulunmaya çalışılacaktır. Eğitime ilişkin detaylı bilgi ektedir. Bilgilerinize sunulur. Saygılarımızla, Gültekin Güler Genel Sekreter
29.06.2021
Yatırımlarda devlet yardımları hakkında kararda değişiklik yapılmasına dair karar
Sayın Üyemiz; TUBİTAK destekli çevre yatırımları kapsamında en az %15 su tasarrufu veya emisyon/atık azalımı sağlayacak entegre damızlık hayvancılık, gıda ve içecek ürünleri imalatı ve 5 dekar ve üstü seracılık, kültür mantarı yetiştiriciliği yatırımlarının asgari yatırım tutarları ve devlet tarafından verilecek destek miktarlarında yapılan değişiklikler hakkında bilgi içeren "Yatırımlarda devlet yardımları hakkında kararda değişiklik yapılmasına dair karar"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
29.06.2021
SEBZE VE MEYVELERİN TOPTAN VE PERAKENDE TİCARETİNDE UYULMASI GEREKEN STANDARTLAR HAKKINDA TEBLİĞ
Sayın Üyemiz; 29.06.2021 tarih ve 31526 sayılı Resmi Gazetede yayımlananSebze ve Meyvelerin ambalajlanmasında, taşınmasında, depolanmasında ve perakende satışa sunulmasında uyulması gerekenyeni standartlar hakkında bilgi içeren"SEBZE VE MEYVELERİN TOPTAN VE PERAKENDE TİCARETİNDEUYULMASI GEREKEN STANDARTLAR HAKKINDA TEBLİĞ"aşağıda yer alan ektebilgilerinize sunulmuştur. Ek-1 Saygılarımızla, Gültekin GÜLER Genel Sekreter
29.06.2021
Almanya ve Romanya Sohbet Toplantısı
Sayın Üyemiz, 30 Haziran 2021 Çarşamba günü 14.00-16.00 saatleri arasında Almanya da görev yapmakta olan Ticaret Müşavir ve bu ülkelerde iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı "İş Dünyası Temsilcilerimizin Gözüyle Almanya" e-sohbet toplantısının, 2 Temmuz 2021 Cuma günü 14:00-15:30 saatleri arasında ise Romanya da görev yapmakta olan Ticaret Müşavirlerimiz ve Ataşemiz ile Romanya daki en büyük online pazar yeri olan eMAG Romanya temsilcilerinin konuşmacı olarak katılacağı İngilizce dilinde "eMAG Romanya ile Romanya Pazarında E-Ticaret Fırsatları" e-sohbet toplantısının gerçekleştirileceği bildirilmektedir. Toplantıların programı ve toplantıya katılmak için gerekli linkler ekte sunulmuştur. Bilgilerinize sunulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
28.06.2021
ÇİĞ SÜT TEBLİĞİ VE YÖNETMELİKLERİ RESMİ GAZETE DE YAYIMLANDI.
Sayın Üyemiz; 27.06.2021 tarih ve 31524 sayılı Resmi Gazetede yayımlananÇİĞ SÜTÜN SÖZLEŞMELİ USULDE ALIM SATIMINA İLİŞKİNYÖNETMELİKTE DEĞİŞİKLİK YAPILMASINADAİR YÖNETMELİK -ÇİĞ SÜT DESTEĞİ VE SÜT PİYASASININ DÜZENLENMESİUYGULAMA TEBLİĞİ-ÇİĞ İNEK SÜTÜNÜN SINIFLANDIRILMASINA İLİŞKİN TEBLİĞ(TEBLİĞ NO: 2019/64)’DE DEĞİŞİKLİK YAPILMASINADAİR TEBLİĞaşağıda yer alan eklerdebilgilerinize sunulmuştur. Ek-1 Ek-2 Ek-3 Saygılarımızla, Gültekin GÜLER Genel Sekreter
28.06.2021
Suriye Hibe Un Temin İhalesi
Sayın Üyemiz; Suriye de yaşayan ve bu ülkedeki olaylardan zarar gören sivil halka yardım amacıyla ekmeklik buğday karşılığı 17.500 ton (± %20 TMO opsiyonunda) çuvallı unun temin ihalesi, 02.07.2021tarihi saat 10.30 da TMO Genel Müdürlüğünde yapılacaktır. Bilgilerinize sunarız. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.06.2021
Endonezya Dışişleri Bakanlığında Düzenlenecek İş Forumu
Sayın Üyemiz; Endonezya Dışişleri Bakanlığı tarafından 14 Temmuz 2021 tarihinde 10.00-15.00 saatleri arasında (Türkiye saati) hibrit formatta "Endonezya-Merkezi ve Doğu Avrupa İş Forumu"nun (Indonesia-Central and Eastern Europe Business Forum, INA-CEE) düzenleneceği belirtilmektedir. Düzenlenecek İş Forumu ile karşılıklı ticaret ve yatırımın artırılması, dijital ekonomiden faydalanma, e-sağlık ve yeşil ekonomide işbirliği imkânlarını araştırma amaçları hedeflenmektedir. Katılımcıların iş dernekleri, KOBİ ler ve devlet yetkilileri olacağı ifade edilmekte olup, ilgili foruma ziyaretçi ya da katılımcı olarak iştirak etmek içinhttps://www.ina-lac.com/en/about-ina-ceeadresinden kayıt yaptırılabileceği ve bu platform aracılığıyla iş dünyasının iş ortaklıkları kurabileceği, iş ortaklarıyla iletişimlerini sağlayabileceği ve ürünlerinin tanıtımını yapabileceği belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla,
25.06.2021
Büyükbaş ve Küçükbaş Hayvancılık İşletmelerine Yönelik Yatırımların Desteklenmesine İlişkin Uygulama Esasları Tebliğ
Sayın Üyemiz; 25.06.2021 tarih ve 31522 sayılı Resmi Gazetede yayınlanan Büyükbaş ve Küçükbaş Hayvancılık İşletmelerine Yönelik Yatırımların Desteklenmesine İlişkin Uygulama Esasları Tebliğiektebilgilerinize sunulmuştur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.06.2021
Hızlı Destek Programı Bilgilendirme Semineri
Sayın Üyemiz; 29 Haziran 2021 Salı günü saat 15:30 da internet üzerinden; COVID-19 dan Etkilenen Mikro ve Küçük İşletmelere Hızlı Destek Programı (Yeni Dönem) Bilgilendirme Semineri internet üzerinden düzenlenecektir. Program ekte sunulmaktadır. KOSGEB, TOBB ve OSBÜK iş birliğinde internet üzerinden gerçekleştirilecek olan seminerde COVID-19 salgınından etkilenen imalat, bilgisayar programlama ve bilimsel Ar-Ge sektörlerinde faaliyet gösteren mikro ve küçük ölçekli işletmelere yönelik olarak teminatsız ve faizsiz geri ödemeli destek olarak açıklanan ve son başvuru tarihi 9 Temmuz 2021 olan "Hızlı Destek Programı" anlatılacak, seminer sonunda katılımcıların soruları cevaplandırılacaktır. Bilgilerinize Sunarız. Saygılarımızla, Gültekin GÜLER
25.06.2021
Çin Halk Cumhuriyeti Ticari Dolandırıcılık Vakaları
Sayın Üyemiz, Son zamanlarda, bazı Çinli firmaların, pek çok firmamızı, hammadde ve ara mamulleri piyasa ortalamasının oldukça altında bir fiyatla temini taahhüdü ve peşin ödeme veya büyük miktarlarda avans ödemesi yoluyla dolandırdıkları belirtilerek Çin ile ticaret yapacak firmalarımızın, kendilerine ulaşan emtia satış talepleri konusunda öncelikle bu ülkedeki temsilcilerimizle irtibata geçmelerinin önem arz ettiği belirtilmektedir. Bilgilerinize önemle rica ederiz. Saygılarımızla, Gültekin Güler Genel Sekreter
25.06.2021
Türkiye-AB İş Dünyası Diyaloğu (TEBD) Projesi-Tarımsal Gıda Forumu
Sayın Üyemiz; Avrupa Birliği nin sağladığı mali destekle Birliğimiz ve "Avrupa Ticaret ve Sanayi Odaları Birliği" (EUROCHAMBRES) işbirliğinde yürütülmekte olan "Türkiye-AB İş Dünyası Diyaloğu (TEBD)" projesi kapsamında, 28-29 Temmuz 2021 tarihlerinde, çevrim içi olarak, "Tarımsal Gıda Forumu" etkinliği gerçekleştirilecektir. Söz konusu forum, 21-22 Nisan 2021 tarihlerinde düzenlenen "Tarımsal Gıda Forumu"nun devamı niteliğinde olup, endüstri liderlerini, politika yapıcıları, çiftçileri, tarımsal gıda tedarik zinciri aktörleri, kamu kurumları ve diğer ilgili paydaş kuruluşları; 6 farklı oturum, paneller ve interaktif yuvarlak masalar aracılığıyla, "tarımsal gıda" alanındaki temel konuları tartışmak ve firmalar arasında yeni ortaklıklar kurmalarına fırsat yaratmak için bir araya getirecektir. Birliğimiz ve EUROCHAMBRES işbirliğinde 28-29 Temmuz 2021 tarihlerinde düzenlenecek olan "Tarımsal Gıda Forumu" etkinliği, aşağıdaki konularda altı interaktif oturumdan oluşmaktadır: 1. Coğrafi İşaretli Ürünler 2. Kuruyemişler ve Meyve 3. Aromatik Bitkiler 4. Dondurulmuş Gıdalar (su ürünleri dahil olmak üzere) 5. Sağlıklı Yaşam için Besleyici Ürünler (vegan, glutensiz, diyabetik vb) 6. Etkinlik için düzenlenen ankete katılan firma ve paydaşların ilgi gösterdikleri konu başlıklarına göre oluşturulacaktır. Etkinliğe katılmak için gündemin de yer aldığıq.surveypal.com/TEBD-Agri-food-Network-Event-Registration/0anketi üzerinden 4 Temmuz 2021 tarihine kadar kayıt yaptırılması gerekmektedir. Etkinlik 28 Temmuz 2021 tarihinde başlayacak olup, etkinlik boyunca Türkçe ve İngilizce simültane çeviri sağlanacaktır. Bilgilerini ve "Türkiye-AB İş Dünyası Diyaloğu (TEBD)" projesi çerçevesinde düzenlenecek olan "Tarımsal Gıda Forumu" etkinliğine katılımınızı rica ederiz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.06.2021
TMO Randevulu Alım Hk.
Sayın Üyemiz, TMO dan gönderilen yazıda, Kurumumuz 2021 dönemi hububat (buğday, arpa, çavdar, tritikale ve yulaf) ve bakliyat alımlarınıgeçtiğimiz yıllarda olduğu gibi randevulu olarak yapacaktır. Lisanslı Depolarda yapılacak alımlardarandevu şartı aranmayacak olup, randevulu alım ile ilgili usul ve esasları içerir duyuru metni yazımızekinde sunulmuştur, bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
24.06.2021
ICDT - Tarım ve gıda ürünleri konulu ArapAfrika İş Forumu
Sayın Üyemiz, 6-8 Temmuz 2021 tarihlerinde ICDT ve Afrika da Ekonomik Kalkınma için Arap Bankası (BADEA) iş birliğinde tarım ve gıda ürünleri konulu çevrimiçi Arap-Afrika İş Forumu düzenleneceği bildirilmektedir. Anılan etkinliğin programı ekte sunulmakta olup, kayıt ve ayrıntılı bilgi için https://icdtbadeabf2021.floor.bz/ adresinin kullanılması mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
Virtual Reverse Trade Mission to California
Sayın Üyemiz, 7 Temmuz 2021 tarihinde Türkiye saatiyle 16:30-17:30 saatleri arasında ABD Ticaret Odası, Birliğimiz, ABD-Türkiye İş Konseyi ve Kaliforniya Valiliği İş ve Ekonomik Kalkınma Ofisi işbirliğinde ABD ve Türk özel sektörlerinden üst düzey temsilciler ve devlet yetkililerinin katılımıyla ABD sanal ticaret misyonu düzenleneceği bildirilmektedir. Yazıda devamla, anılan ticaret heyeti kapsamında Kaliforniya ile iş yapan Türk şirketlerine yönelik fırsatlara odaklanılacağı ve devlet yetkilerinin yatırım teşvikleri konusunda bilgi vereceği belirtilmektedir. Etkinliğe ilişkin broşür ekte sunulmakta olup, ayrıntılı bilgi ve kayıt için https://events.uschamber.com/California adresini kullanmak mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
TMO Kamuoyu Açıklaması
Sayın Üyemiz, TMO Genel Müdürlüğünde yapılan açıklamada; Hububat ve yem piyasalarında istikrarı sağlamak ve ürün arzında oluşan açığı kapatmak üzere ihtiyacımız olan hammaddenin bir kısmı dış alımla tedarik edilerek uygun fiyatla piyasaya arz edilmesi ve gıda enflasyonu riskinin önüne geçilmesi planlanmaktadır. Bu doğrultuda ilk etapta 320 bin ton arpa ve yaklaşık 400 bin ton buğday ithalat ihaleleri için iş ve işlemler başlatılmıştır. TMO, her koşulda üreticilerimizin yanında olmaya devam etmektedir. Yem hammaddelerine yönelik gerçekleştirdiğimiz son hamlelerimizin temelinde hayvansal üretimin bel kemiği olan besici ve yetiştiricilerimizin ihtiyacını gidermek ve hayvancılıkla uğraşan çiftçilerimizin yem maliyetlerinin azaltılmasına katkı sağlamak yer almaktadır, bilgisi yer almaktadır. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
Devlet Destekli Ticari Alacak Sigortası Hk.
Sayın Üyemiz, Devlet Destekli Ticari Alacak Sigortası Sistemine devlet tarafından taahhüt edilecek reasürans değerine dair karar ın yürürlüğe konulmasına dair karar Resmi Gazetede yayınlandı. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
TOBB İkili Odalar a Üyelik
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği nin yurtdışında muadili olan özel sektör kuruluşları (Oda/Birlik/Federasyon) ile kurumsal işbirliğini geliştirme çabaları kapsamında, bir dizi ülke ile "Ticaret ve Sanayi Odası Forumu" adı altında yapılanmaya gittiğine ilişkin tarafınıza bilgi verilmiştir. Şu ana kadar, ülkemiz önceliklerine uygun olarak 19 ülkeyle "Ticaret ve Sanayi Odası Forumu" kurulmuş olup, bahse konu çalışmalar sürdürülmektedir. Birliğimizce kurulumuş olan Ticaret ve Sanayi Odası Forumu listesi aşağıda sunulmuştur: · Afganistan: Türkiye-Afganistan Ticaret ve Sanayi Odası Forumu · Arnavutluk: Türkiye-Arnavutluk Ticaret ve Sanayi Odası Forumu · Azerbaycan: Türkiye-Azerbaycan Ticaret ve Sanayi Odası Forumu · Başkurdistan: Türkiye-Başkurdistan Ticaret ve Sanayi Odası Forumu · Bosna Hersek: Türkiye-Bosna Hersek Ticaret ve Sanayi Odası Forumu · Bulgaristan: Türkiye-Bulgaristan Ticaret ve Sanayi Odası Forumu · Endonezya: Türkiye-Endonezya Ticaret ve Sanayi Odası Forumu · Kazakistan: Türk-Kazak Ticaret ve Sanayi Odası Forumu · Kosova: Türkiye-Kosova Ticaret ve Sanayi Odası Forumu · KKTC: Türkiye-KKTC Ticaret Odası Forumu · Kuzey Makedonya: Türkiye-Kuzey Makedonya Ticaret ve Sanayi Odası Forumu · Kırgızistan: Türk-Kırgız Ticaret ve Sanayi Odası Forumu · Moğolistan: Türk-Moğol Ticaret ve Sanayi Odası Forumu · Moldova: Türkiye-Moldova Ticaret ve Sanayi Odası Forumu · Özbekistan: Türk-Özbek Ticaret ve Sanayi Odası Forumu · Pakistan: Türkiye-Pakistan Ticaret ve Sanayi Odası Forumu · Sırbistan: Türkiye-Sırbistan Ticaret ve Sanayi Odası Forumu · Tataristan: Türkiye-Tataristan Ticaret ve Sanayi Odası Forumu · Ukrayna: Türkiye-Ukrayna Ticaret ve Sanayi Odası Forumu İkili "Oda Forumları" kapsamında, hem Türkiye de hem de muhatap ülkede olmak üzere, mevcut koşullar da dikkate alınarak, geniş katılımlı etkinlikler düzenlenmekte olup, bu etkinlikler ile Türk tarafı üyelerinin kendi aralarında, hem de karşı kanat üyeleri ile bir araya gelmesine olanak sağlanmaktadır. Ayrıca düzenlenen geniş katılımlı etkinliklerde, yine muhatap ülkelerin resmi yetkilileri ve çeşitli sektörlerdeki firma temsilcileri ile ikili görüşme fırsatları sunulmaktadır. Ticaret ve Sanayi Odası Forumlarına ilişkin, üyelik dâhil tüm bilgilere, https://tobb.org.tr/IkiliOdalar/Sayfalar/AnaSayfa.php linkinden ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
Automechanika Dubai 2021 Fuarı
Sayın Üyemiz, Birleşik Arap Emirlikleri nin Dubai Emirliği nde her yıl düzenlenen Automechanika Dubai Fuarı Türkiye milli iştirak organizasyonunun 14-16 Aralık 2021 tarihleri arasında İstanbul Ticaret Odasınca gerçekleştirileceği bildirilmektedir. Fuara ilişkin broşür ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
Küçük İşletmeler İçin Google Eğitim Programı
Sayın Üyemiz, KOBİ lerin dijitalleşmesine yönelik olarak, internetteki görünürlüğünü sağlaması, müşterilerine farklı dijital kanallar üzerinden satış yapmasının desteklenmesi ve geliştirilmesine yardımcı olmak amacıyla Birliğimiz ve Google iş birliğinde "Küçük İşletmeler İçin Google" projesi başlatılmıştır. https://smallbusiness.withgoogle.com/intl/tr_tr adresinden erişim sağlanabilen platformda KOBİ lerin dijital ekonomiye uyum sağlaması ve bu alanda güçlendirilmesi için gerekli ürünler ile çözüm önerileri adım adım açıklanmaktadır. Platform çerçevesinde ayrıca Küçük İşletmeler için Google Eğitim Programı gerçekleştirilecektir. Ekte görseli bulunan eğitim programı kapsamında; - 22 Haziran 2021 Salı günü saat 14:00 te Küçük İşletmeler için Google Oturumu - 29 Haziran 2021 Salı günü saat 14:00 te Google My Business (GMB) ve Benim İşletmem Dijital Oturumu, - 6 Temmuz 2021 Salı günü saat 14:00 te Google Ads 101 Oturumu ve - 8 Temmuz 2021 Perşembe günü saat 14:00 te Perakende İçgörüleri Oturumu olmak üzere 4 online etkinlik düzenlenecektir. Etkinlikler Youtube üzerinden gerçekleştirilecek olup, katılım ve kayıt adresleri http://webinar.tobb.org.tr adresinde yayınlanacaktır. Etkinlik sonlarında katılımcılara soru-cevap imkanı verilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
Dünya Sektörler arası İşbirliği Forumu
Sayın Üyemiz, İnşaat, gıda, tarım, hayvancılık, mobilya, makine, madencilik, enerji, elektrik, tekstil, medikal, hızlı tüketim, genel ticaret ürünleri, sağlık, hizmet sektörü ve dış ticaret sektörlerinden firmaların katılım sağlayacağı Dünya Sektörlerarası İşbirliği Forumu nun 15-16 Eylül 2021 tarihleri arasında İstanbul Pullman Hotel de düzenleneceği bildirilmektedir. Etkinliğe ilişkin tanıtıcı broşür ekte sunulmakta olup, ayrıntılı bilgiye https://www.wciforum.com sitesinden ulaşılması mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
İş Yerleri için Animasyonlu Afet Farkındalık Eğitimi
Sayın Üyemiz, Bildiğiniz üzere, herhangi bir afet durumunda üretimin ve ticaretin en az seviyede etkilenmesinin sağlanabilmesi için işletmelerin de doğal afetlere karşı hazır olması gerekmektedir. İş dünyası afetlere karşı ne kadar hazır olursa Türkiye ekonomisinin de sürdürülebilirliği o denli kuvvetli olacaktır. Bu kapsamda düzenlediğimiz farkındalık eğitimlerinin yanı sıra yapılması gereken yükümlülüklerinizle ilgili bilgi paylaşımlarında bulunmuştuk. Birliğimiz faaliyetleri devam ederken İçişleri Bakanlığımız ile de "2021 Afet Yılı" çalışmaları kapsamında "TOBB-AFAD Eğitim İşbirliği Protokolü" imzaladık. Söz konusu Protokol kapsamında AFAD tarafından iş yerleri için yeni hazırlanan animasyonlu afet farkındalık eğitimi videosuna https://www.youtube.com/watch?v=a6_O_aXy5zo linki üzerinden erişebilirsiniz. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
27. Tiran Uluslararası Fuarı Hk.
Sayın Üyemiz, Arnavutluk un başkenti Tiran da 23-26 Kasım 2021 tarihlerinde sanayi, ticaret, yatırım ve hizmet sektöründe faaliyet gösteren firmaların katılacağı 27. Tiran Uluslararası Fuarı nın düzenleneceği bildirilmektedir. Söz konusu Fuar a ilişkin belgeler ekte sunulmakta olup, ayrıntılı bilgi için İstanbul Ticaret Odası ile iletişime geçilmesi mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
Karadağ İş Hizmet Sektörü Broşürü
Sayın Üyemiz, Karadağ da yapılabilecek yatırımlara ilişkin bilgiler içeren "Karadağ İş Hizmet Sektörü" isimli broşürün bir örneği ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
Ticaret Müşavirleri ile Elektronik Sohbetler - Japonya
Sayın Üyemiz, 23 Haziran 2021 Çarşamba günü saat 10:00 da Japonya da görev yapmakta olan Ticaret Bakanlığı temsilcileri ile Japonya İthalat ve Yatırım Ajansı Danışmanı Makoto Nakamura ve Global Media Corporation CEO su Masanori Tonegawa nın konuşmacı olarak katılarak iş insanlarımızı bilgilendireceği "Japonya Gıda Pazarında Başarılı Olmak" isimli e-sohbet toplantısının gerçekleştirileceği bildirilmektedir. Toplantıya katılmak için gerekli link bilginize sunulmuştur. https://bit.ly/3wqnCly Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
TOBB - Türkiye-Kırgızistan Karma Ekonomik Komisyonu
Sayın Üyemiz, Eşbaşkanlığı Cumhurbaşkanı Yardımcımız Sayın Fuat Oktay tarafından deruhte edilen Türkiye-Kırgızistan Karma Ekonomik Komisyonu (KEK) 10. Dönem toplantısının ileri bir tarihe ertelendiği ifade edilerek, firmalarımızın yaşadıkları sorunlar ve bu sorunların aşılmasına yönelik olası çözüm önerilerine dair görüşler talep edildiği bildirilmektedir. Bilgilerinizi, konunun ilgili üyelerinize duyurulmasını ve iki ülke arasında yaşanan sorunlara dair ilişkin görüşlerin derlenerek 24 Haziran 2021 tarihi mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) adresine iletilmesini rica ederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
23.06.2021
TOBB Nefes Kredisi 2021
Sayın Üyemiz, Nefes Kredisi uygulamasının tekrar başlatılacağı ve krediden 2020 yılı cirosu 2019 yılı cirosuna göre %25 düşük olan üyelerin faydalanabileceği belirtilmiştir. Oda ve borsalarımız ile üyelerden gelen talep doğrultusunda %25 ciro kaybı kriteri kaldırılmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.06.2021
Tarım Ürünleri İthalatında Tarife Kontenjanlarında Yapılan Değişiklik
Sayın Üyemiz, Bazı Tarım ve İşlenmiş Tarım Ürünleri ithalatında tarife kontenjanı uygulamasına ilişkin kararda yapılan değişiklik Resmi Gazetede yayınlandı. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.06.2021
Katma Değer Vergisi Oranlarında Değişiklik
Sayın Üyemiz, Mal ve Hizmetlere uygulanacak Katma Değer Vergisi Oranlarının Tespitine ilişkin kararda yapılan değişiklik Resmi Gazetede yayınlandı. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.06.2021
Destekleme Ödemesi Hk.
Sayın Üyemiz, Tarım Ürünleri Lisanslı Depoculuk Kanunu kapsamında faaliyet gösteren Lisanslı Depolarda Muhafaza edilmesi halinde destekleme ödemesi yapılmasına ilişkin karar Resmi Gazetede yayınlandı. İlgili karar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.06.2021
Bakliyat Peşin Satışlar
Sayın Üyemiz, TMO Mersin Şube Müdürlüğü stoklarına bulunan ve ekli listede (Ek-1) yer alan Pirinçler (Ek-2) yeralan fiyatlarla tarihlerinde 21-30 Haziran 2021 para yatırmak ve 16 Temmuz 2021 tarihine kadar teslimat yapılmak kaydıyla kişi ve kuruluş ayrımı yapılmaksızın serbest olarak peşin bedel mukabilindesatılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
21.06.2021
TMO Çeltik Satışı
Sayın Üyemiz, TMO Bandırma Şube Müdürlüğünün stoklarında bulunan 3579 kodlu 3.150 ton 2020 mahsulüYunanistan Ronaldo çeltik fiyatla (KDV ve maniplasyon hariç, nakliye 3.600 TL/Ton ilave ücretidâhildir.) Bandırma Şube Müdürlüğünce kişi ve kuruluş ayrımı yapılmaksızın serbest olarak peşinbedel mukabili satılacaktır. Randımana göre uygulanacak satış fiyatları ekteki (Ek-1) tabloda belirtilenşekilde uygulanacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
21.06.2021
Lojistik Sektöründe Gıda KaybınıAzaltmaya Yönelik Rehber Doküman-Görüş Talebi
Sayın Üyemiz, Lojistik Sektöründe Gıda Kaybını Azaltmaya YönelikRehber Doküman hazırlandığı bildirilerek, söz konusu Rehber hakkında görüş talebinde bulunulmaktadır. Lojistik Sektöründe Gıda Kaybını Azaltmaya Yönelik Rehber Doküman ekte gönderilmekte olup, konuyailişkin varsa görüşünüzü Borsamıza (eskisehirtb@tobb.org.tr) 21.06.2021 saat 14.00 a kadar iletilmesini ricaederim. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
18.06.2021
Türkiye-Afganistan Ekonomik ve Teknik İşbirliği Ortak Komitesi III. Dönem Toplantısı
Sayın Üyemiz, Türkiye-Afganistan Ekonomik ve Teknik İşbirliği Ortak Komitesi III. Dönem Toplantısı nın 10-11 Temmuz 2021 tarihlerinde Kabil de gerçekleştirilmesinin planlandığı bildirilmektedir. Bahse konu toplantının hazırlık çalışmalarında yararlanılmak üzere Afganistan ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkanları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerilerinin en geç 24 Haziran 2021 Perşembe günü mesai bitimine kadar Borsamıza (eskisehirtb@gmail.com) iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
17.06.2021
5. Antalya Devlet Destekleri Zirvesi
Sayın Üyemiz, Antalya Ticaret ve Sanayi Odası ndan alınan yazıda; ATSO tarafından girişimcilerimizin mevcut desteklerden haberdar olabilmesi için 24 Haziran 2021 Perşembe günü çevrimiçi olarak 5. Antalya Devlet Destekleri Zirvesi düzenlenmesi planlandığı belirtilmektedir. Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
17.06.2021
Yapılandırma Hakkında
Sayın Üyemiz, 7326 sayılı Bazı Alacakların Yeniden Yapılandırılması ile Bazı Kanunlarda Değişiklik Yapılması Hakkında Kanun 09.06.2021 tarihli Resmi gazetede yayımlanmıştır. Kanun içeriğine ilişkin açıklamalar aşağıda yer almaktadır: 1. KAPSAM Kanun un 10 uncu maddesinin 4 inci fıkrası uyarınca 30/4/2021 tarihi itibarıyla ödenmesi gerektiği hâlde bu Kanunun yayımı tarihine kadar ödenmemiş olan; a) Üyelerin oda ve borsalara olan aidat, navlun hasılatından alınacak oda payları ve borsa tescil ücreti borç asılları, b) Oda ve borsaların Birliğimize olan aidat borçları asılları, Kanun kapsamında yapılandırmaya tabi tutulabilecektir. Bu çerçevede üyelerin oda ve borsalara olan 2021 yılı aidat ödemeleri ile oda ve borsaların Birliğimize olan 2021 yılı aidat ödemeleri yapılandırma kapsamında değildir. Bununla birlikte üyelerin oda ve borsalara olan 2020 yılı ve öncesi dönemlere ait aidat ödemeleri ile oda ve borsaların Birliğimize olan 2020 yılı ve öncesi dönemlere ait aidat ödemeleri yapılandırma kapsamında olacaktır. 2. VERGİ MÜKELLEFİYETİ SİLİNEN ÜYELER 17/11/2020 tarihinde yürürlüğe girmiş olan 7256 sayılı Kanun kapsamında yer alan, "vergi mükellefiyeti sona ermiş üyelerin, vergi mükellefiyetinin sona erdiği tarihten sonraki borç asıl ve faizlerinin re sen silinmesi" uygulamasına, 7326 sayılı Kanunda yer verilmemiştir. Bu nedenle vergi mükellefiyeti sona ermiş üyeler bakımından, 7326 sayılı Kanun kapsamında tesis edilmesi gereken bir işlem bulunmamaktadır. 7256 sayılı Kanun gereği olarak vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetinin sona erme tarihi ile 17/11/2020 tarihi arasındaki borç asıl ve faizleri re sen silinmiştir. Bu kapsamdaki üyelerin 17/11/2020 tarihinden sonra tahakkuk etmiş ancak vadesi gelmiş bir borçları da bulunmadığından, Yapılandırma kapsamında olmadıkları değerlendirilmektedir. Öte yandan vergi mükellefiyeti sona ermiş olan üyelerin, mükellefiyetlerinin sona erme tarihinden önceki borçlarının asılları, 7326 sayılı kanun kapsamında yapılandırılabilmektedir. 3. BORÇ SİLİNMESİ ve ÖDEME Yapılandırma kapsamındaki borç asıllarının tamamının kanunda belirtilen ve şekilde ödenmesi halinde faiz, gecikme faizi, gecikme zammı gibi fer i alacakların tahsilinden vazgeçilir. Bununla birlikte yapılandırma kapsamında olan ve Kanunun yayımı tarihinden önce kısmen veya tamamen ödenmiş olan borç asıllarına isabet eden faiz, gecikme faizi, gecikme zammı gibi fer i alacakların da tahsilinden vazgeçilir. Kanun kapsamındaki borçlar için yapılandırmaya başvuranların, borç taksitlerinin birincisini Kanunun yayımlandığı tarihi takip eden dördüncü ayın sonuna kadar (31/10/2021), kalanını ise aylık dönemler hâlinde ve azami toplam altı eşit taksitte (son taksit tarihi 31.03.2022) ödemesi gerekmektedir. Azami altı taksitekadar olan yapılandırma hakkının ne şekilde kullanılacağını üye başvurusunda belli edecektir. Üye tarafından belirlenecek olan taksit adedi, ödenecek toplam borç tutarını değiştirmeyecektir. Üyeler, toplam anapara borç tutarını yukarıda belirtilen taksit sürelerini geçmemek üzere kredi kartına da taksitlendirebileceklerdir. Üyeler, Kanunun yayımlandığı tarihi takip eden üçüncü ayın sonuna kadar (30/09/2021) başvuruda bulunabileceklerdir. Başvuru fiziksel olarak yapılabileceği gibi ebelge.tobb.org.tr veya e-devlet üzerinden de yapılabilecektir. Başvurularda, yapılandırma kapsamında kaç taksit talep edildiğinin belirtilmesi gerekmektedir. Yapılandırmaya başvuru anında askıya alınmış olan üyelerin, ilk taksit ödemeleri ile beraber askıdan indirilmesi gerekmektedir. Ancak bu şekilde askıdan indirilen üyenin, herhangi bir taksiti ödemeyerek yapılandırmayı bozması halinde yeniden askıya alınması gerekmektedir. 4. MUHASEBE İŞLEMLERİ Bu fıkra kapsamında ödenmesi gereken tutarların fıkrada öngörülen süre ve şekilde kısmen veya tamamen ödenmemesi hâlinde, ödenmemiş alacak asılları ile bunlara ilişkin faiz, gecikme faizi, gecikme zammı gibi fer i alacaklar ilgili mevzuat hükümlerine göre tahsil edilir. Bu ana kadar yapılan tahsilatlar Bütçe ve Muhasebe Yönetmeliğinin 58 inci maddesinde belirtilen sıralamaya göre borçtan düşülür ve kalan kısma 6183 sayılı Amme Alacaklarının Tahsil Usulü Hakkında Kanun uyarınca günlük gecikme zammı tahakkuk ettirilmeye devam edilir. 5. UYUŞMAZLIK KONUSU ALACAKLAR Yapılandırmadan faydalanacak kişilerin, yapılandırmaya konu borçlarına dava açmamaları, açılmış davalardan vazgeçmeleri şarttır. Bu Kanunun yayımı tarihinden önce dava konusu edilmiş ve/veya mahkemece hükme bağlanmış ve kesinleşmiş olanlar dâhil olmak üzere icra takibi başlatılmış alacaklar için, borçlunun bu fıkra hükümlerinden yararlanmak üzere başvuruda bulunması hâlinde davalar ve/veya icra takipleri sonlandırılır. Bu kapsamda, tamamı ödenen alacaklara ilişkin yargılama giderleri ile icra masrafları ve vekâlet ücretleri karşılıklı olarak talep edilmez. 6. 7256 SAYILI KANUN KAPSAMINDA YAPILANDIRILAN ALACAKLAR Üyelerin 7256 sayılı Kanun kapsamında yapılandırmış olduğu alacaklar kural olarak 7326 sayılı Kanun kapsamında değildir. Bu bakımdan 7256 sayılı Kanun kapsamında yapılandırması devam eden ve taksitlerini vadesinde ödemeye devam eden üyelerin mevcut yapılandırmalarına uygun davranmaları gerekmektedir. 7256 sayılı Kanun kapsamında taksitlerden herhangi birisini ödemediği için yapılandırması bozulan ve ödenmemiş anapara, faiz ve fer isi yeniden tahakkuk ettirilen üyelerin 7326 sayılı Kanun kapsamında yapılandırmaya başvurması mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
17.06.2021
SMA Tip2 Hastası Toprak Bebek İçin Yardım Kampanyası
Sayın Üyemiz, Eskişehir de yaşayan3,5 yaşındakiToprakYavaş,SMATip2 hastalığıyla mücadele etmektedir. Yurt dışında gerekli tedaviyi alması halinde Toprak bebek sağlığına kavuşabilecektir. Bu sebeple Toprak bebeğin tedavisi için Eskişehir Valiliği’nin izniyle kampanya başlatılmıştır. Kampanyaya katılım ve destek için banka hesap numarası: Banka:Denizbank (Türk Lirası Hesabı) IBAN No:TR 55 0013 4000 0110 4110 8000 01 Hesap Sahibi:Reyhan YAVAŞ Eskişehir Ticaret Borsası
17.06.2021
ACID Numarası Uygulaması, NAFEZA ve Cargo-x Platformları Webinarı
Sayın Üyemiz, ACID (Advanced Cargo Information System-GönderiÖn Bilgilendirme) uygulaması ile ilgili mevcut soru/sorunların değerlendirilerek meselelerinaydınlatılabilmesi amacıyla, 16 Haziran 2021 Çarşamba günü Kahire saati ile 12.00 da (TSİ 13.00) herkeseaçık olacak şekilde İngilizce dilinde bir webinar düzenleneceği belirtilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
16.06.2021
MASAK Bilgilendirme Semineri Hk.
Sayın Üyemiz, 01 Temmuz 2021 Perşembe günü saat 14:00 da internet üzerinden; Kuyumcular, Emlak Danışmanları, İkinci El Araç Ticareti Yapanlar ile Bağımsız Denetim Kuruluşları ve Muhasebeciler için MASAK Bilgilendirme Semineri düzenlenecektir. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; mezkur sektörlerde faaliyet gösterenlere yönelik olarak, Mali Suçları Araştırma Kurulu (MASAK) tarafından kara para aklama, terörizmin finansmanı ile mücadele ve kitle imha silahlarının finansmanının yayılmasının önlenmesi hususları anlatılacaktır. Seminere ilişkin davet ekte sunulmaktadır. Seminer sonunda katılımcıların konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Turquality Destekleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden "Turquality Destekleri Eğitimi" gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TURQUALITY; uluslararası gelişme potansiyeli olan mal ve hizmet ihracatçısışirketlerin faydalandığı devlet destekli bir markalaşma programıdır. Yararlanıcı şirketleri, yüksek katma değer oluşturan, küresel pazarlarda pazar payını artıran, güçlü markalaşma stratejisine sahip, üretimden satış ve satış sonrası hizmetlere kadar tüm süreçleri kapsayacak şekilde yönetsel bilgi birikimine sahip kurumsal yapılar hâline dönüştürmeyi ve uluslararası pazarda küresel marka haline gelmelerini hedefler. Ayrıca, bu markalar kanalıyla Türk malı imajının oluşturulmasını destekler. Eğitimde; mal ve hizmet ihracatında Turquality ve marka destek programları, bunların öngördüğü süreçler, şirketlere sağlanan faydalar, başvuru süreçleri, detaylı şekilde ele alınacaktır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Turquality Destekleri Eğitimi" sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin %70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
TOBB ile AB-Çin KOBİ Merkezi Mutabakat Zaptı Lansmanı ve Bilgilendirme Semineri
Sayın Üyemiz, 17 Haziran 2021 Perşembe günü saat 11:00 da internet üzerinden; TOBB ile AB-Çin KOBİ Merkezi Mutabakat Zaptı Lansmanı ve Bilgilendirme Semineri düzenlenecektir. Seminer programı ekte sunulmaktadır. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; TOBB, Eurochambres ve AB Çin KOBİ Merkezi işbirliğinde KOBİ leri Çin ile iş yapmaya hazırlamak ve halihazırda Çin ile iş yapan KOBİ lere destek olmak amacıyla kurulan AB Çin KOBİ Merkezi ile Birliğimiz arasında imzalanan Mutabakat Zaptı nın lansmanı gerçekleştirilecek, Merkez in KOBİ lere yönelik ürün ve hizmetleri anlatılacak ve seminer sonunda katılımcıların soruları cevaplanacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Global Business Executive Retreat 2021
Sayın Üyemiz, Bosna Hersek Dış Ticaret ve Ekonomik İlişkiler Bakanlığı, Yabancı Yatırımcılar Konseyi ve BH Yatırım Teşvik Ajansı (FİPA) ortaklığında 1-4 Temmuz 2021 tarihleri arasında Jahorina Kayak Merkezi nde Global Business Executive Retreat 2021 konferansının düzenleneceği bildirilmektedir. Bahse konu etkinliğe ilişkin bilgi ve kayıt linki ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Angola Bilgi Notu
Sayın Üyemiz, Angola Cumhurbaşkanı Joao Manuel Gonçalves Lourenço nun 27 Temmuz 2021 tarihinde ülkemize resmi bir ziyaret gerçekleştirmesinin öngörüldüğü bildirilmektedir. Bu itibarla, ilgili ziyaretin hazırlıkları için Dışişleri Bakanlığı na iletilmek üzere, Angola ile ticari ve ekonomik ilişkilerin arttırılmasına yönelik iş birliği imkânları, öncelik verilecek sektörler, ticaretin geliştirilmesi için öneriler, ikili ilişkilerde yaşanan sorunlar ve çözüm önerileri gibi konulara ilişkin görüşlerinizin en geç 18 Haziran Cuma gününe kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Moğolistan Madencilik 2021 Fuarı Hk.
Sayın Üyemiz, Moğolistan Madencilik ve Ağır Sanayi Bakanlığı koordinasyonunda ve Minex Mongolia LLC firması organizatörlüğünde, 1-3 Eylül 2021 tarihlerinde Moğolistan ın başkenti Ulan Bator da madencilik alanında Uluslararası 10. Mongolia Mining Fuarı nın düzenleneceği belirtilmektedir. Fuar için davet mektubunun bir örneği ekte yer almakta olup, detaylı bilgiye http://mongolia-mining.com bağlantısından ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Fransa Ambalaj Tasarısı
Sayın Üyemiz, Fransa nın israfın önlenmesi ve döngüsel iktisat ile ilgili kanun tasarısının, 1 Ocak 2022 tarihinde yürürlüğe girmesinin öngörüldüğü bildirilmektedir. Yazıda, ilgili kanun tasarısı ile Fransa nın meyve ve sebze ithalatının aşağıda açıklandığı şekilde etkilenmesinin beklendiği belirtilmiştir: 1) Plastik ambalajın yasaklanması hususunda: 1.1. Kanunun 77. maddesi çerçevesinde, işlenmemiş sebze ve meyvelerin satışında ürünlerin kısmen veya tamamen plastik ambalaj olmaksızın teşhir edilmesi gerektiği açıklanmıştır. 1.2. Her ne kadar plastik ambalaj kullanımının yasaklanması Fransa da faaliyet gösteren toptancı ve perakendecileri hedef alsa da, ürünlerin ihraç edilmeden önce paketleniyor olduğu göz önünde bulundurulduğunda, alınan kararların ithalatçılarımızı doğrudan etkileyebileceğinin düşünülmekte olduğu ifade edilmiştir. 1.3. Fransız Hükümeti tarafından plastik ambalaj olmaksızın pazarlanması halinde zarar göreceği için bu hükümden muaf olan ürünlere ait taslak listenin yayınlandığı ifade edilerek; 1.3.1.Söz konusu hükümden, yıkanmış ve hazırlanmış (doğranmış yeşil fasulye vb.) ürünlerin muaf olduğu, 1.3.2. Olgunlaşmadan koparılan ve olgunlaşma merkezlerinde satış öncesi olgunlaştırılan meyvelerin (mango, muz ve avokado gibi) plastik ambalaj yasağına dâhil edildiği, bilgileri verilmiştir. Ayrıca, Fransız Meyve ve Sebze İthalatçıları Derneği CSIF yetkililerinin, yıkanmış ve ön hazırlık yapılmış sebzeler ve olgunken koparılmış meyvelerin de bu muafiyetten yararlanabilmesi için Fransız yetkilileri ile görüşmelerine devam ettikleri ifade edilmiştir. 2)Yapışkanlı etiket yasağı hususunda: 2.1. Kanunun 80. Maddesi uyarınca, 1 Ocak 2022 tarihinden itibaren kompost yapılması (doğal gübreye dönüştürülmesi) mümkün olmayan etiket kullanımının yasaklanmasının öngörüldüğü belirtilmiştir. Kanunmetninden, ürünlerin doğrudan üzerine uygulanan etiketlerin yasaklamasının öngörüldüğünün anlaşılmakta olduğu; ancak Fransa ya gönderiminden önce üzerine kompost yapılamayan etiket yapıştırılmış olan ürünlerin perakendecilerde satılmasının mümkün olup olmadığı konusunun henüz belirsiz olduğunun anlaşıldığı açıklanmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Estonya Hak.
Sayın Üyemiz, Ticaret Bakanımız Sayın Mehmet MUŞ un, 12-13 Temmuz 2021 tarihlerinde Estonya yı ziyaret edeceği, söz konusu ziyaret sırasında Türkiye-Estonya Ekonomik ve Ticaret Ortak Komite (JETCO) Kurucu Bildirinin imzalanmasının planlandığı bildirilmektedir. Bu kapsamda, Ticaret Bakanlığı tarafından hazırlık çalışmalarında yararlanmak üzere, Türkiye - Estonya ticari ve ekonomik ilişkilerinde yaşanan sorunlar ve çözüm önerilerine dair görüşlerinizin 18 Haziran 2021 Cuma günü mesai bitimine kadar Borsamıza (eskisehirtb@tobb.org.tr) iletilmesi gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Çin Halk Cumhuriyeti Sohbet Toplantısı
Sayın Üyemiz, 16 Haziran 2021 Çarşamba günü saat 10.30 da Guanco Ticaret Ataşemizin moderatörlüğünde, Çin in en büyük sınır-ötesi e-ticaret platformu olan, Alibaba Group bünyesindeki TMALL Global yetkililerinin konuşmacı olarak katılarak, moda ve bebek / anne ürünleri kategorilerinde TMALL Global platformu aracılığıyla Çin e-ticaret pazarına giriş imkanlarını, bilgi ve tecrübelerini Türk iş insanlarıyla paylaşacağı e-sohbet toplantısının İngilizce olarak gerçekleştirileceği belirtilmektedir. TMALL Global bünyesinde moda ile bebek / anne kategorilerinde yer alan ürünlere ilişkin liste ile toplantı detayları ve katılım linkini içeren program ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
ABD - Türkiye Hidrojen Enerjisi ve Yakıt Deposu Teknolojileri Forumu
Sayın Üyemiz, 15-16 Haziran 2021 tarihlerinde Cisco Webex platformu üzerinden T.C. Enerji ve Tabii Kaynaklar Bakanlığı, ABD Enerji Bakanlığı, ABD Ticaret Bakanlığı ve ABD Dışişleri Bakanlığı tarafından desteklenen "ABD - Türkiye Hidrojen Enerjisi ve Yakıt Deposu Teknolojileri Forumu" düzenleneceği bildirilmektedir. Yazıda devamla, ilgili etkinlik dilinin İngilizce olacağı ve tercüme hizmeti sağlanmayacağı ve yalnızca ABD ve Türk firmaları ile her iki ülkeden devlet yetkililerine açık olacağı belirtilmektedir. Anılan etkinliğin broşürü ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Rusya Federasyonu Tarafından Alınan Tedbirler
Sayın Üyemiz, 15 Nisan - 1 Haziran 2021 tarihleri arasında Rusya Federasyonu ve Türkiye arasındaki tarifeli ve "charter" uçuşlara getirilen geçici kısıtlama kararı hakkında,31 Mayıs 2021 tarihinde yapılan açıklamada; söz konusu geçici kısıtlama uygulamasının 21 Haziran 2021 tarihine kadar (anılan tarih dahil) uzatıldığı belirtilmektedir. Bu aşamada, Rusya Federasyonu na yönelik olarak gerek fuar katılımı gerekse iş ziyareti kapsamında seyahat öngören ihracatçı ve iş insanlarımızın THY yetkililerince yapılacak bilgilendirme ve uyarılara azami dikkat göstermesinde fayda mülahaza edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.06.2021
Genç Girişimci Online Network Programı
Sayın Üyemiz, Ticaret Bakanlığı İhracat Genel Müdürlüğü Kadın ve Genç Girişimciler İhracat Dairesi Başkanlığı tarafından, ülkemiz ihracatının arttırılması vizyonuna ve genç girişimcilerin ihracata yönelmelerine katkı sağlayacak şekilde, genç girişimcilerimize yönelik bir network ağı oluşturmak amacıyla Genç Girişimci Online Networkü Projesi hayata geçirilmiştir. Proje kapsamında yapılacak network toplantıları ihtiyaç duyuldukça yapılacak olup, Projeyle ulusal düzeyde tüm genç girişimcilerimize ulaşılması ve gerekli bilgilendirmelerin yapılabilmesi amaçlanmaktadır. Bu doğrultuda, Genç Girişimci Online Network Projesi kapsamında İlimizde 1 Temmuz 2021 saat 10.30 da düzenlenecek toplantı elektronik ortamda Zoom uygulaması üzerinden gerçekleştirilecek olup katılım sağlamak isteyen tüm genç girişimcilerimizin Borsamıza (eskisehirtb@tobb.org.tr) bilgilerini iletmeleri gerekmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.06.2021
Filistinli Firma Talepleri
Sayın Üyemiz, Filistinli firmaların Türk ihracatçı firmalardan çeşitli ürünleri ithal etmek istedikleri belirtilmekte olup, ilgili firmaların iletişim bilgileri ve konuya ilişkin talepleri ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.06.2021
Ulaştırma Elektronik Takip ve Denetim Sistemi (U-ETDS) Bölgesel Seminerleri
Sayın Üyemiz, Karayolu Taşıma Yönetmeliği çerçevesinde adlarına C2, C3, K1, K3, L1, L2, N1, N2, R1, R2, M1, M2, P1, P2, T1 ve/veya T2 yetki belgesi düzenlenmiş firmaların, faaliyetlerine ilişkin bilgilerini Ulaştırma Elektronik Takip ve Denetim Sistemine (U-ETDS), elektronik olarak eklemeleri/iletmeleri zorunlulukları kapsamında Birliğimiz üyesi gerçek ve tüzel kişilerin bilgilendirilmesi amacıyla Ulaştırma ve Altyapı Bakanlığı himayesinde ve Birliğimiz ev sahipliğinde bölgesel elektronik toplantılar düzenlenmesi planlanmıştır. Planlanan toplantılar webinar şeklinde gerçekleştirilecek olup, katılımcılar soruları ile görüş ve önerilerini hem sistem üzerinden mesaj yazmak suretiyle iletebilecek, hem de sistem üzerinden söz isteyip sözlü olarak iletebileceklerdir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.06.2021
Connecting European Chambers" Davet Yazısı
Sayın Üyemiz, Birliğimizin üyesi olduğu ve Birliğimiz Başkanı M. Rifat Hisarcıklıoğlu nun Başkan Yardımcılığını yürüttüğü Avrupa Ticaret ve Sanayi Odaları Birliği (EUROCHAMBRES) tarafından 29 Haziran-1 Temmuz 2021 tarihleri arasında Avrupa daki bütün yerel/bölgesel odaların davetli olduğu "Connecting European Chambres" adlı etkinlik düzenlenecektir. EUROCHAMBERS tarafından 6. kez düzenlenen "Avrupa Odalarını Buluşturma" etkinliğinin amacı; - Avrupa Birliği nin önümüzdeki dönem sağlayacağı farklı hibe imkânları hakkında yerel ve bölgesel odaları bilgilendirmek, - Avrupa daki yerel ve bölgesel odalar arasında işbirliği ve iletişim ağını geliştirip güçlendirmek, - Odalar arası iyi uygulama örneklerinin ortaya konulmasını sağlamaktır. Etkinlik sadece yerel, bölgesel ve ulusal odalarda AB projeleri ile ilgilenen personele yönelik olarak tasarlanmıştır. Etkinliğin ve 3 gün boyunca yapılacak bütün çalıştayların dili İngilizce olup çeviri imkânı bulunmamaktadır. Etkinlik pandemi nedeniyle bu yıl online olarak gerçekleştirilecektir. Etkinliğe https://www.eventbrite.com/e/connecting-europeanchambers-2021-registration-153434515767 adresinden kayıt yapılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.06.2021
Yazılım Dünyasında Fikri ve Sınai Mülkiyet Hakları Webinarı
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği Türkiye Patent ve Marka Vekilleri Meclisi ve Türkiye Yazılım Meclisi tarafından 16 Haziran 2021 tarihinde saat 14.30 da "Yazılım Dünyasında Fikri ve Sınai Mülkiyet Hakları" isimli bir seminer gerçekleştirilecektir. Toplantıya http://webinar.tobb.org.tr adresinde yer alan linkten erişim sağlanabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.06.2021
Ayçiçek Tohumu İthalatında Sıfır Gümrük Vergisi Uygulaması Devam Edecek
Sayın Üyemiz, Ayçiçek tohumu ithalatında 31 Aralık 2020 tarihli Cumhurbaşkanı kararıyla 30 Haziran a kadar sürmesi öngörülen sıfır gümrük vergisi uygulaması sürecek. Resmi Gazete nin 13 Haziran tarihli sayısında yayımlanan ithalat rejimi kararında değişiklik yapılmasına ilişkin kararla, söz konusu Cumhurbaşkanı kararıyla ayçiçek tohumu ithalatının sıfır olarak belirlenen gümrük vergisinin 30 Haziran a uygulanmasına dair sınırlamayı içeren dipnot yürürlükten kaldırıldı. Kararlar ayrıca, 31 Aralık 2020 tarihli Cumhurbaşkanı kararıyla ayçiçek tohumu yağı için kapsam dahilindeki tüm ülkelerden yapılan ithalata uygulanması ve dipnotta 30 Haziran da sona ermesi öngörülen yüzde 36 oranındaki gümrük vergisi, 13 Haziran dan 30 Haziran a kadar yüzde 10 a düşürüldü. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.06.2021
Hayvan Hastalıklarında Tazminat Yönetmeliğinde Değişiklik Yapılması Hakkında Yönetmelik
Sayın Üyemiz, Resmî Gazete’de yayımlanan Hayvan Hastalıklarında Tazminat Yönetmeliğinde yapılan değişiklik ve ayrıntıları için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.06.2021
Borç yapılandırması Resmi Gazete`de yayımlandı
Sayın Üyemiz, Gelir ve kurumlar vergisi, karşılıksız çek, protesto edilmiş senet, kredi kartı ve diğer kredi borçlarına ilişkin kayıtlar, vergi tahriyatları, gümrük vergileri, sigorta primleri, KYK borçlarının yapılandırılmasıyla ilgili kanun Resmi Gazete de yayımlanarak yürürlüğe girdi. Milyonlarca kişiyi ilgilendiren borç yapılandırmasına ilişkin yasa TBMM de kabul edilmesinin ardından Resmi Gazete de yayımlanarak yürürlüğe girdi. Yasaya göre, Hazine ve Maliye Bakanlığı, Ticaret Bakanlığı, Sosyal Güvenlik Kurumu, il özel idareleri, belediyeler ile Yatırım İzleme ve Koordinasyon Başkanlığına 30 Nisan 2021 e kadar olan bazı borçlar yapılandırılacak. Hangi borçlar yapılandırma kapsamına alındı - Belediyelerin su, atık su ve katı atık ile sunduğu bazı hizmetlerden kaynaklanan ücret alacakları, aldığı bazı paylar, büyükşehir belediyelerinin katı atık ücretleri ile su ve kanalizasyon idarelerinin su ve atık su bedeli alacakları, - Türkiye Esnaf ve Sanatkarları Konfederasyonu, Türkiye Barolar Birliği, Türk Mühendis ve Mimar Odaları Birliği, Türk Tabipleri Birliği, Türk Diş Hekimleri Birliği ile Türk Veteriner Hekimleri Birliğinin bazı alacakları yapılandırılacak, - Her bir taşıt için motorlu taşıtlar vergisi, taşıta ilişkin idari para cezaları ile geçiş ücretinin en az yüzde 10 unun ödenmesi şartıyla taksit ödeme süresince fenni muayene izni verilecek, - Yabancı Memleketlere Gönderilecek Talebe Hakkında Kanun kapsamında yurt dışında öğrenim görenlerin borçlarının da yeniden yapılandırılmasına imkan sağlanacak, - Kesinleşmemiş ya da yargı aşamasında olan resen veya idarece yapılmış vergi tarhiyatları ile gümrük vergileri, çeşitli oranlarda yapılandırılacak. Hesaplanan borç, ilgilinin durumu ve ödenmesi gereken meblağ dikkate alınarak azami 5 yıla kadar taksitlendirilebilecek. Yapılandırılacak tutarların, kanunda öngörülen süre ve şekilde ödenmemesi halinde vade tarihinde değişiklik yapılmayacak. COVID-19 cezaları kapsam dışı Yasaya göre, SGK prim borçları, gümrük cezaları da yeniden yapılandırılabilecek. Otoyol ve köprü cezaları da bu kapsam içinde yer aldı. Koronavirüsle mücadele kapsamında kesilen idari para cezaları ise yapılandırma dışında tutulacak. İlk taksit ödemeleri için son tarih eylül sonu 30 Nisan tarihinden önceki kesinleşmiş borçlar yapılandırmadan yararlanacak. Bunun için 31 Ağustos a kadar başvuru yapılması gerekecek. İlk taksit ödemeleri eylül sonuna kadar yapılacak. İlgili Kanun içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
9.06.2021
Helal Teknik Eğitimi
Sayın Üyemiz, Helal Akreditasyon Kurumu tarafından 21-24 Haziran 2021 tarihlerinde helal uygunluk değerlendirme kuruluşlarında çalışan/çalışacak kişilere yönelik teknik mahiyette çevrimiçi eğitim verileceği bildirilmektedir. Yazıda devamla, eğitim kontenjanının 20 kişiyle sınırlandırıldığı ve katılım ücretinin 1.000 TL/kişi olduğu belirtilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
8.06.2021
Ticaret Müşavirlerimizle Elektronik Sohbetler - Angola
Sayın Üyemiz, 10 Haziran 2021 Perşembe günü 14.00-15.30 saatleri arasında Angola da görev yapmakta olan Ticaret Müşavirimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Toplantının programı ve katılım linki ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
8.06.2021
Ticaret Müşavirlerimizle Elektronik Sohbetler-Moldova
Sayın Üyemiz, 8 Haziran 2021 Salı günü günü 14:00-15:30 saatleri arasında Moldova da görev yapmakta olan Ticaret Müşavirlerimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu etkinliğin programı ve kayıt linki ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
8.06.2021
60.000 Kg Mezbuh Taze Soğutulmuş Gövde (Karkas) Tosun Eti Alımı İçin Piyasa Araştırması
Sayın Üyemiz, Et ve Süt Kurumu Kombina Müdürlüğünce Ek (1) de teknik şartname esaslarına uygun 60.000 kg Mezbuh Taze Soğutulmuş Gövde (Karkas) Tosun Eti alımı planlanmaktadır. Söz konusu alım için yaklaşık maliyet hesaplamasında kullanılacak serbest piyasa birim fiyatlarınızı 09.06.2021 Çarşambasaat 12:00 e kadar 0 (312) 270 42 14 numarasına fax olarak veya mgultekin.gulhan@esk.gov.tr mail adresine, Ek (2) de bulunan birim fiyat cetveline bedel, rakam ve yazı birbirine uygun olarak açıkça yazılarak, üzerinde kazıntı, silinti ve düzeltme yapılmadan, kaşe ve imzalı bir şekilde gönderilmesi talep edilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
8.06.2021
Organize sanayi bölgelerinde (OSB) yer alan parsellerin tamamen veya kısmen bedelsiz olarak tahsis edilmesi Hk.
Sayın Üyemiz, Organize sanayi bölgelerinde (OSB) yer alan parsellerin tamamen veya kısmen bedelsiz olarak tahsis edilmesi uygulaması 31 Aralık 2024 e kadar uzatılmıştır. Konuya ilişkin Cumhurbaşkanı Kararı, Resmi Gazete de yayımlanarak yürürlüğe girmiş olup ekte sunulmaktadır. Buna göre, OSB lerdeki yatırımların, üretim ve istihdamın artırılmasının sağlanması amacıyla buralarda yer alan parsellerin tamamen veya kısmen bedelsiz olarak tahsis edilmesine imkan veren uygulama, 31 Aralık 2024 e kadar sürecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
8.06.2021
AB Çin KOBİ Merkezi
Sayın Üyemiz, KOBİ leri Çin ile iş yapmaya hazırlamak ve halihazırda Çin ile iş yapan KOBİ lere destek olmak amacıyla 2010 yılında Pekin de AB KOBİ Merkezi kurulmuştur. Söz konusu Merkez ile Birliğimiz arasında Mayıs 2021 de imzalanan mutabakat zaptı çerçevesinde, Merkez in hizmetlerinden ülkemiz KOBİ leri de faydalanabilmektedir. AB Çin KOBİ Merkezi tarafından ülkemiz KOBİ lerine yönelik olarak; - Çin pazarı ve Çin pazarına hazırlık konularında kılavuzlar, eğitimler - İşletmelerin Çin pazarına hazırlıklarını ölçmek için testler, - Ülkemiz KOBİ lerinin Çin pazarı hakkında sorularını cevaplamak üzere Danışma/Tavsiye Merkezi, - Piyasa araştırma raporları, hukuki konuların yer aldığı veri tabanları, - Çin e yönelik B2B ve Ticaret Heyeti organizasyonu hizmetleri sunulmaktadır. Merkezin hizmetlerinden faydalanabilmek için https://www.eusmecentre.org.cn/user/register adresinden Merkez in web sitesine kayıt olunması gerekmektedir. AB Çin KOBİ Merkezi ve hizmetleri hakkında detaylı bilgi ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
8.06.2021
Hiper Otomasyon ve Robotik Süreç Otomasyonuna Giriş Eğitimi
Sayın Üyemiz, TOBB, TOBB ETÜ ve Global Al Hub iş birliğinde yürütülen Yapay Zeka Eğitim ve Farkındalık Projesi kapsamında "Hiper Otomasyon ve Robotik Süreç Otomasyonuna Giriş Eğitimi" gerçekleştirilecek olup 7 Haziran 2021 Pazartesi günü bu eğitime yönelik webinar gerçekleştirilecektir. Webinara katılım sağlayanların ücretsiz olarak devam edecekleri online eğitimde; gerçek dünya problemlerinden başlayarak RPA nın temelleri ve bunun RPA olmayan bir ortamda nasıl çözüldüğü, çözümü otomatikleştirmek için yazılım robotu oluşturma konuları anlatılacak olup eğitim sonrasında katılımcılara sertifika verilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7.06.2021
Şeker Piyasasına Denetim
Sayın Üyemiz, Şeker piyasasında faaliyette bulunan gerçek veya tüzel kişilerin izleme, inceleme ve denetimine ilişkin usul ve esasların belirlendiğiŞeker Piyasası İzleme ve Denetim Yönetmeliği(Karar Sayısı: 4079), şeker piyasasında faaliyette bulunan her türlü gerçek ve tüzel kişiler ile bunların izleme, inceleme ve denetlenmesine yönelik çalışmaları ve bu çalışmalar sonucunda yapılacak iş ve işlemleri kapsıyor. 4634 sayılı Şeker Kanununa dayanılarak hazırlanan Yönetmeliğe göre, Şirketler, Kanun kapsamındaki her şeker cinsi ve hammaddesi için ürün özellikleri, kampanya süresi, üretim, satış ve stok faaliyetlerine ait her türlü bilgiler ile ekim alanları ve sözleşme bilgilerini doğru olarak derlemek, kayıtlarını tutmak, muhafaza etmek ve mevzuat çerçevesinde talep edilen usul ve şekilde doğru ve tam olarak Bakanlığa bildirmekle yükümlü olacaklar. Şeker miktarında %3’ün üzerindeki sapmalar, para cezası ile cezalandırılacak Fabrikalarda ölçülen miktarlar ile satışa esas kayıtlar ve stok miktarları arasındaki %3’ün üzerindeki miktarda gerekçesiyle açıklanamayan şekerin, A kotası dışı satıldığı kabul edilerek, şirkete idari para cezası uygulanacak. Şirketler tarafından bildirilmeyen depo ve tesisler ile buralarda tespit edilen ürünler hakkında bildirilmeyen veya eksik ya da yanlış bildirilen miktar için de para cezası uygulanacak. Bakanlık şirketlere, pazarladıkları ürünlerin imalatçılar ve perakendeciye ulaşana kadar olan süreci izlemeye elverişli bir takip sistemi kurdurabilecek. İki yılda bir en az bir kez denetim yapılacak Denetimler, risk esasına göre planlanarak Bakanlık tarafından yürütülecek. Şirket ve bünyesindeki fabrikalar, iki yılda en az bir defa denetlenecek. Bakanlık ihtiyaç halinde izleme ve denetlemeye ilişkin olarak adli ve mülki makamlar ile diğer kurum ve kuruluşlardan talepte bulunabilecek. Yapılan denetimlerde, ilgili mevzuat hükümlerine aykırılık tespit edilmesi halinde, fiilin niteliğine göre Kanunda öngörülen yaptırımlar uygulanacak. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7.06.2021
Şeker Kotalarının Düzenlenmesi ve Uygulanmasına İlişkin Yönetmelik Yürürlüğe Konuldu
Sayın Üyemiz, Şeker Kotalarının Düzenlenmesi ve Uygulanmasına ilişkin yönetmelik Resmi Gazete de yayımlandı. Öte yandan 2002 yılında uygulamaya konulan, şeker kotalarının düzenlenmesine ilişkin yönetmelikte yürürlükten kaldırıldı. Ayrıntlar için tklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7.06.2021
Makarna ve Bulgur İhracatına Kısıtlama Getirildi
Sayın Üyemiz, Şehriye, kuskus, mantı, erişte ve hazır/anında noodle da dahil olmak üzere makarna, bulgur ve buğday irmiği ihracı kayda bağlı mallar listesine eklendi. İhracı kayda bağlı ürünler listesine makarna, bulgur ve buğday irmiği dahil edildi. Söz konusu ürünlerin ihracından önce gümrük beyannamelerinin İhracatçıBirlikleri Genel Sekreterliğince kayda alınması gerekiyor. Resmi Gazete de yayımlanarak yürürlüğe girenTicaret Bakanlığının İhracı Kayda Bağlı Mallara İlişkin Tebliğde Değişiklik Yapılmasına Dair Tebliğine göre;ihracı kayda bağlı mallar listesine, makarna (söz konusu GTİP in alt açılımlarında yer alan şehriye, kuskus, mantı, erişte ve hazır/anında noodle gibi tüm ürünler dahil), bulgur ve buğday irmiği (buğdayın kabaca öğütülmesinden elde edilen küçük parçalar ve buğday kaba unları) eklendi. İlgili tebliğ içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2.06.2021
Uzman Eller Projesi` Kapsamındaki Üreticilerin Projelerine 100 Bin Liralık Hibe Desteği
Sayın Üyemiz, Tarım ve Orman Bakanlığı, üniversitelerin tarım, hayvancılık, ormancılık, gıda ve su ürünleri bölümlerinden mezun olan "Uzman Eller Projesi" kapsamındaki üreticilerin projelerine 100 bin liraya kadar hibe desteği verecek. Kırsal Kalkınma Destekleri Kapsamında Kırsal Kalkınmada Uzman Ellerin Desteklenmesine İlişkin Cumhurbaşkanı Kararı, Resmi Gazete de yayımlanarak yürürlüğe girdi. Buna göre, 2022-2024 yıllarında kırsal alanda yaşayan/yaşamayı taahhüt eden ve meslek yüksekokulları ile üniversitelerin tarım, hayvancılık, ormancılık, gıda ve su ürünleri eğitimi veren bölümlerinden mezun olanların mahallinde uygulayacağı projeler hibe ödemesinden yararlanabilecek. Kararla, ilgili bölümlerden mezun genç nüfusun istihdamına katkı sağlamak, bu sektörlerde girişimciliği destekleyerek söz konusu faaliyetlerin uzman kişiler tarafından yapılmasını teşvik etmek, tarımsal üretimin miktarını, kalitesini ve verimliliğini artırmak ve sürdürülebilir yatırımları desteklemek amaçlanıyor. 100 bin liraya kadar hibe ödemesi Hayvansal ve bitkisel üretim, su ürünleri ve yöresel ürünler ile tıbbi aromatik bitki üretimine yönelik projeler ve bu ürünlerin işlenmesi, depolanması ve paketlenmesine yönelik projeler destekten yararlanabilecek. Uygulanacak projelere 100 bin liraya kadar hibe ödemesi yapılacak. Proje bütçesi katma değer vergisi hariç hazırlanacak. Hibe ödemesi yapılabilmesi için hibe sözleşmesi imzalanması ve proje yatırımının tamamlanması şartı aranacak. Karar kapsamında uygulanacak projelere yapılacak ödemeler için gerekli kaynak Kırsal Kalkınma Yatırımlarının Desteklenmesi Programı ndan karşılanacak ve Ziraat Bankası aracılığıyla ödenecek. Desteklemeden yararlanamayacaklar Üniversitelerin ilgili bölümlerinden mezun olmayan kişiler desteklerden yararlanamayacak. Hak sahipleri, verilen hibe desteklemesinden sadece bir kez faydalanabilecek. Aynı proje konusunda Tarım ve Orman Bakanlığının diğer hibe programlarından yararlanan kişiler de bu desteklemeden yararlanamayacak. Kara esasların uygulanmasına ilişkin usul ve esaslar Tarım ve Orman Bakanlığınca çıkarılacak tebliğle belirlenecek. Bakanlık, destek ödemeleriyle ilgili hususların denetimini sağlayacak tedbirleri almaya da yetkili olacak. İlgili Cumhurbaşkanı Kararı içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2.06.2021
KDV desteği 2 ay daha sürecek
Sayın Üyemiz, COVID-19 destekleri kapsamında geçen yıl başlatılan ve Aralık ayında süresi 31 Mayıs’a kadar uzatılan KDV indirimi, 2 ay daha uzatıldı. Resmi Gazete’de yayınlanan Hazine ve Maliye Bakanlığı Tebliğine göre, KDV indirimleri 1 Haziran’dan itibaren geçerli olmak üzere Temmuz sonuna kadar uzatıldı. İndirimli KDV’ye tabi sektörler şunlar: Yolcu taşımacılığı, yeme-içme hizmetleri, kültürel faaliyetler, sinema tiyatro, opera, operet, bale, müze giriş ücretleri, kongre, konferans, seminer, konser, fuar ve lunapark giriş ücretleri, düğün, nikah, balo ve kokteyl salonlarında verilen organizasyon hizmetleri, berberlik ve kuaförlük hizmetleri, kuru temizleme, çamaşırhane ve ütüleme hizmetleri, halı ve kilim yıkama hizmetleri ile küçük esnafın faaliyet alanıyla ilgili bir kısım bakım onarım faaliyetleri Öte yandan, işyeri kiralama hizmetlerinde KDV oranının yüzde 8 olması ve işyeri kiralamaları karşılığında ödemeler üzerinden yapılan tevkifat oranının da yüzde 20 yerine yüzde 10 olarak uygulanmasına devam edilecek. Temmuz ayında açılacak sinemalarda, biletler üzerinden alınan yüzde 10 oranındaki eğlence vergisi de Temmuz sonuna kadar yüzde 0 olacak. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2.06.2021
TMO Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO stoklarında bulunan ve ekli listede yer alan mısır, çeltik (Ek-1) ve pirinç aşağıdabelirtilen esaslar ve ekte (Ek-2) yer alan fiyatlarla 01 Haziran 2021 tarihinden itibaren peşin bedelmukabilinde satılacaktır. TMO Elektronik Satış Platformu (ESP) vasıtasıyla veya Şube müdürlüklerimizce satılacak stoklarEk-1 listede belirtilmiştir. ESP vasıtasıyla satılacak ürünlere ilişkin talep başvuruları şube müdürlüklerine elden değilwww.tmo.gov.tr adresindeki TMO ELEKTRONİK SATIŞ PLATFORMU sistemi üzerindenyapılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
1.06.2021
Türkiye de Tarım ve Kırsal Kalkınma Destekleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden Türkiye de Tarım ve Kırsal Kalkınma Destekleri Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Türkiye de Tarım ve Kırsal Kalkınma Destekleri Eğitimi" başlıklı eğitimde; IPARD programı kapsamında, TKDK tarafından Avrupa Birliği ve Türkiye Cumhuriyeti eş finansmanı ile 42 ilde yürütülen yatırım destekleri ile Tarım ve Orman İl Müdürlükleri tarafından yürütülen ulusal fonlar ile desteklenen yatırımlar, destek miktarları ve oranları, başvuru koşulları ve uygulama esasları hakkında bilgi verilecek, eğitim sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin % 70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
1.06.2021
Yapay Zeka: İş Dünyası Stratejileri ve Uygulamaları Bilgilendirme Webinarı
Sayın Üyemiz, TOBB ve TOBB ETÜ organizasyonuyla 24 Haziran 2021 Perşembe günü saat 14:00 te "Yapay Zeka: İş Dünyası Stratejileri ve Uygulamaları Bilgilendirme Webinarı" gerçekleştirilecektir. Söz konusu webinarda; yapay zekanın temelleri ve iş dünyası uygulamaları, makine öğrenmesi temelleri, yapay sinir ağları ve derin öğrenme temelleri, yapay zekaya entegrasyon yol haritası, beşeri sermayenin yapay zekaya adaptasyonu konuları anlatılacak olup seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. "Yapay Zeka: İş Dünyası Stratejileri ve Uygulamaları Bilgilendirme Webinarı" programı ve ayrıntılar ekte dikkatinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
1.06.2021
Anonim Şirketlerin Genel Kurul Toplantılarının Usul Ve Esasları İle Bu Toplantılarda Bulunacak Bakanlık Temsilcileri Hakkında Yönetmelikte Değişiklik Yapılmasına Dair Yönetmelik
Sayın Üyemiz, Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
1.06.2021
Haziran Ayı Normalleşme Tedbirleri Genelgesi
Sayın Üyemiz, İçişleri Bakanlığı nca "Haziran Ayı Normalleşme Tedbirleri Genelgesi" yayınlandı. Genelgede, Koronavirüs (Covid-19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme ve hastalığın yayılım hızını kontrol altında tutma amacıyla, salgınla mücadele sürecinin temelprensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulmasıgereken kurallar ve önlemler; salgının genel seyrinin ve Sağlık Bakanlığı ile Koronavirüs BilimKurulu nun önerilerinin değerlendirilmesi sonucunda Cumhurbaşkanlığı Kabinesinde alınan kararlardoğrultusunda belirlenmektedir. Bu çerçevede gerek 14 Nisan 2021 tarihinden bu yana sırasıyla uygulan kısmi kapanma, tamkapanma ve kademeli normalleşme tedbirleri ile birlikte sosyal izolasyonun artırılması; gerekse azizmilletimizin tedbirlere uyum noktasındaki sağduyulu ve fedakârca yaklaşımı sonucunda günlük vaka,hasta ve ağır hasta sayılarında ciddi bir düşüş yaşandığı kamuoyunun malumudur. Öte yandan hep birlikte elde edilen bu başarının sürdürülmesi, salgının yayılımının kontrol altındatutulması ve ivmelenen aşılama faaliyetleri ile birlikte kalıcı normalleşmenin sağlanması için salgınlamücadele tedbirlerine riayet etmek önümüzdeki dönemde de önemini korumaktadır. Bu doğrultuda salgının seyrinde yaşanan gelişmeler ile Sağlık Bakanlığı ve Koronavirüs BilimKurulu nun tavsiyeleri, Sayın Cumhurbaşkanımızın başkanlığında toplanan 31 Mayıs 2021 tarihliCumhurbaşkanlığı Kabinesinde ele alınarak; Haziran ayı boyunca uygulanacak olan kademelinormalleşme sürecinin ikinci etabı kapsamında aşağıdaki tedbirlerin1 Haziran 2021 Salı günü saat05.00’ten itibarenhayata geçirilmesi gerektiği değerlendirilmiştir. 1. SOKAĞA ÇIKMA KISITLAMASI Kademeli normalleşme döneminin ikinci etabında;Pazartesi, Salı, Çarşamba, Perşembe, Cuma veCumartesi günleri 22.00 - ­05.00 saatleri arasında;Pazar günleri ise Cumartesi günü saat 22.00’denbaşlayıp Pazar gününün tamamını kapsayacak ve Pazartesi günü saat 05.00’tetamamlanacak şekildesokağa çıkma kısıtlaması uygulanacaktır. 1.1- Sokağa çıkma kısıtlaması uygulanacak süre ve günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğinin sağlanması amacıylaEk’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacaktır. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler, 14.12.2020 tarih ve 20799 sayılıGenelgemizde açıkça belirtildiği şekilde muafiyet nedeni ve buna bağlı olarak zaman ve güzergâh ilesınırlı olup aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konuedilecektir. Sokağa çıkma kısıtlamasından muaf tutulan iş yeri/fabrika/imalathane gibi yerlerde çalışan kişileryapılan denetimlerde 29.04.2021 tarih ve 7705 sayılı Genelgemiz çerçevesinde e-Devlet platformunda yeralan İçişleri Bakanlığı e-Başvuru sistemi üzerinden alınan “çalışma izni görev belgesini” ibraz etmekzorundadırlar. Ancak NACE kodu eşleşme hatası, muafiyet kapsamındaki bir iş yerinde görev yapmasınarağmen alt işverenin muafiyet kapsamında olmaması nedeniyle görev belgesi alınamaması veya erişimhatası gibi durumlarda örneği bahse konu genelge ekinde yer alan ve işveren ile çalışanınbeyanı/taahhüdüyle manuel doldurularak imza altına alınan “çalışma izni görev belgesi formu” dadenetimlerde ibraz edilebilecektir. 1.2-Tam gün sokağa çıkma kısıtlaması uygulanacak Pazar günlerindebakkal, market, manav,kasap, kuruyemişçi ve tatlıcılar10.00-17.00saatleri arasında faaliyet gösterebilecek, vatandaşlarımızzorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engellivatandaşlarımız hariç) ikametlerine en yakın bakkal, market, manav, kasap, kuruyemişçi vetatlıcılara gidip gelebileceklerdir. 1.3- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde ekmek üretiminin yapıldığı fırın ve/veyaunlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri (sadece ekmek ve unlumamul satışı için)açık olacaktır. Vatandaşlarımız ekmek ve unlu mamul ihtiyaçlarının karşılanmasıile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine yürümemesafesinde olan fırına gidip gelebileceklerdir. Fırın ve unlu mamul ruhsatlı iş yerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallaraekmek servisi yapılabilecek, sokak aralarında kesinlikle satış yapılmayacaktır. 1.4- Yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamakta olup; ikamet izinliler,geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzereturistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar sokağa çıkma kısıtlamalarına tabidirler. 1.5- Kendi ihtiyaçlarını karşılayamayacak durumda olan ileri yaş gruplarındaki veya ağırhastalığı olan vatandaşlarımızın112, 155 ve 156 numaraları üzerinden bildirdikleri temel ihtiyaçları,VEFA Sosyal Destek Gruplarınca karşılanacak olup, bu konuda gerek personel görevlendirilmesigerekse ihtiyaçların bir an evvel giderilmesi bakımından gerekli tedbirler Valiler ve Kaymakamlar tarafından alınacaktır. 1.6- Aşı hakkını kullanarak iki doz aşı olmuş olan 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımızla ilgili olarak, herkes için uygulanan sokağa çıkma kısıtlamasının dışında ayrıcabir sokağa çıkma kısıtlaması uygulanmayacaktır. Aşı hakkı bulunmasına rağmen aşı olmayan 65 yaş ve üzeri vatandaşlarımız pazar günleridışındaki diğer günlerde sadece 10.00 - 14.00 saatleri arasında sokağa çıkabilecekler; pazar günleri ise tamgün sokağa çıkma kısıtlamasına tabi olacaklardır. 1.7- Sokağa çıkma kısıtlamasına tabi olup olmadığına bakılmaksızın 65 yaş ve üzeri vatandaşlarımızile 18 yaş altı gençler ve çocuklarımız şehir içi toplu ulaşım araçlarını (metro, metrobüs, otobüs,minibüs, dolmuş vb.) kullanamayacaklardır. Bu hükümden, Milli Eğitim Bakanlığı nın yüz yüze eğitim ve öğretim yapmasını uygun gördüğüöğrenciler istisna tutulacaktır. 2. ŞEHİRLER ARASI SEYAHAT KISITLAMASI Kademeli normalleşme döneminin ikinci etabında; sadece sokağa çıkma kısıtlaması uygulanansüre ve günlerde şehirler arası seyahat kısıtlaması uygulanacak olup sokağa çıkma kısıtlamasıuygulanmayan süre içerisinde şehirler arası seyahate ilişkin herhangi bir kısıtlamaya gidilmeyecektir. 2.1- Şehirler arası seyahat kısıtlamasının istisnaları; - Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın uçak, tren, otobüs gibitoplu taşıma vasıtalarıyla yapacakları şehirler arası seyahatler için ayrıca seyahat izni almasıistenmeyecek, şehirler arası seyahat edeceğini bilet, rezervasyon kodu vb. ile ibraz etmeleri yeterliolacaktır. Bu durumdaki kişilerin şehirler arası toplu taşıma vasıtaları ile ikametleri arasındaki hareketlilikleri, kalkış-varış saatleriyle uyumlu olmak kalmak kaydıyla sokağa çıkma kısıtlamasından muaf olacaktır. - Zorunlu bir kamusal görevin ifası kapsamında ilgili Bakanlık ya da kamu kurum veyakuruluşu tarafından görevlendirilmiş olan kamu görevlilerinin (müfettiş, denetmen vb.) özel veyaresmi araçlarla yapacakları şehirler arası seyahatlerine, kurum kimlik kartı ve görevlendirme belgesini ibraz etmeleri kaydıyla izin verilecektir. - Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmakiçin veya cenaze nakil işlemine refakat etmek amacıyla herhangi bir cenaze yakınının e-devletkapısındaki İçişleri Bakanlığına aite-BaşvuruveyaALO 199sistemleri üzerinden yapacaklarıbaşvurular (yanında akraba konumundaki 9 kişiye kadar bildirimde bulunabilecektir) sistem tarafındanvakit kaybetmeksizin otomatik olarak onaylanarak cenaze yakınlarına özel araçlarıyla seyahatedebilmeleri için gerekli seyahat izin belgesi oluşturulacaktır. Cenaze nakil ve defin işlemleri kapsamında başvuru yapacak vatandaşlarımızdan herhangi bir belgeibrazı istenilmeyecek olup Sağlık Bakanlığı ile sağlanan entegrasyon üzerinden gerekli sorgulama seyahatizin belgesi düzenlenmeden önce otomatik olarak yapılacaktır. 2.2- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın özel araçlarıylaşehirler arası seyahate çıkmamaları esastır. Ancak aşağıda belirtilen zorunlu hallerin varlığı durumunda vatandaşlarımız, bu durumubelgelendirmek; e-devlet üzerinden İçişleri Bakanlığına aite-Başvuruve ALO 199sistemleriüzerinden Valilik/Kaymakamlık bünyesinde oluşturulan Seyahat İzin Kurullarından izin almak kaydıylaözel araçlarıyla da seyahat edebileceklerdir. Seyahat İzin Belgesi verilen kişiler, seyahat süreleri boyuncasokağa çıkma kısıtlamasından muaf olacaktır. Zorunlu Hal Sayılacak Durumlar; Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevkolan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, Kendisi veya eşinin, hastanede tedavi gören birinci derece yakınına ya da kardeşine refakatedecek olan (en fazla 2 kişi), Bulunduğu şehre son5 güniçerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikametettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araçplakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ÖSYM tarafından ilan edilen sınavlar ile merkezi düzeyde planlanan sınavlara katılacakolanlar, Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, Özel veya kamudan günlü sözleşmeye davet yazısı olan, Ceza infaz kurumlarından salıverilen, kişilerin zorunlu hali bulunduğu kabul edilecektir. 3. İŞ YERLERİNİN FAALİYETLERİ 3.1- Yeme-içme yerleri (restoran, lokanta, kafeterya, pastane gibi); Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirtilen tüm kurallara uyulması,masalar arasında her yönden2 metre, yan yana sandalyeler arasında60 cmmesafe bırakılması, Aynı anda aynı masadaaçık alanlarında üç, kapalı alanlarında ise ikiden fazlamüşterikabul edilmemesi, kaydıyla, Pazartesi, Salı, Çarşamba, Perşembe, Cuma ve Cumartesi günlerinde 07.00-21.00saatleriarasında masada servis, gel-al ve paket servis,21.00 - 24.00saatleri arasında ise sadece paket servis, Pazar günleri ise 07.00 - 24.00saatleri arasında sadece paket servis,şeklinde faaliyet gösterebileceklerdir. 3.2- 14 Nisan 2021 tarihinden bu yana faaliyetlerine ara verilmiş durumda olan; Sinema salonları, Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi gibi yerler, İnternet kafe/salonu, elektronik oyun yerleri, bilardo salonları, Halı sahalar, spor salonları, açık yüzme havuzları, Lunaparklar ve tematik parkları, Faaliyet alanında bulunan iş yerleri; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde her bir iş kolu/faaliyet alanı için ayrıayrı belirlenen kurallara eksiksiz uyulması, Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi, çay ocağı gibi yerlerde herhangi birşekilde oyun (kağıt-okey, tavla dahil) oynanmaması, aynı anda aynı masada açık alanlarında üç, kapalı alanlarında ise ikiden fazla müşteri kabul edilmemesi, Sinema salonlarında% 50 kapasite (bir koltuk dolu bir koltuk boş)sınırına uyulması, kaydıyla 1 Haziran 2021 tarihinden itibaren (Pazar günleri hariç) 07.00 - 21.00 saatleri arasında faaliyet gösterebileceklerdir. Öte yandan kapalı yüzme havuzları, hamamlar, saunalar ve masaj salonları, nargilesalonu/kafeleri ile gazino, taverna, birahane gibi iş yerlerinin faaliyetlerine yeni bir karar alınıncayakadar ara verilmesine devam edilecektir. 3.3- Yukarıda sayılan iş yerleri dışında kalan perakende ve hizmet sektöründeki giyim, tuhafiye,züccaciye, hırdavat, terzi, berber gibi dükkanlar, büro ve ofisler vb. iş yerleri ile AVM’ler; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde içerisinde bulunduğu iş kolu içinbelirlenen tüm salgınla mücadele tedbirlerine riayet etmek kaydıyla (Pazar günleri hariç) 07.00 - 21.00saatleri arasında faaliyet gösterebileceklerdir. 3.4- Zincir marketler başta olmak üzere çeşitli iş yerleri tarafından açılış veya belirli gün ya dasaatlere özgü genel indirim uygulamalarının oluşturduğu yoğunluğun önüne geçilebilmesi için indirimuygulamalarının en az bir hafta sürecek şekilde uzun periyodlarla yapılması gerekmektedir. 3.5- Tam gün sokağa çıkma kısıtlaması uygulanacak olan Pazar günlerinde; marketlerde (zincirve süper marketler dahil) zorunlu temel ihtiyaçlar kapsamındaki ürünler dışında elektronik eşya, oyuncak,kırtasiye, giyim ve aksesuar, alkol, ev tekstili, oto aksesuar, bahçe malzemeleri, hırdavat, züccaciye vb.ürünlerin satışına izin verilmeyecektir. 3.6- Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirlenen kurallara uymakkaydıyla pazar yerleri (Pazar günleri hariç) 07.00 - 20.00 saatleri arasında faaliyet gösterebileceklerdir. 3.7- Online market ve yemek sipariş firmaları, hafta içi ve hafta sonu 07.00 - 24.00 saatleriarasında evlere/adrese servis şeklinde çalışabileceklerdir. 4. EĞİTİM - ÖĞRETİM FAALİYETLERİ Halihazırda faaliyetlerine devam etmekte olan kreşler ve anaokulları kademeli normalleşmeninikinci etabında da faaliyetlerine devam edecek olup diğer tüm okul ve sınıf seviyeleri için Milli EğitimBakanlığı nca kamuoyuna duyurulduğu şekilde uygulama sürdürülecektir. 5. KAMU KURUM VE KURULUŞLARINDA MESAİ Cumhurbaşkanlığının 14.04.2021 tarih ve 2021/8 sayılı Genelgesi ile Cumhurbaşkanlığı İdari İşlerBaşkanlığının 27.04.2021 tarih ve 17665 sayılı yazısı doğrultusunda, kamu kurum ve kuruluşlarındauygulanmakta olan10.00 - 16.00saatleri arası mesai sistemi ile uzaktan/dönüşümlü gibi esnek çalışma usulünün uygulanmasına kademeli normalleşme döneminin ikinci etabında da devam edilecektir. 6. TOPLANTI / ETKİNLİKLER İLE NİKAHLAR / DÜĞÜNLER VE ZİYARETLER 6.1- Dönemsel açıdan zorunluluk taşıyan spor kulüplerinin genel kurulları hariç olmak üzere siviltoplum kuruluşları, sendikalar, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üstkuruluşları ile birlikler ve kooperatiflerin genel kurul dahil yapacakları geniş katılımlı her türlüetkinlikleri15 Haziran 2021tarihine kadar ertelenecektir. Dönemsel açıdan yapılması zorunlu olan spor kulüplerinin genel kurulları ise; fiziki mesafe iletemizlik/maske/mesafe kurallarına uyulması ve açık alanlarda kişi başı asgari4 m², kapalı alanlarda kişi başı asgari6m²alan bırakılması kaydıyla yapılabilecektir. 15 Haziran 2021 Salı gününden itibaren ise sivil toplum kuruluşları, sendikalar, kamu kurumuniteliğindeki meslek kuruluşları, birlikler ve kooperatiflerce yapılacak genel kurul dahil geniş katılımlıetkinliklere; fiziki mesafe ile maske/mesafe/temizlik kurallarına uyulması ve açık alanlarda kişi başıasgari 4 m², kapalı alanlarda kişi başı asgari 6 m²alan bırakılması kaydıyla izin verilecektir. 6.2- Nikah törenleri ile nikah merasimi şeklindeki düğünler; - Açık alanlarda; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde nikah törenleri ve düğünlerleilgili belirlenen tüm kurallara eksiksiz riayet edilmesi, Masa ve sandalyeler arasında gerekli mesafenin bırakılması ile temizlik, maske, mesafekurallarına uyulması, Yiyecek-içecek ikramının yapılmaması, Kapalı alanlarda ise yukarıdaki kurallara ilave olarak; Kişi başı asgari 6 m²alan bırakılması, Azami 100 davetli ile sınırlandırılması, kaydıyla 1 Haziran 2021 Salı gününden itibaren yapılabilecektir. Yiyecek-içecek ikramına ve kapalı alanlarda azami davetli sayısına ilişkin kısıtlamalara 15Haziran 2021 Salı günü son verilecektir. Bu tarihten sonraki nikah törenleri ve düğünlerde yiyecek-içecek ikramı yapılabilecek olup kapalı alanlarda kişi başına en az 6 m²alan bırakılması kaydıyla azamikatılımcı sınırı uygulanmayacaktır. Nişan ve kına gibi etkinliklere 1 Temmuz 2021 tarihinden sonra izin verilecektir. 6.3- Huzurevi, yaşlı bakımevi, rehabilitasyon merkezi, çocuk evleri gibi sosyal koruma/bakımmerkezlerinde kalanlara yönelik ziyaretlere bu yerlerde kalan her kişi için haftada en fazla bir ziyaretolacak şekilde izin verilecektir. 7. TOPLU ULAŞIM TEDBİRLERİ 7.1- Şehirler arası faaliyet gösteren toplu taşıma araçları (uçak hariç); araç ruhsatında belirtilenyolcu taşıma kapasitesinin%50’sioranında yolcu kabul edebilecekler ve araç içindeki yolcularınoturma şekli yolcuların birbirleriyle temasını engelleyecek(1 dolu 1 boş) şekilde olacaktır. Otobüs, tren vb. şehirler arası toplu taşıma araçlarında kapasite sınırlamasının tespiti sırasında aynıadreste ikamet eden ve aynı çekirdek aileden (eş, anne-baba, kardeş) olan kişiler, hesaplamaya dahiledilmeyecek ve yan yana seyahat etmelerine izin verilecektir. Ayrıca 2+1 koltuk düzenindeki şehirler arası toplu taşıma yapan otobüslerde her iki camkenarındaki koltuklara yolcu kabul edilebilecek olup (ortadaki koltuklar boş bırakılacaktır), yolcu taşımakapasitesi buna göre belirlenecektir. 7.2- Şehir içi toplu ulaşım araçları (minibüs, midibüs vb.) ise 14.04.2021 tarih ve 6638 sayılıGenelgemizle getirilen esaslar çerçevesinde % 50 kapasite sınırlamasına ile ayakta yolcu kabuledilmemesi kuralına tabi olarak faaliyet sunabileceklerdir. 8. KONAKLAMA TESİSLERİNE DAİR TEDBİRLER 8.1- Şehirler arası karayolları üzerinde bulunan dinlenme tesisleri (yerleşim sahası içerisindebulunanlar hariç) ile konaklama tesislerinin (otel, motel, apart otel, pansiyon vb.) içerisinde bulunanyeme-içme yerleri (sadece konaklamalı müşterilerle sınırlı olacak şekilde); aynı masada aynı anda açıkalanlarında üç, kapalı alanlarında ise ikiden fazla müşteri kabul edilmemek kaydıyla hizmetverebileceklerdir. 8.2- Konaklama tesislerinin kapalı alanlarında bulunan eğlence merkezleri kapalı tutulacak ve bualanlarda müşteri kabul edilmeyecektir. 8.3- Konaklama tesislerinin açık alanlarında toplu eğlence şeklinde etkinliklere kesinlikle izinverilmeyecek, bu yerlerde yoğunlaşmanın önüne geçilebilmek adına fiziksel mesafe kurallarına azamiözen gösterilecektir. 8.4- Sokağa çıkma kısıtlaması uygulanacak olan süre ve günlerde konaklama tesislerinderezervasyonunun bulunması (bedelinin tamamı ödenmiş olmak kaydıyla) vatandaşlarımız açısındansokağa çıkma ve/veya şehirler arası seyahat kısıtlamasından muafiyet sağlayacak olup bu amaçlaseyahat edecek vatandaşlarımızın denetimlerde rezervasyon ve ödeme belgelerini ibraz etmeleri yeterliolacaktır. 8.5- 30.09.2020 tarih ve 16007 sayılı ile 28.11.2020 tarih ve 19986 sayılı Genelgelerimizdoğrultusunda konaklama tesislerinin denetimleri etkin şekilde sürdürülecek, sahte rezervasyon baştaolmak üzere her türlü kötüye kullanımın önüne geçilecektir. 9. GENEL ESASLAR 9.1- Valilik ve Kaymakamlıklarca; Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde herbir iş kolu/faaliyet alanına ilişkin ayrı ayrı olarak belirlenmiş olan koronavirüs salgınıyla mücadele amaçlıtedbir, usul ve esasların ilgili iş yeri yetkilileri ve çalışanlarına hatırlatılmasına dair bilgilendirmefaaliyetlerine ağırlık verilecektir. 9.2- Gerek Bakanlığımız Genelgeleri gerekse Sağlık Bakanlığı Salgın Yönetimi ve ÇalışmaRehberinde belirlenen tedbir, usul ve esaslar çerçevesinde, Vali ve Kaymakamlarımızın koordinesindekolluk kuvvetlerinin azami düzeyde kapasite ile katılım gösterdiği (diğer kurum ve kuruluşlarınpersoneli/görevlileri ile takviye edilmiş şekilde) yoğunlaştırılmış denetimler gerçekleştirilecektir. 9.3- Yürütülecek her türlü denetim faaliyetinde iş yeri sahipleri/çalışanları ile vatandaşlarımızıkurallara uymaya/sorumlu davranmaya nezaketle davet eden rehberlik edici bir yaklaşım sergilenecekolup, kurallara aykırılıklarda ısrar, tekerrür, kuralların esaslı ihlali gibi suistimal edici tutum vedavranışlarla karşılaşılması halinde ise gerekli idari/adli işlem tesisinden imtina edilmeyecektir.
1.06.2021
Mezbuh Taze Soğutulmuş Karkas Alımı Piyasa Araştırması
Sayın Üyemiz, Et ve Süt Kurumu tarafından piyasa şartların ve fiyatlarının değerlendirilmesi amacıyla, onaylıkesimhanelerde kesilmiş, 0-4 C soğutulmuş, yağsız kesim 1. Kalite Dana Karkas o ( 1-4 yaş (dahil)arasındaki erkek sığırlardan elde edilen karkas) ve 3. Kalite Dişi Karkas (reforme olan ve/veya gebeolmayan dişi sığırlar ile 3 yaşını aşmış, reforme olan ve/veya gebe olmayan düvelerden elde edilenkarkas) alımına esas teşkil edecek şekilde piyasa araştırması yapılmaktadır. Ekteki tabloda esvafı belirtilmiş olan dişi ve dana karkaslar için alıcı rampa teslim piyasafiyatlarınızı mgultekin.gulhan@esk.gov.tr mail adresine veya 0 (312) 270 42 14 numarasına fax olarakEk te sunulan birim fiyat cetveline bedel, rakam, yazı biribirine uygun olacak şekilde açıkca yazılarak, üzerinde kazıntı, silinti ve düzeltme yapılmadan, kaşe ve imzalı bir şekilde 31.05.2021 Pazartesi günüsaat 17.00 a kadar gönderilmesi hususunda; Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
28.05.2021
2021 Nefes Kredisi
Sayın Üyemiz, T.C. Hazine ve Maliye Bakanlığınca yapılan basın açıklaması bilgilerinize sunulur. Koronavirüs salgınının ekonomik etkilerinin sınırlanmasına katkı sunmak ve KOBİ’lere uygun koşullarda finansman desteği sağlamak amacıyla “2021 Nefes Kredisi”, 10 bankanın katılımı ile TOBB ve KGF işbirliğinde 1 Haziran 2021 itibarı ile uygulamaya alınacaktır. Nefes Kredi Paketi ile yıllık cirosu 10 milyon TL altında olan ve 2020 yılı cirosunda 2019 yılına göre yüzde 25 kayıp yaşayan; Ticaret, Deniz Ticaret, Sanayi, Ticaret ve Sanayi veya Ticaret Borsası’na kayıtlı üyelere işletme sermayesi finansman imkânı sağlanacaktır. 2020 yılı cirosu 1 milyon TL’yi aşmayan KOBİ’ler azami 50 bin TL, cirosu 1-10 milyon TL arasında olan KOBİ’ler ise azami 200 bin TL kredi kullanabilecektir. TOBB ve Oda / Borsalar da kaynaklarını bu bankalarda değerlendirerek projeye katkı sunacaktır. 6 ay ödemesiz dönem imkânı sağlanıyor İşletmelere 6 ay ödemesiz dönem imkânı sağlanacak olan 2021 Nefes Kredisi uygulamasında, kredi geri ödemeleri 12 eşit taksitte yapılacaktır. Söz konusu uygulamada Hazine destekli KGF kefaleti sağlanacak olup, faiz oranı yıllık yüzde 17,5 olarak belirlenmiştir. Kamuoyuna saygıyla duyurulur. Katılımcı Bankalar T.C. ZİRAAT BANKASI A.Ş. TÜRKİYE VAKIFLAR BANKASI T.A.O. TÜRKİYE HALK BANKASI A.Ş. TÜRKİYE İŞ BANKASI A.Ş. T.GARANTİ BANKASI A.Ş. YAPI VE KREDİ BANKASI A.Ş. AKBANK T.A.Ş. DENİZBANK A.Ş. ZİRAAT KATILIM BANKASI A.Ş. VAKIF KATILIM BANKASI A.Ş.
26.05.2021
Ticaret Müşavirlerimizle Elektronik Sohbetler-Rusya Federasyonu
Sayın Üyemiz, 27 Mayıs Perşembe günü 15:00-17:00 saatleri arasında Rusya Federasyonu nda görev yapmakta olan Ticaret Müşavirlerimiz ile bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşacağı bir e-sohbet toplantısı gerçekleştirileceği bildirilmektedir. Söz konusu etkinliğin programı ve kayıt linki ekte yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
26.05.2021
KAMU İHALE SÖZLEŞMELERİNDE GÜNCEL SORUNLAR, ÇÖZÜM ÖNERİLERİ VE ELEKTRONİK DÖNÜŞÜM SEMPOZYUMU
Sayın Üyemiz, Kamu İhale Kurumu, TOBB ve TOBB ETÜ iş birliğinde27-28 Mayıs 2021tarihlerinde"Kamu İhale Sözleşmelerinde Güncel Sorunlar, Çözüm Önerileri ve Elektronik Dönüşüm"konulu sempozyumu internet üzerinden düzenlenecektir. Sempozyum davetine ilişkin afiş ekte yer almaktadır. Sempozyumda ekli program kapsamındaKamu İhale Sözleşmelerinde Borçlar Hukuku, Şirketler Hukuku ve İdare Hukukuna İlişkin Sorunlar ve Çözüm Önerileri ile Kamu İhalelerinde Elektronik Dönüşümkonuları anlatılacaktır. Saygılarımızla Gültekin GÜLER Genel Sekreter
25.05.2021
Avrupa Mükemmeliyet Destinasyonu Yarışması
Sayın Üyemiz, Avrupa Birliği İşletmelerin ve KOBİ lerin Rekabet Edebilirliği Programının (COSME) ulusal koordinasyonundan sorumlu kurum olarak yetkilendirilmiş olan KOSGEB tarafından; COSME Programının bileşenlerinden biri olan "Çerçeve Koşulların İyileştirilmesi" bileşeni altında turizme yönelik faaliyetlere yönelik olarak Avrupa Mükemmeliyet Destinasyonu Yarışması düzenlenmektedir. Bu kapsamda, Avrupa Komisyonu tarafından düzenlenen, Avrupa Mükemmeliyet Destinasyonu Yarışmasına, nüfusu 25.000-100.000 arasında bulunan destinasyonlar için, destinasyonu yasal olarak temsil etme yetkisine sahip temsilciler tarafından başvuru yapılabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Endonezya Yatırım Forumu
Sayın Üyemiz, Endonezya Yatırım Forumu nun çevrimiçi olarak düzenleneceği belirtilmekte olup, anılan Forum kapsamında birinci gün Endonezya ekonomi ve yatırım ortamı hakkında konuşmacılar tarafından bilgilendirme yapılacağı, ikinci gün ise yatırım projeleri üzerine ikili görüşmelerinin gerçekleştirileceği belirtilmektedir. Bu kapsamda, söz konusu etkinlik hakkında detaylı bilgilere https://investinindonesia.uk/iif-2021/ internet sayfasından ulaşılabilmekte olup, konu ile ilgili Endonezya Ankara Büyükelçiliği ile (Mr. Faisal Rachman, Birinci Sekreter, E-posta: faisal.rachman@kemlu.go.id) temas kurulması ayrıca mümkündür. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Ticaret Müşavirlerimizle Elektronik Sohbetler- Venezuela
Sayın Üyemiz, 25 Mayıs 2021 Salı günü 16.00-17.30 saatleri arasında Venezuela da görev yapmakta olan Ticaret Müşavirimiz ve bu ülkede iş yapmakta olan iş insanlarımızın konuşmacı olarak katılarak tecrübelerini paylaşılacağı e-sohbet toplantısının gerçekleştirileceği bildirilmiştir. Toplantı programı ve linki ekte sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Yeşil Lojistik ve Yeşil Tedarik Zinciri Semineri
Sayın Üyemiz, Yeşil lojistik ve yeşil tedarik zinciri hakkında işletmeleri bilgilendirmek amacıyla 25 Mayıs 2021 Salı günü saat 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. Birliğimiz organizasyonunda gerçekleştirilecek olan seminerde; AB Yeşil Mutabakatı kapsamında gelişmelerin ticarete etkileri, yeşil tedarik zinciri yönetimi, yeşil satınalma ve yeşil lojistik uygulamalarının faydaları ile etik perspektifinden yeşil tedarik kavramı anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Devlet Destek ve Teşvikleri Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden Devlet Destek ve Teşvikleri Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Devlet Destek ve Teşvikleri Eğitimi" başlıklı eğitime; Devletin verdiği destek ve teşviklerden istifade ederek pazarda var olmak, büyümek, işini geliştirmek isteyen vizyon sahibi girişimciler, yatırımcılar, sanayiciler, hizmet işletmesi sahip ve yöneticileri ile potansiyel yararlanıcılar katılabilecek olup, eğitimde tüm devlet kurumlarınca sağlanan destek ve teşvikler topluca sunularak bunlardan yararlanma yolları anlatılacaktır. Eğitim sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin % 70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Sri Lanka Yatırım Forumu
Sayın Üyemiz, Sri Lanka nın Ankara Büyükelçiliğinden alınan yazıda, Sri Lanka Ticaret Odası nın (CCC), Sri Lanka Yatırım Kurulu (BOI) ve Colombo Borsası (CSE) işbirliğinde 7-9 Haziran 2021 tarihleri arasında sanal "Sri Lanka Yatırım Forumu" organizasyonu için çalışmalarının devam ettiği belirtilmektedir. Sri Lanka Yatırım Forumu nun temasının "Sri Lanka- Asya nın bir sonraki büyüme cenneti" olacağı ve üç günlük etkinlikte üst düzey hükümet liderleri, kamu ve özel şirketlerin üst düzey liderleri, küresel uzmanlar, yatırım bankacıları ve danışmanlık firmaları tarafından gerçekleştirilecek oturumların ve sunumların yer alacağı ifade edilmektedir. Etkinlik kaydı ve katılım ücretsizdir. Sri Lanka Sanal Yatırım Forumu nun, iş ortakları da dahil olmak üzere potansiyel yatırımları Sri Lanka ya çekmek üzere yatırım kararları için gerekli ve kapsamlı bilgileri sağlamanın yanı sıra Sri Lanka ile yabancı iş adamları arasında iş bağlantıları kurmaya odaklanacağı belirtilmektedir. Söz konusu etkinliğe ücretsiz kayıt ve diğer detayları linkinden https://invest-srilanka.lk ulaşılabilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Kuveyt te Atık Lastik Dönüşümü Alanındaki Yatırım Fırsatı Hk.
Sayın Üyemiz, Kuveyt Ticaret Müşavirliğimizden alınan bir yazıya atfen, ülkedeki atık lastik sayısının fazla olduğu ve bu durumunun lastik geri dönüşüm sektöründe faaliyet gösteren ve yurt dışında tesis kurmak isteyen firmalarımız tarafından fırsat olarak değerlendirilebileceği ifade edilmektedir. Ticaret Müşavirliğimizce konuya ilişkin hazırlanan bilgi notu ekte gönderilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Staj Seferbirliği Programı
Sayın Üyemiz, Cumhurbaşkanlığı İnsan Kaynakları Ofisi Başkanlığı koordinasyonunda, kamu kurumları ve özel sektörden gönüllü işverenlerin iş birliğiyle, üniversite öğrencilerine yönelik hazırlanan 2021 Staj Seferbirliği Programı değerleme süreci tamamlanmıştır. Program kapsamında oluşturulan 136 bin öğrencinin yer aldığı yurt içi stajyer havuzu, 27.04.2021 tarihinde saat 13.00 itibari ile işverenlerin erişimine https://kariyerkapisi.cbiko.gov.tr/ adresi üzerinden açılmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
25.05.2021
Kanada Montreal Limanında Grevin Sona Ermesi
Sayın Üyemiz, Ticaret Bakanlığı nın Birliğimize ilettiği ilgi (b) de kayıtlı yazısı ile, Ottava Ticaret Müşavirliğinden alınan bir yazıya atfen, Montreal Liman İdaresi tarafından 1 Mayıs 2021 tarihinde yapılan açıklamaya göre; Bill C29 adlı Kanunun Kanada Parlamentosu Avam Kamarasından (House of Commons) geçerek 30 Nisan 2021 tarihinde onaylanmasının akabinde Montreal Limanının 2 Mayıs 2021 Pazar günü faaliyetlerine başladığı belirtilmiş olup Montreal Limanı üzerinden Kanada ile ticaret yapan firmalarımızın Limandaki iş ve işlemlerine yönelik planlamalarında bahse konu gelişmeleri dikkate almasında fayda olduğunun düşünüldüğü ifade edilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
18.05.2021
2021 HUBUBAT VE BAKLİYAT ALIM DETAYLARI BELİRLENDİ
Sayın Üyemiz, TMO hububat ve bakliyat alım fiyat ve politikaları belirlenmiş olup Sayın Cumhurbaşkanımız tarafından17.05.2021tarihinde alım fiyatları açıklanmıştır. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
18.05.2021
TEKNOFEST 2021
Sayın Üyemiz, Sanayi ve Teknoloji Bakanlığı tarafından iletilen yazı ile 21-26 Eylül 2021 tarihleri arasında gerçekleştirilecek Teknofest ile ilgili bilgi verilmektedir. Ayrıntılar Ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
18.05.2021
She Trades Global Etkinliği
Sayın Üyemiz, Kadın girişimci, ihracatçı, yatırımcı ve diğer paydaşları bir araya getiren "She Trades Global" etkinliğinin 17-19 Ekim 2021 tarihlerinde Dubai de düzenleneceği ve etkinliğe sanal ortamda da katılım sağlanmasının mümkün olduğu belirtilmektedir. Söz konusu etkinliğe ilişkin broşürün bir örneği ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
18.05.2021
Kademeli Normalleşme Tedbirleri Genelgesi
Sayın Üyemiz, İçişleri Bakanlığı nca "Kademeli Normalleşme Tedbirleri Genelgesi" yayınlandı. Genelgede, Koronavirüs (Covid-19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme ve hastalığın yayılım hızını kontrol altında tutma amacıyla, salgınla mücadele sürecinin temel prensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemler; salgının genel seyrinin ve Sağlık Bakanlığı ile Koronavirüs Bilim Kurulunun önerilerinin değerlendirilmesi sonucunda alınan kararlar doğrultusunda belirlenmektedir. Bu kapsamda salgının seyrinde yaşanan artışa bağlı olarak 14 Nisan 2021 tarihinden itibaren kısmi kapanma, 29 Nisan 2021 tarihinden itibaren tam kapanma tedbirleri hayata geçirilmiştir. Gerek kısmı kapanma ve tam kapanma döneminde alınan tedbirlerle sosyal izolasyonun artırılması gerekse aziz milletimizin tedbirlere uyum noktasındaki sağduyulu ve fedakarca yaklaşımı sonucunda günlük vaka, hasta ve ağır hasta sayılarında ciddi bir düşüş yaşandığı kamuoyunun malumudur. Öte yandan hep birlikte elde edilen bu başarının sürdürülmesi, salgının yayılımının kontrol altında tutulması ve yeniden ivmelenen aşılama faaliyetleri ile birlikte kalıcı normalleşmenin sağlanması için salgınla mücadele tedbirlerine riayet etmek önümüzdeki kademeli normalleşme sürecinde de son derece önem taşımaktadır. Bu doğrultuda Sağlık Bakanlığı Koronavirüs Bilim Kurulunun tavsiyeleri ve salgının seyrinde yaşanan gelişmeler göz önüne alındığında 17 Mayıs 2021 Pazartesi günü saat 05.00’ten 1 Haziran 2021 Salı günü saat 05.00’e kadar uygulanacak olan kademeli normalleşme döneminde aşağıdaki tedbirlerin hayata geçirilmesi gerektiği değerlendirilmiştir. 1. Sokağa Çıkma Kısıtlaması Kademeli normalleşme döneminde;hafta içerisinde yer alan günlerde (Pazartesi, Salı, Çarşamba, Perşembe ve Cuma) 21.00­-5.00 saatleri arasında, hafta sonları ise Cuma günleri saat 21.00’den başlayıp, Cumartesi ve Pazar günlerinin tamamını kapsayacak ve Pazartesi günleri saat 05.00’de tamamlanacakşekilde sokağa çıkma kısıtlaması uygulanacaktır. 1.1- Sokağa çıkma kısıtlaması uygulanacak süre ve günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamak amacıyla Ek’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacaktır. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler, 14.12.2020 tarih ve 20799 sayılı Genelgemizde açıkça belirtildiği şekilde muafiyet nedeni ve buna bağlı olarak zaman ve güzergâh ile sınırlı olup, aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konu edilecektir. Sokağa çıkma kısıtlamasından muaf tutulan işyeri/fabrika/imalathane gibi yerlerde çalışan kişiler yapılan denetimlerde 29.04.2021 tarih ve 7705 sayılı yazımız çerçevesinde e-Devlet platformunda yer alan İçişleri Bakanlığı e-Başvuru sistemi üzerinden alınançalışma izni görev belgesiniibraz etmek zorundadırlar. Ancak Nace kodu eşleşme hatası, muafiyet kapsamındaki bir iş yerinde görev yapmasına rağmen alt işverenin muafiyet kapsamında olmaması nedeniyle görev belgesi alınamaması veya erişim hatası gibi durumlarda örneği bahse konu yazı ekinde yer alan ve işveren ile çalışanın beyanı/taahhüdüyle manuel doldurularak imza altına alınançalışma izni görev belgesi formuda denetimlerde ibraz edilebilecektir. 1.2- Tam gün sokağa çıkma kısıtlaması uygulanacakCumartesi-Pazar günlerinde bakkal, market, manav, kasap, kuruyemişçi ve tatlıcılar 10.00-17.00 saatleri arasında faaliyet gösterebilecek, vatandaşlarımız zorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın bakkal, market, manav, kasap, kuruyemişçi ve tatlıcılara gidip gelebilecektir. 1.3- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri (sadece ekmek ve unlu mamul satışı için) açık olacaktır. Vatandaşlarımız ekmek ve unlu mamul ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine yürüme mesafesinde olan fırına gidip gelebileceklerdir. Fırın ve unlu mamul ruhsatlı iş yerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallara ekmek servisi yapılabilecek, sokak aralarında kesinlikle satış yapılmayacaktır. 1.4- Yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamakta olup; ikamet izinliler, geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzere turistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar sokağa çıkma kısıtlamalarına tabidirler. 1.5- Tam kapanma sürecinde kendi ihtiyaçlarını karşılayamayacak durumdaki ileri yaş gruplarındaki veya ağır hastalığı olan vatandaşlarımızın 112, 155 ve 156 numaraları üzerinden bildirdikleri temel ihtiyaçları VEFA Sosyal Destek Gruplarınca karşılanacak olup, bu konuda gerek personel görevlendirilmesi gerekse ihtiyaçların bir an evvel giderilmesi bakımından gerekli tedbirler Valiler ve Kaymakamlar tarafından alınacaktır. 1.6- Aşı hakkını kullanarak iki doz aşı olmuş olan 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımız için herkes için uygulanan sokağa çıkma kısıtlamasının dışında ayrıca bir sokağa çıkma kısıtlaması uygulanmayacaktır. Aşı hakkı bulunmasına rağmen aşı olmayan 65 yaş ve üzeri vatandaşlarımız ise hafta içi günlerde sadece 10.00-14.00 saatleri arasında sokağa çıkabilecekler olup, hafta sonları tam gün sokağa çıkma kısıtlamasına tabi olacaklardır. Sokağa çıkma kısıtlamasına tabi olup olmadığına bakılmaksızın 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımız kademeli normalleşme döneminde şehir içi toplu ulaşım araçlarını (metro, metrobüs, otobüs, minibüs, dolmuş vb.) kullanamayacaklardır. 2. Şehirler Arası Seyehat Kısıtlaması Kademeli normalleşme döneminde; sokağa çıkma kısıtlaması uygulanan süre ve günlerde (hafta içi ve hafta sonunda) şehirler arası seyahat kısıtlaması uygulanacaktır. 2.1- Şehirler arası seyahat kısıtlamasının istisnaları; - Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın uçak, tren, otobüs gibi toplu taşıma vasıtalarıyla yapacakları şehirlerarası seyahatler için ayrıca seyahat izni alması istenmeyecek, şehirlerarası seyahat edeceğini bilet, rezervasyon kodu vb. ile ibraz etmesi yeterli olacaktır. Bu durumdaki kişilerin şehirler arası toplu taşıma vasıtaları ile ikametleri arasındaki hareketlilikleri, kalkış-varış saatleriyle uyumlu olmak kalmak kaydıyla sokağa çıkma kısıtlamasından muaf olacaktır. - Zorunlu bir kamusal görevin ifası kapsamında ilgili Bakanlık ya da kamu kurum veya kuruluşu tarafından görevlendirilmiş olan kamu görevlilerinin (müfettiş, denetmen vb.) özel veya resmi araçlarla yapacakları şehirler arası seyahatlerine, kurum kimlik kartı ve görevlendirme belgesini ibraz etmek kaydıyla izin verilecektir. - Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmak için veya cenaze nakil işlemine refakat etmek amacıyla herhangi bir cenaze yakınının e-Devlet kapısındaki İçişleri Bakanlığına ait e-Başvuru veya ALO 199 sistemleri üzerinden yapacakları başvurular (yanında akraba konumundaki 9 kişiye kadar bildirimde bulunabilecektir) sistem tarafından vakit kaybetmeksizin otomatik olarak onaylanarak cenaze yakınlarına özel araçlarıyla seyahat edebilmeleri için gerekli seyahat izin belgesi oluşturulacaktır. Cenaze nakil ve defin işlemleri kapsamında başvuru yapacak vatandaşlarımızdan herhangi bir belge ibrazı istenilmeyecek olup Sağlık Bakanlığı ile sağlanan entegrasyon üzerinden gerekli sorgulama seyahat izin belgesi düzenlenmeden önce otomatik olarak yapılacaktır. 2.2- Sokağa çıkma kısıtlaması uygulanan süre ve günlerde vatandaşlarımızın özel araçlarıyla şehirler arası seyahate çıkmamaları esastır.Ancak aşağıda belirtilen zorunlu hallerin varlığı durumunda vatandaşlarımız, bu durumu belgelendirmek kaydıyla; e-Devlet üzerinden İçişleri Bakanlığına ait e-Başvuru ve ALO 199 sistemleri üzerinden Valilik/Kaymakamlık bünyesinde oluşturulan Seyahat İzin Kurullarından izin almak kaydıyla özel araçlarıyla da seyahat edebileceklerdir. Seyahat İzin Belgesi verilen kişiler, seyahat süreleri boyunca sokağa çıkma kısıtlamasından muaf olacaktır. Zorunlu Hal Sayılacak Durumlar; ▪ Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevk olan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, ▪ Kendisi veya eşinin, hastanede tedavi gören birinci derece yakınına ya da kardeşine refakat edecek olan (en fazla 2 kişi), ▪ Bulunduğu şehre son 5 gün içerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikamet ettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araç plakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ▪ ÖSYM tarafından ilan edilmiş merkezi sınavlara katılacak olan, ▪ Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, ▪ Özel veya kamudan günlü sözleşmeye davet yazısı olan, ▪ Ceza infaz kurumlarından salıverilen, Kişilerin zorunlu hali bulunduğu kabul edilecektir. 3. İş Yerlerinin Faaliyetleri 3.1- Yeme-içme yerleri (restoran, lokanta, kafeterya, pastane gibi); - Hafta içi günlerde 07.00-20.00 saatleri arasında gel-al ve paket servis, 20.00-24.00 saatleri arasında ise sadece paket servis, - Hafta sonlarında ise 07.00-24.00 saatleri arasında sadece paket servis,şeklinde faaliyet gösterebileceklerdir. 3.2-.17 Mayıs-1 Haziran arası uygulanacak olan kademeli normalleşme döneminde aşağıda sayılan iş yerlerinin faaliyetlerine geçici olarak ara verilmesine devam edilecektir. - Gazino, taverna, birahane, nargile salonu/kafeleri, - Sinema salonları, - Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi gibi yerler, - İnternet kafe/salonu, elektronik oyun yerleri, bilardo salonları, - Halı saha, yüzme havuzu, spor salonları, - Hamam, sauna ve masaj salonları, - Lunaparklar ve tematik parklar. Çay ocakları ise masa, sandalye/taburelerini kaldırmak ve sadece esnafa servis yapmak kaydıyla faaliyetlerine devam edebileceklerdir. 3.3- Yukarıda sayılan iş yerleri dışında kalan ve tam kapanma döneminde faaliyetlerine ara verilen perakende ve hizmet sektöründeki giyim, tuhafiye, züccaciye, hırdavat gibi dükkanlar ile büro ve ofisler vb. iş yerleri; - Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde içerisinde bulunduğu işkolu için belirlenen tüm salgınla mücadele tedbirlerine riayet etmek kaydıyla hafta içi günlerde 07.00-20.00 saatleri arasında faaliyet gösterebileceklerdir. - Alışveriş merkezlerinin (AVM) ise; hafta içi 10.00-20.00 saatleri arasında faaliyet gösterebilecek olup, hafta sonları kapalı olacaktır. 3.4- Zincir marketler başta olmak üzere çeşitli iş yerleri tarafından açılış veya belirli gün ya da saatlere özgü genel indirim uygulamalarının oluşturduğu yoğunluğun önüne geçilebilmesi için indirim uygulamalarının en az bir hafta sürecek şekilde uzun periyodlarla yapılması gerekmektedir. 3.5- Marketlerde (zincir ve süper marketler dahil) zorunlu temel ihtiyaçlar kapsamındaki ürünler dışında elektronik eşya, oyuncak, kırtasiye, giyim ve aksesuar, alkol, ev tekstili, oto aksesuar, bahçe malzemeleri, hırdavat, züccaciye vb. ürünlerin satışına tam gün sokağa çıkma kısıtlaması uygulanacak olan hafta sonlarında izin verilmeyecektir. 3.6- Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirlenen kurallara uymak kaydıyla pazaryerleri hafta içi günlerde 07.00-19.00 saatleri arasında faaliyet gösterebilecek olup, hafta sonları ise pazar yerlerinin kurulmasına izin verilmeyecektir. 3.7- Online market ve yemek sipariş firmaları, hafta içi ve hafta sonu 07.00-24.00 saatleri arasında evlere/adrese servis şeklinde çalışabileceklerdir. 4. Eğitim-Öğretim Faaliyetleri Halihazırda faaliyetlerine devam etmekte olan kreşlerle birlikte Milli Eğitim Bakanlığıyla yapılan değerlendirmeler çerçevesinde kademeli normalleşme döneminde anaokulları da faaliyetlerine devam edecek olup diğer tüm okul ve sınıf seviyeleri için Milli Eğitim Bakanlığınca kamuoyuna duyurulduğu şekilde uygulama sürdürülecektir. 5. Kamu Kurum ve Kuruluşlarında Mesai Cumhurbaşkanlığının 14.04.2021 tarih ve 2021/8 sayılı Genelgesi ile Cumhurbaşkanlığı İdari İşler Başkanlığının 27.04.2021 tarih ve 17665 sayılı yazısı doğrultusunda, kamu kurum ve kuruluşlarında uygulanmakta olan 10.00-16.00 saatleri arası mesai sistemi ile uzaktan/dönüşümlü gibi esnek çalışma usulünün uygulanmasına kademeli normalleşme döneminde de devam edilecektir. 6. Ertelenen FaaliyetEtkinlik ve Törenler 6.1- Sivil toplum kuruluşları, sendikalar, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üst kuruluşları ile birlikler ve kooperatiflerin genel kurul dahil yapacakları geniş katılımlı her türlü etkinlikleri 1 Haziran 2021 tarihine kadar ertelenecektir. 6.2- Evlendirme işlemlerinin gerçekleştirilmesine devam edilmekle birlikte halen uygulanmakta olan nikah ve nikah merasimi şeklindeki düğünler ile nişan ve kına gibi etkinliklerin yapılmaması uygulaması, 1 Haziran 2021 tarihine kadar devam edecektir. 6.3- Huzurevi, yaşlı bakımevi, rehabilitasyon merkezi, çocuk evleri gibi sosyal koruma/bakım merkezlerinde halihazırda uygulanmakta olan ziyaretçi kısıtlaması 1 Haziran 2021 tarihine kadar uzatılacaktır. 7. Toplu Ulaşım Tedbirleri 7.1- Şehirler arası faaliyet gösteren toplu taşıma araçları (uçak hariç); araç ruhsatında belirtilen yolcu taşıma kapasitesinin %50’si oranında yolcu kabul edebilecekler ve araç içindeki yolcuların oturma şekli yolcuların birbirleriyle temasını engelleyecek (1 dolu 1 boş) şekilde olacaktır. 7.2- Şehir içi toplu ulaşım araçları (minibüs, midibüs vb.) ise 14.04.2021 tarih ve 6638 sayılı Genelgemizle getirilen esaslar çerçevesinde % 50 kapasite sınırlamasına ile ayakta yolcu kabul edilmemesi kuralına tabi olarak faaliyet sunabileceklerdir. 8. Konaklama Tesislerine Dair Tedbirler 8.1- Şehirler arası karayolları üzerinde bulunan dinlenme tesisleri (yerleşim sahası içerisinde bulunanlar hariç) ile konaklama tesislerinin (otel, motel, apart otel, pansiyon vb.) içerisinde bulunan yeme-içme yerleri (sadece konaklamalı müşterilerle sınırlı olacak şekilde) aynı masada aynı anda en fazla 2 kişiye servis açılması kaydıyla hizmet verebileceklerdir. 8.2- Konaklama tesislerinin kapalı alanlarında bulunan eğlence merkezleri kapalı tutulacak ve bu alanlarda müşteri kabul edilmeyecektir. 8.3- Konaklama tesislerinin açık alanlarında toplu eğlence şeklinde etkinliklere kesinlikle izin verilmeyecek, bu yerlerde yoğunlaşmanın önüne geçilebilmek adına fiziksel mesafe kurallarına azami özen gösterilecektir. 8.4- Sokağa çıkma kısıtlaması uygulanacak olan süre ve günlerde konaklama tesislerinde rezervasyonunun bulunması (bedelinin tamamı ödenmiş olmak kaydıyla) vatandaşlarımız açısından sokağa çıkma ve/veya şehirler arası seyahat kısıtlamasından muafiyet sağlayacak olup bu amaçla seyahat edecek vatandaşlarımızın denetimlerde rezervasyon ve ödeme belgelerini ibraz etmeleri yeterli olacaktır. 8.5- 30.09.2020 tarih ve 16007 sayılı ile 28.11.2020 tarih ve 19986 sayılı Genelgelerimiz doğrultusunda konaklama tesislerinin denetimleri etkin şekilde sürdürülecek, sahte rezervasyon başta olmak üzere her türlü kötüye kullanımın önüne geçilecektir. Yukarıda belirtilen esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27 nci ve 72 nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararlarının ivedilikle alınması, uygulamada herhangi bir aksaklığa meydan verilmemesi ve mağduriyete neden olunmaması hususunda;
17.05.2021
Karayolu Taşıma Yönetmeliğinde Değişiklik Yapılmasına Dair Yönetmelik
Sayın Üyemiz, Bu Yönetmelik ile Bakanlığın, salgın, olağanüstü hal, gerginlik, buhran, kriz dönemleri ile afet ve acil durumlarında; bu Yönetmelik kapsamında öngörülen uyarma, geçici durdurma ve iptal gibi müeyyideler ile taşıt yaşları, sözleşmeli taşıt oranları, yetki belgesi almanın diğer özel/genel şartları veya belirlenmiş sürelerin, azaltılmasına, arttırılmasına veya durdurulmasına ilişkin geçici düzenlemeler yapabileceği, yetki belgeleri ile ilgili bazı konular ve sair değişiklikler düzenlenmektedir. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
11.05.2021
TARSİM Ayçiçeği Sigortası
Sayın Üyemiz, Tarım Sigortaları Havuzu’ndan (TARSİM) yapılan açıklamada, üreticilereyüzde 50Devlet prim desteğinden faydalanmaları ve ‘ayçiçeği’ ürününü zamanında sigortalatmaları konusunda uyarıda bulunuldu. Üreticilerin ‘ayçiçeği’ ürünü için son günü beklemeden, bir an önce sigorta yaptırmalarının vurgulandığı açıklamada, öncelikle Çiftçi Kayıt Sistemi’ne (ÇKS) kayıt olunması ya da kaydın güncellenmesi gerektiği, sonrasında ise yetkili sigorta şirketlerinin acenteleri aracılığıyla tarım sigortası poliçesinin düzenlenebileceği bildirildi. Açıklamada şu ifadeler yer aldı: “1 dekarlıkalanda sigorta bedeli891 TLolan yağlık ayçiçeği ürününün sigortalanması halinde ‘dolu paketi’ için ödenecek tutar sadece8 TL. Sigorta bedeli1.625 TLolan çerezlik ayçiçeği ürününün sigortalanmasıhalinde ise ödenecek tutar15 TL. Dijital Tarım Pazarı (DİTAP) sistemine kayıtlı üreticilere toplam poliçe primi üzerindenyüzde 5; aynı zamanda DİTAP üzerinden sözleşme yapmış olmaları durumunda ilaveyüzde 5olmak üzere toplamdayüzde 10‘DİTAP indirimi’, hasarsız geçen yıllara bağlı olarakyüzde 30’a varan oranda ‘hasarsızlık indirimi’, sigorta yaptıran üreticinin yaşının 30 ve altında olması halinde, dolu paket primi üzerindenyüzde 5nispetinde ‘genç çiftçi indirimi’, sigorta yaptıran üreticinin kadın olması halinde dolu paket primi üzerindenyüzde 5nispetinde ‘kadın çiftçi indirimi’ uygulanıyor. Prim tutarının tamamının peşin ödenmesi durumunda toplam poliçe primi üzerindenyüzde 5oranında ‘peşin ödeme indirimi’ ile üreticinin aldığı risk önleyici ve azaltıcı önlem türüne göre çeşitli oranlarda indirimler de mevcut. Ayçiçeği ürününde teminat, dolu, fırtına, hortum, yangın, deprem, heyelan, sel ve su baskını ile yaban domuzu riskleri için bitkinin yeşermesinden ve filizlenmesinden itibaren başlıyor. Kuş zararında ise, dane olum ile hasat dönemi arasında teminat veriliyor. Ayçiçeği, dolu, fırtına, hortum, yangın, heyelan, deprem ile sel ve su baskını, yaban domuzu ve bu yıl itibarıyla teminat kapsamına alınan kuş zararı risklerinin neden olduğu miktar kaybına karşı sigortalanabiliyor. Bu üründe poliçe kabul tarihi lokasyonlara göre değişmekte olup, 1. ürün için10 Haziran, 2. ürün için ise8 Ağustostarihinde sona eriyor. Üreticiler, yetkili acentelerden ve tarsim.gov.tr’den detaylı bilgi edinebilir.” Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.05.2021
HUBUDER Konferansı
Sayın Üyemiz, HUBUDER tarafından her yıl geleneksel olarak düzenlenen uluslararası hasat öncesi değerlendirme toplantımızı 2020 yılında Pandemi nedeniyle düzenleyemedik. Pandemi sürecinin 2021 yılında da devam etmesi nedeniyle“2021 YILI HASADINA DOĞRU TÜRKİYE VE DÜNYA’DA TAHIL”konulu konferansımızın26 Mayıs 2021, Çarşamba günüONLINE (ZOOM)ortamında düzenleme kararı alınmıştır. Bu kapsamda sanal konferansta, yurtdışı ve yurtdışından katılacak olan konunun uzmanı kişiler Dünya özellikle Rusya, Ukrayna, AB, ABD ve Türkiye’de tahıl üretimi, arz talep durumu ve son piyasa gelişmeleri gibi konularda siz katılımcılara güncel sunum yapacaklar ve; 2021 yılı TMO politikaları Türkiye tahıl piyasasını nasıl etkileyecek? Türkiye’de tahıl üretimi bölgelere göre nasıl gerçekleşecek? Lisanslı depoculuk sistemi piyasaları nasıl etkileyecek? Rusya, Ukrayna, AB ve ABD’de üretim nasıl gerçekleşecek? Rusya ve Ukrayna ihracat politikaları ne olacak? Türkiye ekonomisindeki beklentiler neler? Covid etkisindeki ekonomik gelişmeler tarım piyasalarını nasıl etkileyecek? Konularında detaylı bilgilendirileceklerdir. Ayrıca konferans esnasında konuşmacılara soru sorma fırsatı bulacaksınız. Konferansta simultane tercüme yapılacak olup katılım formu ve programahttps://hubuder.org/konferanslinkinden ulaşabilirsiniz. Hasat öncesinde faydalı olacağını umduğumuz konferansımıza katılımlarınızı bekliyoruz. NOT: Güncel mail adresimizhubuder@hubuder.org.trolarak güncellenmiş olup, konferans ile alakalı dönüşlerinizi güncel mail adresimize yapmanızı rica ederiz. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.05.2021
Bitkisel Üretime Destekleme Ödemesi Yapılmasına Hk.
Sayın Üyemiz, Resmî Gazete’de yayımlanan Bitkisel Üretime Destekleme Ödemesi Yapılmasına Dair Tebliğ (Tebliğ No: 2020/31)’in EK-2’sindeki “Destekleme Uygulama Takvimi”nde yer alan “HububatBaklagilve Dane Mısır Fark Ödemesi Desteği” satırı aşağıdaki şekilde değiştirilmiş ve bu satırdan sonra gelmek üzere aşağıdaki satır eklenmiş; “Destekleme Uygulama Takvimi” içerisinde yer alan “Organik Tarım Desteği” ve “İyi Tarım Uygulamaları Desteği” satırlarında yer alan “29/3/2021” ibareleri “28/5/2021” olarak değiştirilmiştir. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.05.2021
Türkiye Odalar ve Borsalar Birliği (TOBB) Başkanı’na iftira.
KAMUOYUNUN BİLGİSİNE Türkiye Odalar ve Borsalar Birliği (TOBB) Başkanı’na iftira. Odatv internet sitesinde ‘’Al Gülüm Ver Gülüm’’ başlıklı haberde iftira ve yanlış bilgiler yer almaktadır. TOBB’un, TOBB Başkanı Rifat Hisarcıklıoğlu’nun ortak olduğu şirketten hizmet alması asla söz konusu değildir. TOBB’un hizmet aldığı Tür-Sum şirketinde TOBB Başkanı Rifat Hisarcıklıoğlu’nun hiçbir ortaklığı söz konusu değildir. TOBB Başkanı ve Yönetim Kurulu üyelerinin şirketleri TOBB’un düzenlediği ihalelere giremezler ve TOBB’a kendi ürün ve hizmetlerini satamazlar. TOBB ve iştiraklerinin düzenlediği ihalelerde, ihaleyi kazanan firmadanyazılıbir taahhütname de alınır. Bu taahhütname ile ihaleyi alan şirket, TOBB Başkanı’nın şirketlerinden mal almayacağını taahhüt eder. Haberde yer alan iftira, iddia, itham ve yorumların aksine TOBB’un etik kuralları da hiçbir şekilde çiğnenmemiştir. TOBB, büyük hassasiyet gösterdiği bu kuralları en başından itibaren kararlılıkla uygulamıştır ve uygulamayı da sürdürecektir. Haberde ismi geçen Tür-Sum şirketi, TOBB’unil ve ilçelerdekiokul yapımı gibi bazı faaliyetlerde teknik müşavirlik hizmeti vermiştir. Bu hizmet, söz konusu faaliyetlerin inşaat ve alım işlerinden bağımsız olarakdenetimine yöneliktir. Kamu ve özel sektörde herkes gayet iyi bilir ki, asıl büyük önem taşıyan inşaat ihalesinin düzgün ve şartnameye uygun yürütülmesidir. Bu noktada kilit bir rolü olan teknik müşavir seçiminde, geçmiş performansının ve yetkinliğinin bilinmesi çok büyük önem taşımaktadır. Kamu ve özel sektöre hizmet veren ve 44 yıldır faaliyet gösteren Tür-Sum, yurtiçi ve yurtdışı iş deneyimleri, yetkin kadrosu nedeniyle tercih edilmiştir. Ahmet Akpınar’ın Yönetim Kurulu Başkanlığı’nı yaptığı Tür-Sum şirketi ile TOBB Başkanı Rifat Hisarcıklıoğlu’nun herhangi bir ortaklığı veya bağı bulunmamaktadır. Haberde söz edilen Armada ve Söğütözü çok ortaklı şirketlerdir. Söğütözü mal sahibidir. Armada ise sadece işletici firmadır. 58ortağı vardır. Rifat Hisarcıklıoğluyüzde 9.74 oranı ile azınlıkhissedarlardan birisidir. Yüzde 3.2 oranı ile küçük hissedarlardan biri de Ahmet Akpınar’dır. Bu çerçevede söz konusu teknik müşavirlik şirketinin sahibinin, TOBB Başkanı Rifat Hisarcıklıoğlu’nun azınlık hissedarı olduğu bir şirkette çok küçük hissedarlardan biri olması gündeme getirilerek tüm bu gerçeklerin göz ardı edilmeye çalışılması son derece yanlış ve yanıltıcıdır. Kamuoyuna saygı ile duyurulur. Türkiye Odalar ve Borsalar Birliği (TOBB)
10.05.2021
Webinar - Karbon Ayak İzi Nedir ve Nasıl Ölçülür?
Sayın Üyemiz, Türkiye Odalar ve Borsalar Birliği Türkiye İklimlendirme Meclisi tarafından 20 Mayıs 2021 tarihinde saat 11.30 da "Karbon Ayak İzi Nedir ve Nasıl Ölçülür?" isimli bir seminer gerçekleştirilecektir. Toplantıya http://webinar.tobb.org.tr adresinde yer alan linkten erişim sağlanabilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.05.2021
Fuar Başvuruları
Sayın Üyemiz, COVID-19 Pandemisinin fuarcılık sektöründeki olumsuz etkilerinin artmasından dolayı;  31.12.2021 tarihine kadar, 2021 Fuar Takviminde yapılacak olan iptal ve değişiklik başvurularından ücret alınmamasına,  Bu tarihe kadarki 2021 Fuar Takvimine ekleme ve değişiklik başvurularında Yurt İçinde Fuar Düzenlenmesine Dair Usul ve Esaslar ın 17 nci maddesinde düzenlenen ekleme başvurularının ana fuar takviminde yer alan bir fuar ile çakışması halinde reddedileceğine ilişkin hükmün askıya alınarak değerlendirilmesine,  Bu tarihe kadar yapılan ekleme, iptal ve değişiklik başvurularında Esaslar da yer alan sürelere uyulmasa dahi başvuruların değerlendirilmeye alınmasına karar verilmiştir.  2021 yılında düzenlenmek üzere Fuar Takviminde yer alan ancak mücbir nedenlerden dolayı 2022 yılına ertelemek isteyen fuarların normal değişiklik başvurusu yapmaları halinde başvurularının kabul edilmesine, değişiklik başvurularından ücret alınmamasına ve bu değişikliklerin 2022 yılı Ana Fuar Takvimine dahil edilmesine karar verilmiştir. Ayrıca, Yurt İçinde Fuar Düzenlenme Yetki Belgesi sahibi firmalardan 2 yılda bir talep edilen en az 250.000 TL sermayenin öz varlık içinde korunduğuna dair mali durumunu gösterir Yeminli Mali Müşavir raporunun 2021 senesi için talep edilmemesine karar verilmiştir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.05.2021
Samsun Export- Samsun Sanayi ve İhraç Ürünleri Sanal Fuarı
Sayın Üyemiz, 3-12 Mayıs 2021 tarihleri arasında ihracatçı ve sanayici firmaların sanal ortamda yer alarak ürünlerini tanıtabileceği Samsun Export – Samsun Sanayi ve İhraç Ürünleri Sanal Fuarı nı düzenleyeceklerini bildirmektedirler. Sanal Fuar da KOBİ lerin ürünlerini 7 dilde tanıtma, B2B görüşmeler yapma imkanı sağlanacağını bildirilmekte, yurt içi ve yurt dışından birçok ziyaretçinin fuara iştirak edeceği bildirilmektedir. Fuar 3-12 Mayıs 2021 tarihleri arasında www.digitalsamsunfair.com web sitesi üzerinden ziyaret edilebilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.05.2021
Trakya ya Hayvan Sevki
Sayın Üyemiz, Tarım ve Orman Bakanlığı Gıda ve Kontrol Genel Müdürlüğünden, Bakanlıklarına iletilen yazı ile hayvan sevkleri hakkında bilgilendirme yapıldığı iletilmektedir. Ticaret Bakanlığı ndan alınan söz konusu yazı ve ekinde bulunan Tarım ve Orman Bakanlığı Gıda ve Kontrol Genel Müdürlüğü nün yazısı ve ekleri ilişikte gönderilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
10.05.2021
Çalışma İzin Görev Belgesi Süresi Uzatıldı
Sayın Üyemiz, İçişleri Bakanlığı muafiyet kapsamındaki işveren ve çalışanların manuel olarak doldurduklarıçalışma izni görev belgesi formunungeçerlilik süresi12 Mayıs 2021 Çarşamba Günü saat 24.00’ekadar uzatıldı. Genelgede, tam kapanma döneminde üretim, imalat, tedarik ve lojistik zincirlerinde herhangi bir aksama yaşanmaması için sokağa çıkma kısıtlaması muafiyeti getirilen işkolları ve görevlileri tespit edilerek duyurulduğu bildirildi. Genelgede, tam kapanma sürecinde muafiyet kapsamında bulunan işkollarında üretim faaliyetlerinin devamlılığını sağlamak ve muafiyetlerin suistimal edilmesini önlemek amacıyla, sokağa çıkma kısıtlamalarından muaf iş yerlerinde görevli kişilere e-Başvuru sistemi üzerinden“çalışma izin belgesi”veya manuel olarak doldurularak çalışan ve iş yeri yetkilisince imzalanıp onaylanan“çalışma izni görev belgesi formunu”alma ve denetimlerde ibraz etme zorunluluğunun getirildiği hatırlatıldı. Genelgede, tam kapanma sürecinde muafiyet tanınan sektör çalışanlarına yönelik e-Başvuru sistemi üzerindenbugün itibariyle 9.5 milyona yakın başvuru neticelendirildiği ve muafiyet nedeni, güzergahı ve zamanı ile kısıtlı olacak şekilde çalışma izni görev belgesi düzenlendiği belirtildi. Genelgede, Nace kodu eşleşme hatası, muafiyet kapsamındaki bir işyerinde görev yapmasına rağmen alt işvereninin muafiyet kapsamında olmaması nedeniyle çalışma izni görev belgesi alamayanlar ile erişim hatası gibi geçici durumlar göz önünde bulundurulduğunda;sistem üzerinden görev belgesi alınamamasının üretim, imalat, tedarik ve lojistik zincirlerinde herhangi bir aksamaya yol açmaması için Ek’te yer alan ve işveren ile çalışanın beyanı/taahhüdüyle manuel doldurularak imza altına alınan“çalışma izni görev belgesi formunun”geçerlilik süresinin12 Mayıs 2021 Çarşamba Günü saat 24.00’ekadar uzatıldığı ifade edildi. Çalışma izin belgesi için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
7.05.2021
81 İl Valiliğine Pazar Yerleri Genelgesi Gönderildi
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl ValiliğinePazar YerleriGenelgesigönderildi. Genelgede, tam kapanma sürecindeki sokağa çıkma kısıtlamasında, temel gıda, ilaç ve temizlik ürünlerinin satıldığı yerler (bakkal, market, kasap, manav, kuruyemişçi, tatlıcı, fırın ve yeme-içme yerleri) ile üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması amacıyla muafiyet kapsamında bulunan işyerleri dışındaki tüm ticari işletme, işyeri ve/veya ofislerin kapalı olacağının düzenlendiği hatırlatıldı. Genelgede, mevsimsel etkiler nedeniyle ürün arzında yaşanan artış, ürünlerin saklama zorluğu ve raf ömürlerindeki kısalık nedeniyle çiftçiler tarafından üretilen tarımsal ürünlerin (yaş sebze-meyve) zayi olabileceği yönünde tespitler bulunduğu belirtildi. Bu doğrultuda, ilgili Bakanlıklar, kamu kurum ve kuruluşları, meslek odaları ve sektör temsilcileri ile yapılan görüşmeler sonucunda alınan kararlar şu şekilde sıralandı: Tam kapanma dönemi içerisinde8 ve 15 Mayıs 2021tarihlerine denk gelenCumartesi günleri 10.00-17.00saatleri arasındasadece yaş sebze/meyve ile fide satışı yapan pazar yerleri açık olacak.Vatandaşların yaş sebze/meyve ve fide ihtiyaçlarını temin amacıyla ikametlerine en yakın pazar yerine gidip gelebilmelerine izin verilecek. Cumartesi günleri 10.00-17.00 saatleri arasında kurulacak pazarlarda sadece yaş sebze/meyve ile fide satılabilecek, (özellikle köylülerimizin ürünleri olmak üzere), temizlik ürünleri, giyim, züccaciye, oyuncak, süs eşyası, çanta vb. ürünlerin satışına ise izin verilmeyecek. Pazar yerlerinde oluşabilecek yoğunluk göz önünde tutularak Valilik/Kaymakamlıkların koordinasyonunda mahalli idareler tarafından gerekli tedbirler alınacak. Bu amaçla mevcut pazaryerleri genişletilecek veya ilave pazar alanları oluşturulacak. Pazar yerlerine kontrollü giriş/çıkışları sağlamak için belirlenen noktalar haricinde diğer tüm alanlar demir bariyer ve benzeri araç-gereç ile kapatılarak kontrolsüz giriş/çıkışlar engellenecek. Pazar yerlerinde Sağlık Bakanlığı Salgın Yönetimi ve Çalışma Rehberinde belirtildiği üzeresergi ve tezgahlar arasında en az 3 metre olacak şekilde mesafe bırakılacak. Her bir pazar yerinde gerekli kontrolleri yapmak için başta zabıta olmak üzere yeterli sayıda personel görevlendirilecek, görevlendirilen personel tarafından pazar yerlerinin içerisinde yoğunluk oluşmaması için gerekli tedbirler alınacak, bu kapsamda içerdeki yoğunluk azaltılana kadar yeni müşteri girişine geçici olarak izin verilmeyecek. Pazar yerlerinde ambalajsız satılan yaş sebze ve meyvelerin tüketicilerce temas edilmeden, doğrudan pazarcı esnafı tarafından hijyen koşullarına dikkat edilerek poşetlenecek ve satışı yapılacak. İlgili mahalli idare birimlerince pazaryerlerinde çöp toplama, hijyen ve dezenfeksiyon hususunda gerekli tedbirler alınacak. Pazar yerlerinde satış yapacak pazarcılar, ilgili meslek odası tarafından düzenlenenmesleki faaliyet belgesiileticari araç görevlendirme belgesiniibraz etmek ve güzergahla sınırlı kalmak kaydıyla Cumartesi günleri sokağa çıkma kısıtlamasından muaf olacak. Bu esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27 nci ve 72 nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararları ivedilikle alınacak. Pazar yerlerine yönelik her türlü tedbirin; Vali/Kaymakamlar ile belediye başkanları ve meslek odası temsilcilerinin katılımıyla planlancak vesahada bizzat takip edilmesi sağlanacak. Başta zabıta görevliler ve kolluk kuvvetleri olmak üzere denetim ekiplerince bu hususa ilişkin gerekli kontrol faaliyetlerinin eksiksiz yerine getirilecek. Uygulamada herhangi bir aksaklığa meydan verilmeyecek ve mağduriyete neden olunmayacak.
4.05.2021
TGK-Zeytinyagı ve Pirina Yagı Tebligi
Sayın Üyemiz, Tarım ve Orman Bakanlığı ndan alınan ilgi yazı ile TGK-Zeytinyagı ve Pirina Yagı Tebligi (Özel Hüküm Uygulama Talimatı-2021) gönderilmiştir. Tarım ve Orman Bakanlığı ndan alınan söz konusu yazı ekte gönderilmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekrete
4.05.2021
Peşin Hububat Satışları (Genel Ve Sözleşme Bazında)
Sayın Üyemiz, TMO stoklarında bulunan ve ekli listede yer alan hububat (Ek-1) ve bakliyat aşağıdabelirtilen esaslar ve ekte (Ek-2) yer alan fiyatlarla 03 Mayıs 2021 tarihinden itibaren peşin bedelmukabilinde satılacaktır. Besici ve yetiştiricilere yapılan arpa satışları peşin veya 90 güne kadar vadeli vevade farksız olarak gerçekleştirilecektir. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
4.05.2021
Online Toplantı Raporları
Sayın Üyemiz / Paydaşımız, T.C. Eskişehir Ticaret Borsası ev sahipliğinde, 23 Ekim 2020 tarihinde "Covid-19 Sonrası Eskişehir Tahıl Tarımında Öncelikler ve Tercihler Neler Olmalıdır" ve 19 Şubat, 2021 tarihinde “Yaşamakta Olduğumuz Kuraklığın Eskişehir de Kışlık Tahıllara Etkileri Konusunda Gözlemler, Olası Sonuçları ve Öneriler" başlıklı online (Zoom) olarak gerçekleştirilen toplantılarda verilen bilgiler, görüş ve yorumları da içeren sonuç raporunu siz değerli tarım paydaşlarımızın bilgisine sunarız. İlgili rapora ulaşmak için tıklayınız. Üyelerimize ve paydaşlarımıza duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
4.05.2021
KOSGEB Mikro ve Küçük İşletmelere Hızlı Destek Programı
Sayın Üyemiz, Covid-19 pandemisinden etkilenen öncelikli sektörlerdeki mikro ve küçük işletmelerin faaliyetlerini sürdürebilmeleri ve istihdam seviyelerini muhafaza edebilmeleri için tasarlanan "KOSGEB Mikro ve Küçük İşletmelere Hızlı Destek Programı" 29 Nisan 2021 tarihi itibariyle Cumhurbaşkanı tarafından kamuoyuna ilan edilmiştir. Başvurular 3 Mayıs 2021 Pazartesi günü başlayacak olup, destek programına ilişkin bilgi notu ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
4.05.2021
81 İl Valiliğine Market Tedbirleri Genelgesi gönderildi
Sayın Üyemiz, Genelgede, tam kapanma sürecinde uygulanan sokağa çıkma kısıtlaması ile ilgili usül ve esasların belirlenerek, valilere duyurulduğu hatırlatıldı. Bu kapsamda daha önce illere gönderilen sokağa çıkma kısıtlaması sırasında temel gıda, ilaç ve temizlik ürünlerinin satıldığı yerler ile üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması amacıyla muafiyet kapsamında bulunan iş yerleri dışında tüm ticari işletme, iş yeri ve/veya ofislerin kapalı olacağı belirtilmiş, vatandaşlarımızın zorunlu temel ihtiyaçlarını karşılamakla sınırlı olacak şekilde bakkal, market, fırın, kasap, manav, kuruyemişçi ve tatlıcıların tam kapanma döneminde 10.00 - 17.00 saatleri arasında faaliyet gösterebileceği, zincir ve süper marketlerin Pazar günleri kapalı kalacağı bildirilmişti. Genelgede, sokağa çıkma kısıtlaması sırasında marketlerde oluşabilecek yoğunlukların önüne geçmek amacıyla ilgili Bakanlıklar, kamu kurum ve kuruluşları, meslek odaları ve sektör temsilcileri ile yapılan görüşmeler sonucunda alınan tedbirler şu şekilde sıralandı: Marketlerde (zincir ve süper marketler dâhil) vatandaşlarımızın zorunlu temel ihtiyaçları kapsamındaki ürünlerin dışında herhangi bir ürün satışına izin verilmeyecek. 7 Mayıs 2021 Cuma gününden itibaren marketlerde (zincir ve süper marketler dâhil) temel gıda ve temizlik ürünlerinin yanı sıra sadece hayvan yemi, mamaları ile kozmetik ürünleri (parfümeri ve makyaj malzemeleri hariç) satılabilecek. Daha önce getirilen alkollü ürün satışı kısıtlamasının yanı sıra marketlerde (zincir ve süper marketler dâhil) elektronik eşya, oyuncak, kırtasiye, giyim ve aksesuar, ev tekstili, oto aksesuar, bahçe malzemeleri, hırdavat, zücaciye vb. ürünlerin satışına izin verilmeyecek. Bu esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27’nci ve 72’nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararları ivedilikle alınacak. Başta zabıta görevlileri ve kolluk kuvvetleri olmak üzere denetim ekiplerince bu hususa ilişkin tebliğler ve kontroller eksiksiz yerine getirilecek. Uygulamada herhangi bir aksaklığa meydan verilmeyecek ve mağduriyete neden olunmayacak. Genelge içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
4.05.2021
Görev Belgesi Hakkında
Sayın Üyemiz, İçişleri Bakanlığı tarafından Görev Belgesi Düzenlenmesi hakkında yeni bir Genelge gönderildi. Genelgede,26.04.2021tarihliCumhurbaşkanlığıKabinesindealınan“tamkapanma”kararıkapsamında29Nisan 2021Perşembegünüsaat19.00’dan17Mayıs2021Pazartesigünüsaat05.00’ekadaruygulanacakolan sokağaçıkmakısıtlamasınıntemelusulveesaslarıBakanlığımızınilgi(a)Genelgesiylebelirlenerek Valiliklere duyurulmuştur. Yineilgi(a)Genelgemizle,dahaöncekikısıtlamadönemlerindeolduğugibitamkapanmadöneminde detemelönceliğiüretim,imalat,tedarikvelojistikzincirlerindeherhangibiraksamayaşanmaması olan sokağaçıkmakısıtlaması muafiyetigetirilenişkollarıvegörevlilertespitedilmiştir. Hemmuafiyetkapsamındabulunanişkollarındagörevlikişilerinüretimdevamlılıklarınınsürdürülmesi vehemdemuafiyetlerinkötüyekullanılmasınınönünegeçilebilmesiamacıylailgi(b)Genelgemizle; ­E­başvurusistemiüzerindençalışmaizinbelgesialınmasına, ­Ek’tebelirtilenyenioluşturduğumuzçalışmaiznigörevbelgesiformuna, dairusulveesaslarbelirlenmiştir. Sokağaçıkmakısıtlamasısırasındamuafiyettanınanişkollarındaçalışankişilerinbaşvurularının değerlendirildiği,e­devletplatformundayeralanİçişleriBakanlığıe­başvurusistemiüzerinden02.05.2021 saat17.00’yekadar2.677.000başvurugereklisorgulamalaryapılarakneticelendirilmişveilgili vatandaşlarımıziçinçalışmaizni görevbelgesidüzenlenmiştir. Halihazırdamuafiyetalanındaolmasınarağmensistemüzerindençalışmaiznigörevbelgesialma imkanıolmayan; ­İşyerisahipleri, ­Kendinamvehesabınabağımsızçalışanlar, ­ Kendiözelsandıklarınatabiolmalarınedeniylesosyalgüvenliksistemindekayıtlarıbulunmayan bankacılıksektörüçalışanları, gibialanlardadagereklikurumlararasıentegrasyonGelirİdaresiBaşkanlığıveTürkiyeBankalarBirliği baştaolmaküzereilgilikurumvekuruluşlarca2Mayıs2021Pazargünütamamlanacaktır. Tamkapanmadöneminde;üretim,imalat,tedarikvelojistikzincirlerindeherhangibiraksama yaşanmamasıvevatandaşlarımızıntemelihtiyaçmalzemelerineerişimlerininsağlanmasıiçinhertürlü tedbiralınmış/alınmaktaolmasınarağmen,buişkollarındazorunlubirgörevinifasıiçinişyerinegidip gelmekdurumundakiişyerisahipleriveyaçalışanlarınherhangibirsorunlakarşıkarşıyakalmamasıiçin; 1.Dahaöncekiilgi(b)Genelgemizleyenioluşturduğumuz“çalışmaiznigörevbelgesiformunun”5 MayısÇarşambagününekadargeçerliolacağıbildirilmişti.Muafiyetalanındakiişkollarıiçinişvereninve çalışanınbeyanıvetaahhüdüylemanuelolarakdoldurularakçalışanveişyeri/firmayetkilisininimzasıyladüzenlenecek“çalışmaiznigörevbelgesiformunun”geçerliliksüresi7Mayıs2021Cumagünüsaat 24.00’ekadaruzatılmıştır. 2.Çalışmaiznigörevbelgesinin,esasitibariylee­devletplatformuüzerindeyeralanİçişleriBakanlığı e­başvurusistemiüzerindenalınmasının,gerekdenetimlerdegereksededüzenlenmesiveişleyişi açısındanrahatlıksağlayacağıvesuiistimaliengelleyeceğiaçıktır.BuçerçevedeEk’tekiformauygunşekilde manuelçalışmaiznigörevbelgesidüzenlenmesi,e­başvurusistemininkullanımındaoluşabilecek problemler,sistemselyoğunluk,erişimhatasıgibigeçicidurumlarnedeniylezamanındagörevbelgesi alınamamasıgibizorunluhallerdekullanılabilecekbiruygulamadır. 3.Öteyandankollukgörevlilerinceyapılacakdenetimlerde,e­başvurusistemiüzerindenalınan çalışmaiznigörevbelgelerirutinkontrole,manueltanzimedilençalışmaiznigörevbelgeleriisekolluk kuvvetlerininkullandıklarıbilgisistemleriüzerindenayrıcadenetimetabitutulacaktır.Bukontrollerde çalışmaiznigörevbelgesininsuiistimaledildiğinintespitihalindetaahhüttebulunanlarlailgiliolarakgerekli idari/adliişlemlergerçekleştirilecektir. Biryılıaşkınsüredirazizmilletimizinçeşitlifedakârlıklardabulunduğu,baştasağlıkçalışanlarıve kollukkuvvetleriolmaküzeretümdenetimekiplerindegörevalanpersonelinbüyükbirözveriylegörev yaptığıvehepimizinbirbirimizekarşısorumluolduğusalgınlamücadelesürecinde;muafiyetlerinsuiistimal edilmemesi,salgınnedeniylekatlanmakdurumundakalınantoplumsalyükünartmamasıaçısındanson dereceönemlidir. YukarıdabelirtilenesaslardoğrultusundaUmumiHıfzıssıhhaKanununun27ncive72ncimaddeleri uyarıncaİl/İlçeUmumiHıfzıssıhhaKurullarıkararlarınınivediliklealınması,uygulamadaherhangibir aksaklığameydanverilmemesivemağduriyetenedenolunmamasıhususunda; bilgisi yer almaktadır. İlgili genelgeye ulaşmak için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
2.05.2021
Ticaret Bakanlığı çek ile ilgili genelge ve tebliğ yayınladı
Sayın Üyemiz, Ticaret Bakanlığı, genelgeden sonra mükerrer Resmi Gazete’de bir de tebliğ yayınladı. Çek ile ilgili sıkıntıları genelge ile çözmeye çalışan Ticaret Bakanlığı genelgeden sonra öğleden sonra mükerrer Resmi Gazete’de bir de tebliğ yayınladı. Tebliğde 30 Nisan ile 31 Mayıs tarihleri arasında çek ibraz yasağının bulunduğu belirtilirken, bu hükmün gerekçesinde kapanmanın ticari hayata olumsuz etkilerinin azaltılmasının amaçlandığına dikkat çekildi. Tebliğde, düzenlemeyle COVID-19 salgın hastalığı nedeniyle uygulanan kısıtlama tedbirleri kapsamında çekini bankaya ibraz edemeyen alacaklının hakkının korunmasının yanı sıra borçlunun ödeme günü bu tarihler arasına denk gelen borçlarını 1/6/2021 tarihinden sonra ödeyebilmesine de imkân sağlandığı belirtilerek, “a) İbraz süresinin son günü, 30/4/2021 ila 31/5/2021 tarihleri arasına isabet eden çeklerin, belirtilen tarihler arasında bankaya ibraz edilmesi halinde, çek hesabı sahibinin hesabında çekin karşılığının bulunması kaydıyla çek bedelinin ödenmesi gerekmektedir. b) İbraz süresinin son günü, 30/4/2021 ila 31/5/2021 tarihleri arasına isabet eden çeklerin, belirtilen tarihler arasında bankaya ibraz edilmesi ve çek hesabı sahibinin hesabında çekin karşılığının bulunmaması halinde, 1/6/2021 tarihinden önce 5941 sayılı Çek Kanunu kapsamında karşılıksızdır işlemi yapılmayacaktır. 1/6/2021 tarihinden sonra ise söz konusu çeklerle ilgili gerekli işlemler yapılabilecektir” ifadeleri kullanıldı. c) 10.12.2003 tarihli ve 5018 sayılı Kamu Mali Yönetimi ve Kontrol Kanunu kapsamına giren kamu idarelerinin kamu hukukundan veya özel hukuktan doğan alacakları hakkında, 30.04.2021 ila 31.05.2021 (bu tarihler dahil) tarihleri arasında icra ve iflas takibi başlatılamaz. İlgili kanun içintıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
30.04.2021
Tam Kapanma Süreci doğrultusunda açıklanan ekonomik destekler
Sayın Üyemiz, 29 Nisan 2020 tarihinde CumhurbaşkanıRecep Tayyip Erdoğan tarafından açıklanan desteklerin tam metni şu şekilde; Salgının faaliyetlerini olumsuz etkilediği esnafımıza yapılan 1.000 TL Gelir desteği ile 500 ve 750 TL olarak verilen kira desteği uygulamasının süresini 1 ay daha uzatıyoruz, TESKOMB ve Halkbank aracılığıyla esnafa kullandırdığımız kredilerin taksit ödemelerini 1 Temmuz 2021 tarihine kadar erteliyoruz, TESKOMB kefaleti ile kredi kullanan esnafımızdan taksit ödemesi yapamayan 240 bin kişinin 1 milyar lira tutarındaki borcu daha sonra tahsil edilmek üzere TESKOMB tarafından bankaya ödenmiştir, Çek ve senetlerle ilgili önemli bir düzenleme Mecliste uzlaşmayla görüşülmektedir, İş Bu sözleşmelerin fesih yasağı 30 Haziran’a kadar uzatılmıştır. Kısa Çalışma Ödeneği süresi Nisan başından Haziran sonuna kadar uzatılmıştır, KOSGEB VASITASIYLA TOPLAMDA 5 MİLYAR TL BÜTÇELİ YENİ BİR DESTEK PROGRAMI BAŞLATIYORUZ; COVID Salgını sebebiyle gelir kaybına uğramış veya nakit akışı bozulmuş ama istihdamını koruyan, imalat sektörlerinde faaliyet gösteren mikro ve küçük ölçekli işletmelere yöneliktir, Teknoloji alanında faaliyet gösteren filiz şirketler de bu desteğe başvurabilecektir, Mikro işletmeler 30 birn TL’ye kadar, küçük işletmeler 75 bin TL’ye kadar olmak üzere 3 yıl geri ödemesiz, tamamı faizsiz şekilde bu destekten faydalanacaklardır, Sektörlerde şartları taşıyan işletmeler 3 Mayıs Pazartesi gününden itibaren e-devlet üzerinden KOSGEB aracılığıyla başvurularını yapabilirler
30.04.2021
Görev Belgesi Düzenlenmesi Konulu Genelge
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl ValiliğineGörev Belgesi DüzenlenmesiGenelgesigönderildi. Genelgede,Bakanlığımız 81 İl ValiliğineGörev Belgesi Düzenlenmesikonulu genelge gönderdi. Genelgede daha önceki kısıtlama dönemlerinde olduğu gibi tam kapanma döneminde de temel önceliği üretim, imalat, tedarik ve lojistik zincirlerinde herhangi bir aksama yaşanmaması olan sokağa çıkma kısıtlaması sırasında bahse konu sektörlerde çalışanlara yönelik sokağa çıkma muafiyeti getirildiği hatırlatıldı. Genelgede, salgınla mücadele sürecinde; muafiyetlerin suiistimal edilmemesi, hastalığın yayılımı ve başta sağlık çalışanları olmak üzere toplumsal yükün artmaması açısından son derece önemli olduğu belirtilerek, üretim, imalat, tedarik ve lojistik sektörleri başta olmak üzere daha önce genelgelerlemuafiyet tanınan işyerlerinde çalışan görevliler için bu işyerlerinin yetkililerince tüm belgelerin geçerliliğin2 Mayıs 2021 Pazar günü saat 24.00’de sona ereceği ifade edildi. Genelge görev belgeleri ile ilgili şu bilgilere yer verildi: 29 Nisan 2021 Perşembe gününden itibaren muafiyetler kapsamında bulunan işyeri/fabrika/imalathane gibi yerlerde çalışan kişilerin, e-devlet platformunda yer alan İçişleri Bakanlığı e-başvuru sistemi üzerindengörev belgesibaşvurusunda bulunacak. Görev belgesi başvurusunda bulunan kişilerin sosyal güvenlik numarasına göre halen çalışmakta olduğu işyeri sicil numarası belirlenecek ve iş yerinin faaliyet alanına göre muafiyet kapsamında kalıp kalmadığı kontrol edilecek. İlgili Bakanlıklarla sağlanan entegrasyonlar sayesinde anlık ve otomatik olarak yapılacak bu sorgulamalar sonucunda bildirim ile aranan şartlar arasında uyumluluğun tespiti halinde sistem üzerinden otomatik olarak görev belgesi düzenlenecek. Başvuruda bulunan çalışana dair kimlik bilgilerinin yanı sıra sokağa çıkma kısıtlaması sırasında hangi amaçla işyerinde olması gerektiği, çalışma süresi/zaman dilimi, işyeri ve ikamet adresi, varsa kullanacağı servis ya da araç plaka bilgisinin de yer alacağı görev belgesinin çıktısı başvuruda bulunan kişi tarafından alınarak işyeri/firma yetkilisine imzalatılacak. Başvuruda bulunacak çalışanın e-başvuru sistemini kullanımında oluşabilecek problemler, sistemsel yoğunluk, erişim hatası gibi geçici durumlar nedeniyle zamanında görev belgesi alınamaması durumunda bir defaya mahsus olmak ve en fazla üç gün için geçerli olmak kaydıyla Ek-1’de örneği sunulan görev belgesi formu manuel olarak doldurularak çalışan ve işyeri/firma yetkilisi tarafından imzalanmak suretiyle düzenlenebilecek. e-başvuru sitemi üzerinden veya zorunlu hallerde manuel olarak düzenlenen görev belgeleri kapsamında; İşyeri/firma yetkilisi, imza altına aldığı belgede belirtilen kişinin yetkilisi olduğu işyerinde/firmada çalıştığı, sokağa çıkma kısıtlaması sırasında zorunlu bir amaçla işyerinde olması gerektiği bilgisinin doğruluğundan, Hakkında görev belgesi düzenlenen kişi ise kendisi ile ilgili bilgilerin doğruluğundan ve sokağa çıkma kısıtlaması sırasında muafiyet nedeni ile buna bağlı olarak zaman ve güzergahla sınırlı davranmaktan, sorumlu olacak. Düzenlenen görev belgesi, sokağa çıkma kısıtlamaları sırasında muafiyet tanınan işyerlerinde çalışan personelin yanında bulundurulacak ve yapılacak kontrollerde denetim ekiplerine ibraz edilecek. e-başvuru sistemi üzerinden üretilen görev belgeleri eş zamanlı olarak kolluk kuvvetlerinin bilgi sistemlerine de iletilecek olup, kolluk kuvvetlerince yürütülecek denetim faaliyetleri sırasında, geçerli görev belgesi olmayan/ibraz edemeyen veya görev belgesinde belirtilen muafiyet nedeni, zamanı ve güzergahı ile denetim sırasındaki durumu uyumlu olmayan kişiler ile eksik/yanlış bilgi veren işyeri yetkilileri hakkında adli ve idari işlem uygulanacak. Bu noktada esnaf, sanayi ve/veya ticaret ile ziraat odaları başta olmak üzere ilgili meslek odaları tarafından gerekli rehberlik faaliyetlerine ağırlık verilecek ve faaliyet alanlarındaki işyerlerinin/firmaların bilgilendirilmeleri ve kurallara uymaya teşvik edilecek. Tam kapanma dönemi içerisinde asgari personel ile hizmet sunacak kamu kurum ve kuruluşlarının hizmet binalarında/yerlerinde görev yapacak kamu personeli için de yetkili yönetici tarafından bu durumu ortaya koyan Ek-2’de örneği verilenKamu Personeli Görev Bildirim Belgesidüzenlenecek ve bu kapsamdaki kamu personeli, görevli olduğu zaman dilimi içerisinde ikameti ile işyeri arasındaki güzergahla sınırlı olacak şekilde muafiyete tabi olacak. Ayrıca seyahat izin başvuruları, önceden e-Devlette Bakanlığımızca sunulan hizmetlerden olan E-Başvuru Sisteminin içerisindeyken vatandaşlarımızın erişimlerini kolaylaştırmak üzere yapılan geliştirmeler ile birlikte e-Devlet İçişleri Bakanlığı Hizmetleri listesinden doğrudan erişim sağlanabilecek hale getirildi. Cenaze sahibi vatandaşların mağdur olmalarının önüne geçilmesi amacıylaCenaze İzin Hizmetiseyahat izni başvurusundan ayrı olarak doğrudan erişilebilir hale getirildi. Ayrıca cenaze izni için başvuru esnasında vatandaşların elektronik ortamdaÖlüm Belgesi yüklemesi uygulamasından da vazgeçildi. Başvuru konusunun doğruluğu, Bakanlığımız ve Sağlık Bakanlığı arasındaki sistem entegrasyonları ile teyit edilecek.
29.04.2021
İL UMUMİ HIFZISSIHHA KURUL KARARI
Sayın Üyemiz, İL UMUMİ HIFZISSIHHA KURUL KARARLARI AŞAĞIDAKİ GİBİDİR.
29.04.2021
Üye İzin Belgesi
27 NİSAN 2021 TARİHİNDE İÇİŞLERİ BAKANLIĞI TARAFINDAN YAYINLANAN "TAM KAPANMA TEDBİRLERİ"GENELGESİ VE AŞAĞIDA YAZILI MADDELERİ GEREĞİNCE İSTENEN BELGERİN SORUMLULUĞU KENDİLERİNE AİT OLMAK ÜZERE BORSAMIZIN ÜYELERİNİN FAALİYETLERİNE İZİN VERİLENLER. -Üretim ve imalat tesisleri ile inşaat faaliyetleri ve bu yerlerde çalışanlar, -Bitkisel ve hayvansal ürünlerin üretimi, sulanması, işlenmesi, ilaçlanması, hasadı, pazarlanması ve nakliyesinde çalışanlar, -Tarımsal üretime ilişkin zirai ilaç̧ tohum, fide, gübre vb. ürünlerin satışı yapılan işyerleri ve buralarda çalışanlar, -Yurt içi ve dışı taşımacılık (ihracat/ithalat/transit geçişler dâhil) ve lojistiğini yapan firmalar ve bunların çalışanları, - Ürün ve/veya malzemelerin nakliyesinde ya da lojistiğinde (kargo dahil), yurt içi ve yurt dışı taşımacılık, depolama ve ilgili faaliyetler kapsamında görevli olanlar, -Sebze/meyve ve su ürünleri toptancı halleri ile buralarda çalışanlar. MESAİ GÜN-SAATLERİNE VE COVİD-19 TEDBİRLERİNE RİAYET ETMEK KAYDIYLA İŞYERLERİNİ AÇABİLECEKLERDİR. MAL VE SEVKİYATLARDA İSE BİR SINIRLAMA YOKTUR. ÜYELERİMİZİN FAALİYET BELGELERİNİ VE ÇALIŞAN PERSONELİN SGK VE GÖREVLENDİRME BELGELERİNİ İŞYERLERİNDE VE ARAÇLARINDA BULUNDURMALARI GEREKECEKTİR. Örnek izin belgesi ekte bilgilerinize sunulmuştur. ÜYELERİMİZE SAYGILARIMIZLA DUYURULUR
28.04.2021
Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari Para Cezalarının Hesaplanmasına Dair Yönetmelik
Sayın Üyemiz, 16 Nisan 2021 tarih ve 31456 sayılı Resmi Gazete de Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari ParaCezalarının Hesaplanmasına Dair Yönetmelik yayımlanmış olup ekte dikkatinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
28.04.2021
Tam Kapanma Tedbirleri Genelgesi
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl Valiliğine Tam KapanmaGenelgesigönderildi. Genelgede,Covid-19 virüsünün mutasyona uğrayan yeni varyantları sonrasında artan bulaşıcılığıyla birlikte Koronavirüs (Covid-19) salgınının toplum sağlığı ve kamu düzeni açısından oluşturduğu riski yönetme ve hastalığın yayılım hızını kontrol altında tutma amacıyla yeni tedbirlerin alınması gerekmiş ve 13 Nisan 2021 tarihli Cumhurbaşkanlığı Kabinesi toplantısında alınan kararlar doğrultusunda 14 Nisan 2021 Çarşamba gününden itibaren iki haftalık kısmi kapanma sürecine girilmiştir. Gelinen aşamada temel usul ve esasları 14.04.2021 tarih ve 6638 sayılı Genelgemizle belirlenen kısmi kapanma tedbirleri sonrasında salgının artış hızının önce yavaşladığı, akabinde durduğu, son günlerde ise bir düşüş eğilimine girdiği görülmektedir. Bu çerçevede 26.04.2021 tarihinde Sayın Cumhurbaşkanımızın başkanlığında toplanan Cumhurbaşkanlığı Kabinesi nde alınan kararlar doğrultusunda; halihazırda uygulanmakta olan kısmi kapanma tedbirlerine yeni önlemler eklenerek tam kapanma dönemine geçilecektir.29 Nisan 2021 Perşembegünü saat19.00’danitibaren17 Mayıs 2021 Pazartesigünü saat05.00’ekadar sürecek olan tam kapanma döneminde ülke genelini kapsayacak şekilde aşağıdaki tedbirlerin alınması gerektiği değerlendirilmektedir. Tam kapanma döneminde 14.04.2021 tarih ve 6638 sayılı Genelgemizde belirtilen tedbirlere ilave olarak; 1. Sokağa Çıkma Kısıtlaması Hafta içi hafta sonu ayrımı olmaksızın29 Nisan 2021 Perşembegünü saat19.00’dabaşlayıp17 Mayıs 2021 Pazartesigünü saat05.00’tebitecek şekilde tam zamanlı sokağa çıkma kısıtlaması uygulanacaktır. 1.1-Sokağa çıkma kısıtlaması uygulanacak günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamak amacıyla Ek’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacaktır. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler, 14.12.2020 tarih ve 20799 sayılı genelgemizde açıkça belirtildiği şekilde muafiyet nedeni ve buna bağlı olarak zaman ve güzergâh ile sınırlı olup, aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konu edilecektir. 1.2-Sokağa çıkma kısıtlamasının olduğu günlerdebakkal, market, manav, kasap, kuruyemişçi ve tatlıcılar10.00-17.00saatleri arasında faaliyet gösterebilecek, vatandaşlarımız zorunluihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın bakkal, market, manav, kasap, kuruyemişçi ve tatlıcılara gidip gelebilecektir. Aynı saatler arasında bakkal, market, manav, kasap, kuruyemişçi, tatlıcılar ve online sipariş firmaları evlere/adrese servis şeklinde de satış yapabileceklerdir. Yukarıda belirtilen uygulama zincir ve süper marketler için haftanın altı günü geçerli olacak, zincir marketler pazar günleri kapalı kalacaktır. 1.3-Sokağa çıkma kısıtlamasının olduğu günlerde yeme-içme yerleri (restoran, lokanta, kafeterya, pastane gibi yerler) sadece paket servis şeklinde faaliyet gösterebileceklerdir. Yeme-içme yerleri ile online yemek sipariş firmalarıRamazan ayı sonuna denk gelen13 Mayıs 2021 Perşembe gününe kadar 24 saat esasına görepaket servis yapabilecektir. Yeme-içme yerleri ile online yemek sipariş firmalarıRamazan ayının sona ermesiylebirlikte saat01.00’ekadar paket servis yapabilecektir. 1.4-Tam kapanma döneminde ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri açık olacaktır (Bu iş yerlerinde sadece ekmek ve unlu mamul satışı yapılabilir.). Vatandaşlarımız ekmek ve unlu mamul ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerineyürümemesafesindeolan fırına gidip gelebileceklerdir. Fırın ve unlu mamul ruhsatlı iş yerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallara ekmek servisi yapılabilecek, sokak aralarında kesinlikle satış yapılmayacaktır. 1.5-Sokağa çıkma kısıtlaması sırasında yukarıda belirtilen temel gıda, ilaç ve temizlik ürünlerinin satıldığı yerler ile üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması amacıyla muafiyet kapsamında bulunan iş yerleri dışında tüm ticari işletme, iş yeri ve/veya ofisler kapalı olacak olup uzaktan çalışma haricinde yüz yüze hizmet verilmeyecektir. 1.6-Sokağa çıkma kısıtlaması uygulanacak olan dönemde konaklama tesislerinde rezervasyonunun bulunması vatandaşlarımız açısından sokağa çıkma ve/veya şehirler arası seyahat kısıtlamasından muafiyet sağlamayacak olup bu dönemde konaklama tesisleri sadece zorunlu durumlara bağlı olarak seyahat izin belgesi alan kişilere hizmet verebileceklerdir. 1.7-Yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamakta olup; ikamet izinliler, geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzere turistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar sokağa çıkmakısıtlamalarına tabidirler. 1.8-Tam kapanma sürecinde kendi ihtiyaçlarını karşılayamayacak durumdaki ileri yaş gruplarındaki veya ağır hastalığı olan vatandaşlarımızın112,155ve156numaraları üzerinden bildirdikleri temel ihtiyaçlarıVEFA Sosyal Destek Gruplarıncakarşılanacak olup, bu konuda gerek personel görevlendirilmesi gerekse ihtiyaçların bir an evvel giderilmesi bakımından gerekli tedbirlerValiler ve Kaymakamlar tarafından alınacaktır. 2. Şehirler Arası Seyahat Kısıtlaması Sokağa çıkma kısıtlaması uygulanacak olan 29 Nisan 2021 Perşembe günü saat 19.00’dan 17 Mayıs 2021 Pazartesi günü saat 05.00’e kadar vatandaşlarımızın şehirler arası seyahatlerine zorunlu haller dışında izin verilmeyecektir. 2.1-Şehirler arası seyahat kısıtlamasının istisnaları; Zorunlu bir kamusal görevin ifası kapsamında ilgili Bakanlık ya da kamu kurum veya kuruluşu tarafından görevlendirilmiş olan kamu görevlileri (müfettiş, denetmen vb.) kurum kimlik kartı ile birlikte görev belgesini ibraz etmek kaydıyla bu hükümden muaf tutulacaktır. Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmak için veya cenaze nakil işlemine refakat etmek amacıyla herhangi bir cenaze yakınının e-Devlet kapısındaki İçişleri Bakanlığına aite-BAŞVURUveyaALO 199sistemleri üzerinden yapacakları başvurular (yanında akraba konumundaki 9 kişiye kadar bildirimde bulunabilecektir) sistem tarafından vakit kaybetmeksizin otomatik olarak onaylanarak cenaze yakınlarına gerekli seyahat izin belgesi oluşturulacaktır. Cenaze nakil ve defin işlemleri kapsamında başvuru yapacak vatandaşlarımızdan herhangi bir belge ibrazı istenilmeyecek olup Sağlık Bakanlığı ile sağlanan entegrasyon üzerinden gerekli sorgulama seyahat izin belgesi düzenlenmeden önce otomatik olarak yapılacaktır. 2.2-Zorunlu Hal Sayılacak Durumlar; Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevk olan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, Kendisi veya eşinin, hastanede tedavi gören birinci derece yakınına ya da kardeşine refakat edecek olan (en fazla 2 kişi), Bulunduğu şehre son 5 gün içerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikamet ettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araç plakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ÖSYM tarafından ilan edilmiş merkezi sınavlara katılacak olan, Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, Özel veya kamudan günlü sözleşmeye davet yazısı olan, Ceza infaz kurumlarından salıverilen, Kişilerin zorunlu hali bulunduğu kabul edilecektir. 2.3-Vatandaşlarımız, yukarıda belirtilen zorunlu hallerin varlığı halinde bu durumu belgelendirmek kaydıyla; e-devlet üzerinden İçişleri Bakanlığına aitE-BAŞVURUveALO 199sistemleri üzerinden Valilik/Kaymakamlık bünyesinde oluşturulan Seyahat İzin Kurullarından izin almak kaydıyla seyahat edebileceklerdir. Seyahat İzin Belgesi verilen kişiler seyahat süreleri boyunca sokağa çıkma kısıtlamasından muaf olacaktır. 2.4-Tam kapanma sürecinde seyahat izin taleplerinde yaşanabilecek artış göz önünde bulundurularak Vali ve Kaymakamlarımızca yeterli sayıda personel görevlendirilmesi başta olmak üzere seyahat izin taleplerinin hızlı bir şekilde değerlendirilerek karara bağlanabilmesi için her türlü tedbir alınacaktır. 2.5-Belirtilen dönem içerisinde uçak, tren, gemi veya otobüs gibi toplu ulaşım aracıyla seyahat edecek kişilere biletleme işlemi yapılmadan önce mutlaka seyahat izin belgesinin olup olmadığı kontrol edilecek, geçerli bir seyahat izninin bulunması halinde biletleme işlemi gerçekleştirilecektir. Uçak, tren, gemi veya otobüs gibi toplu taşıma araçlarıyla yapılacak seferlerde yolcuların araçlara kabulü öncesinde HES kodu sorgulaması muhakkak yapılacak ve tanılı/temaslı gibi sakıncalı bir durumun olmaması halinde araca alınacaktır. 2.6-Şehirler arası faaliyet gösteren toplu taşıma araçları (uçak hariç); araç ruhsatında belirtilen yolcu taşıma kapasitesinin %50’si oranında yolcu kabul edebilecekler ve araç içindeki yolcuların oturma şekli yolcuların birbirleriyle temasını engelleyecek (1 dolu 1 boş) şekilde olacaktır. 3.Tam kapanma sürecinde sağlık, güvenlik, acil çağrı gibi kritik görev alanları hariç olmak üzere kamu kurum ve kuruluşlarında hizmetlerin sürdürülebilmesi için gerekli olan asgari personel seviyesine düşülecek (asgari personel seviyesi toplam personel sayısının % 50’sini aşmayacak ölçüde) şekilde uzaktan veya dönüşümlü çalışmaya geçilecektir. Bu dönemde; Uzaktan ve dönüşümlü çalışmaya tabi kamu personeli, herhangi bir özel muafiyete sahip olmamaları nedeniyle diğer vatandaşlarımızın tabi olduğu esaslar haricinde ikametlerinden ayrılmayacaklardır. Kamu kurum ve kuruluşlarının hizmet binalarında/yerlerinde görev alacak kamu personeli için yetkili yönetici tarafından bu durumu ortaya koyan görev belgesi düzenlenecek ve görevli olduğu zaman dilimi içerisinde ikameti ile iş yeri arasındaki güzergahla sınırlı şekilde muafiyete tabi olacaktır. 4.İller arası hareketliliğin zorunlu olduğu mevsimlik tarım işçileri, hayvancılık ve arıcılık faaliyetlerinde salgınla mücadele koşullarına uygun hareket edilebilmesi için Tarım ve Orman Bakanlığının koordinasyonunda valilikler tarafından gerekli tedbirler eş zamanlı olarak alınacak, bu bağlamda mevsimlik tarım işçilerinin iller arası hareketliliği ile konaklayacakları alanlarda alınacak tedbirler ve iller arası hayvancılık ve arıcılık faaliyetleri konusunda Bakanlığımızca yeni bir Genelge yayımlanıncaya kadar 03.04.2020 tarih ve 6202 sayılı Genelgemizde belirlenen esaslara göre hareket edilecektir. 5.Tam gün uygulanacak sokağa çıkma kısıtlaması tedbirinin konut sitelerinde de uygulanmasını temin etmek amacıyla site yönetimlerine sorumluluk verilecek, site içerisinde izinsiz şekilde dışarı çıkan kişilerin (özellikle çocukların ve gençlerin) ikametlerine dönmeleri konusunda uyarılmaları sağlanacaktır. 6.Sokağa çıkma süresi boyunca sokak hayvanlarının beslenmelerine özel önem verilecek, bu kapsamda Vali/Kaymakamlar tarafından yerel yönetimler, ilgili kamu kurum ve kuruluşları ile gerekli koordinasyon tesis edilerek sokak hayvanlarının beslenmeleri için gerekli tedbirler alınacak, bu amaçla başta hayvan barınakları olmak üzere park, bahçe, orman gibi sokak hayvanlarının doğal yaşam alanlarına düzenli olarak mama, yem, yiyecek ve su bırakılması sağlanacaktır. 7. Denetim Faaliyetlerinin Etkinliğinin Artırılması 7.1-Tam kapanma döneminde kolluk kuvvetlerinin tam kapasiteyle denetim faaliyetlerine katılımı sağlanacak, özellikle sokağa çıkma ile şehirler arası seyahat kısıtlamaları başta olmak üzere kolluk kuvvetleri tarafından kapsamlı, geniş katılımlı, etkili ve sürekli denetim faaliyetleri planlanarak uygulamaya geçirilecektir. 7.2-Sokağa çıkma kısıtlamaları sırasında; Muafiyet tanınan iş yerlerinde çalışıldığına dair gerçeğe aykırı belge düzenlenmesi, Özel sağlık kuruluşlarından sahte randevu alınması, Fırın, market, bakkal, kasap, manav, kuruyemişçi veya tatlıcılara çıkış serbestisinin maksadını aşan şekilde kullanımı (markete ailece gidilmesi gibi), Çiftçi Kayıt Belgesinin (ÇKS) amaç dışı kullanılmasıgibi durumlarda muafiyetlerin giderek artan bir sıklıkla kötüye kullanıldığı göz önünde bulundurularak, bu suistimallerin önlenmesi amacıyla kolluk kuvvetleri tarafından her türlü tedbir alınacak ve yapılacak denetimlerde bu hususların kontrolü özellikle sağlanacaktır. 7.3-Şehirler arası seyahat kısıtlamasının etkinliğinin artırılması amacıyla şehirlerin tüm giriş ve çıkışlarında (iller arası koordinasyon sağlanmak kaydıyla) kontrol noktaları oluşturulacak, kontrol noktalarında görevlendirilecek yeterli sayıda kolluk personeli (trafik ve asayiş birimlerinden) marifetiyle toplu ulaşım araçlarıyla veya özel araçlarla yolculuk edenlerin seyahat izin belgelerinin olup olmadığı muhakkak tetkik edilecek ve geçerli bir mazereti/muafiyeti bulunmayan kişilerin şehirler arası seyahatlerine izin verilmeyecektir. 7.4-Tam gün sokağa çıkma kısıtlaması uygulanacak olan tam kapanma döneminde, vatandaşlarımızın sadece temel ihtiyaçlarının giderilmesi amacıyla açık tutulacak fırın, market, bakkal, kasap, manav, kuruyemişçi ve tatlıcı gibi iş yerlerinin çevresinde gerekli kontrollerinyapılabilmesi için yeterli sayıda kolluk personeli görevlendirilecek; yürütülecek devriye ve denetim faaliyetlerinde, bu iş yerlerinin kurallara uyup uymadıkları ile vatandaşlarımızın bu iş yerlerine gidişlerinde araç kullanmama ve ikametlerine en yakın yere gitme kuralına riayet edip etmedikleri kontrol edilecektir. EK: Sokağa Çıkma Kısıtlamasından Muaf Yerler ve Kişiler Listesi Sokağa çıkma kısıtlamalarının uygulanacağı günlerde istisna kapsamında olduğunu belgelemek ve muafiyet nedeni/güzergahı ile sınırlı olmak kaydıyla; 1.TBMM üyeleri ve çalışanları, 2.Kamu düzeni ve güvenliğinin sağlanmasında görevli olanlar (özel güvenlik görevlileri dâhil), 3. Zorunlu kamu hizmetlerinin sürdürülmesi için gerekli kamu kurum ve kuruluşları ile işletmeler (Havalimanları, limanlar, sınır kapıları, gümrükler, karayolları, huzurevleri, yaşlı bakım evleri, rehabilitasyon merkezleri, PTT vb.), buralarda çalışanlar ile ibadethanelerdeki din görevlileri, Acil Çağrı Merkezleri, Vefa Sosyal Destek Birimleri, İl/İlçe Salgın Denetim Merkezleri, Göç İdaresi, Kızılay, AFAD ve afet kapsamındaki faaliyetlerde görevli olanlar ve gönüllü olarak görev verilenler, cemevlerinin dede ve görevlileri, 4.Kamu ve özel sağlık kurum ve kuruluşları, eczaneler, veteriner klinikleri ve hayvan hastaneleri ile buralarda çalışanlar, hekimler ve veteriner hekimler, 5.Zorunlu sağlık randevusu olanlar (Kızılay a yapılacak kan ve plazma bağışları dahil), 6.İlaç, tıbbi cihaz, tıbbi maske ve dezenfektan üretimi, nakliyesi ve satışına ilişkin faaliyet yürüten iş yerleri ile buralarda çalışanlar, 7.Üretim ve imalat tesisleri ile inşaat faaliyetleri ve bu yerlerde çalışanlar, 8.Bitkisel ve hayvansal ürünlerin üretimi, sulanması, işlenmesi, ilaçlanması, hasadı, pazarlanması ve nakliyesinde çalışanlar, 9.Tarımsal üretime ilişkin zirai ilaç, tohum, fide, gübre vb. ürünlerin satışı yapılan iş yerleri ve buralarda çalışanlar, 10.Yurt içi ve dışı taşımacılık (ihracat/ithalat/transit geçişler dâhil) ve lojistiğini yapan firmalar ve bunların çalışanları, 11.Ürün ve/veya malzemelerin nakliyesinde ya da lojistiğinde (kargo dahil), yurt içi ve yurt dışı taşımacılık, depolama ve ilgili faaliyetler kapsamında görevli olanlar, 12.Oteller ve konaklama yerleri ile buralarda çalışanlar, 13.Sokak hayvanlarını besleyecek olanlar, hayvan barınakları/çiftlikleri/bakım merkezlerinin görevlileri/gönüllü çalışanları ve 7486 sayılı Genelgemizle oluşturulan Hayvan Besleme Grubu üyeleri, 14.İkametinin önü ile sınırlı olmak kaydıyla evcil hayvanlarının zorunlu ihtiyacını karşılamak üzere dışarı çıkanlar, 15. Gazete, dergi, radyo, televizyon ve internet medya kuruluşları, medya takip merkezleri, gazete basım matbaaları, bu yerlerde çalışanlar ile gazete dağıtıcıları, 16.Akaryakıt istasyonları, lastik tamircileri ve buralarda çalışanlar, 17.Sebze/meyve ve su ürünleri toptancı halleri ile buralarda çalışanlar, 18.Ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri, üretilen ekmeğin dağıtımında görevli olan araçlar ile buralarda çalışanlar, 19.Cenaze defin işlemlerinde görevli olanlar (din görevlileri, hastane ve belediye görevlileri vb.) ile birinci derece yakınlarının cenazelerine katılacak olanlar, 20. Doğalgaz, elektrik, petrol sektöründe stratejik olarak faaliyet gösteren büyük tesis ve işletmeler (rafineri ve petrokimya tesisleri ile termik ve doğalgaz çevrim santralleri gibi) ile bu yerlerde çalışanlar, 21.Elektrik, su, doğalgaz, telekomünikasyon vb. kesintiye uğramaması gereken iletim ve altyapı sistemlerinin sürdürülmesi ve arızalarının giderilmesinde görevli olanlar ile servis hizmeti vermek üzere görevde olduklarını belgelemek şartı ile teknik servis çalışanları, 22.Kargo, su, gazete ve mutfak tüpü dağıtım şirketleri ve çalışanları, 23.Mahalli idarelerin toplu taşıma, temizlik, katı atık, su ve kanalizasyon, karla mücadele, ilaçlama, itfaiye ve mezarlık hizmetlerini yürütmek üzere çalışacak personeli, 24.Şehir içi toplu ulaşım araçlarının (metrobüs, metro, otobüs, dolmuş, taksi vb.) sürücü ve görevlileri, 25.Yurt, pansiyon, şantiye vb. toplu yerlerde kalanların gereksinim duyacağı temel ihtiyaçların karşılanmasında görevli olanlar, 26.İş sağlığı ve güvenliği ile iş yerlerinin güvenliğini sağlamak amacıyla iş yerlerinde bulunması gerekli olan çalışanlar (iş yeri hekimi, güvenlik görevlisi, bekçi vb.), 27.Otizm, ağır mental retardasyon, down sendromu gibi “Özel Gereksinimi” olanlar ile bunların veli/vasi veya refakatçileri, 28.Mahkeme kararı çerçevesinde çocukları ile şahsi münasebet tesis edecekler (mahkeme kararını ibraz etmeleri şartı ile), 29.Yurt içi ve yurt dışı müsabaka ve kamplara katılacak olan milli sporcular ile seyircisiz oynanabilecek profesyonel spor müsabakalarındaki sporcu, yönetici ve diğer görevliler, 30.Bankalar başta olmak üzere yurt çapında yaygın hizmet ağı olan kurum, kuruluş ve işletmelerin bilgi işlem merkezleri ile çalışanları (asgari sayıda olmak kaydıyla), 31.ÖSYM tarafından ilan edilmiş merkezi sınavlara katılacağını belgeleyenler (bu kişilerin yanlarında bulunan eş, kardeş, anne veya babadan bir refakatçi) ile sınav görevlileri, 32.İl/İlçe Umumi Hıfzıssıhha Kurullarınca izin verilen, şehirler arası karayolları kenarında bulunan dinleme tesislerinde yer alan yeme-içme yerleri ve buralarda çalışanlar, 33.Zorunlu müdafi/vekil, duruşma, ifade gibi yargısal görevlerin icrasıyla sınırlı kalmak kaydıyla avukatlar, 34.Dava ve icra takiplerine ilişkin yapılacak zorunlu iş ve işlemler için adliyelere gitmesi gereken taraf veya vekilleri (avukat) ile mezat salonlarına gidecek ilgililer, 35.Araç muayene istasyonları ve buralarda çalışan personel ile araç muayene randevusu bulunan taşıt sahipleri, 36.Milli Eğitim BakanlığıEBA LİSE TV MTALveEBAplatformunda yayınlanmak üzere Bakanlığa bağlı mesleki ve teknik ortaöğretim okul/kurumlarında çalışmaları devam eden uzaktan eğitim video çekimi, kurgu ve montaj faaliyetlerini yürütmekte olan ya da söz konusu çalışmaların koordinasyonunu sağlayan personel, 37.Profesyonel site yöneticileri ile apartman/site yönetimince düzenlenen görevli olduklarına dair belgeyi ibraz etmek ve ikametleriyle görevli oldukları apartman veya sitelere gidiş-geliş güzergâhıyla sınırlı olmak kaydıyla apartman ve sitelerin temizlik, ısınma vb. işlerini yerine getiren görevliler, 38.İş yerinde bulunan hayvanların günlük bakım ve beslenmelerini yapabilmek için ikamet ile iş yeri arasındaki güzergâh ile sınırlı olmak kaydıyla evcil hayvan satışı yapan iş yerlerinin sahipleri ve çalışanları, 39.Sadece yarış atlarının bakım ve beslenmelerini ve yarışlara hazırlık antrenmanlarını yapmak ve ikamet ile yarış ya da antrenman alanı arasındaki güzergâhla sınırlı kalmak kaydıyla at sahipleri, antrenörler, seyisler ve diğer çalışanlar, 40.Sadece ilaçlama faaliyetleri için zorunlu olan güzergâhlarda kalmak ve bu durumu belgelemek kaydıyla iş yerlerinin haşere ve diğer zararlı böceklere karşı ilaçlamasını yapan firmalarda görevli olanlar, 41.Muafiyet nedenine bağlı olmak ve ikametlerinden iş yerlerine gidiş/gelişleri ile sınırlı olmak kaydıyla serbest muhasebeciler, serbest muhasebeci mali müşavirler, yeminli mali müşavirler ile çalışanları, 42.10.00-16.00 saatleri arasında sayıları banka yönetimlerince belirlenecek şekilde sınırlı sayıda şube ve personel ile hizmet verecek olan banka şubeleri ile çalışanları, 43.Nöbetçi noterler ile buralarda çalışanlar.
27.04.2021
KOSGEB Desteği Webinarı
Sayın Üyemiz, KOSGEB in "Ar-Ge, Ür-Ge ve İnovasyon Destek Programı"nın açık çağrısı hakkında 28 Nisan 2021 Çarşamba günü saat: 14:00 te internet üzerinden bir seminer gerçekleştirilecektir. Seminere ilişkin davet ekte sunulmaktadır. KOSGEB ve TOBB işbirliğinde gerçekleştirilecek olan seminerde ekli davette yer alan tabloda bulunan hedef sektörlerde ve uygun proje konularında işletme büyüklüğüne göre 6 Milyon TL ye kadar geri ödemesiz destek sağlayan "Ar-Ge, Ür-Ge ve İnovasyon Destek Programı" anlatılacak olup, seminer sonunda KOBİ lerin konu hakkındaki soruları cevaplandırılacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.04.2021
TOBB UYUM - OSBÜK iş birliği protokol töreni
Sayın Üyemiz, Organize Sanayi Bölgeleri Üst Kuruluşu ve TOBB UYUM Arabuluculuk Uyuşmazlık ve Çözüm Merkezi arasında 29 Nisan 2021 Perşembe günü saat 11:00 de iş birliği protokolü imzalanacaktır. İnternet üzerinden katılımın mümkün olduğu protokol imza törenine ilişkin davet ekte sunulmaktadır. Törende öncelikle TOBB UYUM un kuruluş amacı, TOBB UYUM un hizmetleri ve OSBÜK - TOBB UYUM işbirliği hakkında sunum yapılacak ardından karar alma süreçlerinde üst kuruluşların rolü değerlendirilecektir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.04.2021
Kısa Çalışma Ödeneği Haziran Sonuna Kadar Sürecek
Sayın Üyemiz, Cumhurbaşkanı Recep Tayyip Erdoğan, kısa çalışma ödeneği uygulamasının Haziran ayı sonuna kadar devam edeceğini açıkladı. Erdoğan, turizm sektöründe de mayısta sona erecek KDV indirimini bir ay daha uzatıldığını duyurdu. İş dünyasının talep ettiği kısa çalışma ödeneğinde beklenen adım atıldı ve süre uzatıldı. Cumhurbaşkanı Recep Tayyip Erdoğan, tüm sektörler için geçerli olmak üzere Nisan, Mayıs, Haziranı kapsayacak şekilde kısa çalışma ödeneği uygulamasının devam ettirileceğini açıkladı. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.04.2021
Slovak Matchmaking Fair 2021
Sayın Üyemiz, Slovakya Ekonomi Bakanlığı nın himayelerinde,25-26 Mayıs 2021 tarihlerinde ZOOM da "Slovak Eşleştirme Fuarı (Slovak Matchmaking Fair 2021)"nıngerçekleştirileceği bildirilmektedir. Bahsi geçen fuarın, Slovak ve yabancı katılımcıların bir araya gelerek ikili görüşmeler gerçekleştirmesi,potansiyel iş ortaklıkları ve yeni temaslar kurma noktasında etkili bir araç olması sebebiyle Slovakya nınönemli bir etkinliği olarak görüldüğü belirtilmektedir. İş insanlarının, potansiyel ortaklarıyla, hükümet temsilcileri ve Slovak Ticaret ve Yatırım Ajansı yetkilileriylegörüşme fırsatı yakalayabileceği söz konusu etkinliğin detaylı bilgileri ekte sunulmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.04.2021
Çiğ Süte 2 Yıllık Destekleme Kararı
Sayın Üyemiz, Çiğ süt desteği ve süt piyasasının düzenlenmesine ilişkin Cumhurbaşkanı Kararı Resmi Gazete de yayınlanarak yürürlüğe girdi. Karara göre, 2021 ve 2022 de destekler çiğ süt sınıflandırmasına göre ödenecek. Et ve Süt Kurumu nun üretici örgütleri üzerinden çiğ sütü süt tozuna dönüştürmesi de destekleme kapsamında olacak. Desteklemeden kimler yararlanacak? 1- Tarım ve Orman Bakanlığının belirleyeceği dönemler, kriterler ve birim fiyatlar üzerinden çiftçilere çiğ süt destekleme ödemesi yapılacak. 2- Desteklemeden üretmiş olduğu çiğ sütü, süt işleme tesislerine satan ve bir üretici örgütüne üye olan yetiştiriciler yararlanacak. 3- Manda, inek, koyun ve keçi sütü, soğutulmuş inek sütü, üretici örgütleri kanalı ile pazarlanan soğutulmuş inek sütü destekleme kapsamında olacak. 4- Çiğ inek sütü desteklemesi, protein ve yağ değerine göre yapılan A,B,C sınıflamasına göre ödenecek. 5- Üretmiş olduğu çiğ sütü, süt piyasasının düzenlenmesi uygulaması kapsamında, üretici örgütleri aracılığı ile süt ürününe(süt tozu) çevirterek Et ve Süt Kurumu Genel Müdürlüğü (ESK)’ne satan üreticiler çiğ süt desteklemesinden yararlandırılacak. 6- Hastalıktan ari işletme belgeli süt üreten işletmeler, ürettikleri çiğ sütü, faaliyet alannda sütün arzı/satışı bulunan işletme kayıt belgesine sahip ve Bakanlık Süt Kayıt Sistemine kayıtlı yerel perakendecilere, işletme kayıt belgesine sahip Bakanlık Süt Kayıt Sistemine kayıtlı süt dolum tesislerine fatura/müstahsil makbuzu karşılığında satmaları şartıyla çiğ süt desteklemesinden yararlandırılacak. 7-Ürettiği çiğ sütü, Dijital Tarım Pazarı (DİTAP) üzerinden doğrudan veya üyesi olduğu üretici/yetiştirici örgütü üzerinden satan üreticilere Bakanlığın belirleyeceği dönemler, kriterler ve birim fiyatlar üzerinden ilave destekleme ödemesi yapılacak. Çiğ süt piyasasının düzenlenmesi Çiğ süt piyasasının düzenlenmesi uygulamasında, Et ve Süt Kurumu tarafından yapılan alım ve satım arasında oluşacak fark, hayvancılık destekleme bütçesinden karşılanacak. Üretici örgütleri için yüzde 3 kesinti Çiğ sütü toplayan, pazarlayan üretici örgütlerine desteğin yüzde 3 ü "çiftçi örgütlerini güçlendirme" amacıyla ödendikten sonra kalan miktar çiftçiye ödenecek. Ödemeler nasıl olacak? Destek ödemeleri, Tarım ve Orman Bakanlığının 2021-2022 yılları bütçesinde hayvancılık desteklemeleri için ayrılan ödenekten sağlanacak. 2022 yılından kalan ödemeler 2023 bütçesinden hayvancılık desteklemeleri için ayrılacak ödenekten sağlanacak. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.04.2021
Pandemi Kurallarına Uygun 23 Nisan Kutlamaları Genelgesi
Sayın Üyemiz, T.C. İçişleri Bakanlığından yapılan açıklamada; 81 İl Valiliği nePandemi Kurallarına Uygun 23 Nisan Kutlamaları Genelgesi gönderildi. Genelgeye göre; 23 Nisan Ulusal Egemenlik ve Çocuk Bayramıresmi tatil olması dolayısıyla bu hafta sonuna özel sokağa çıkma kısıtlaması22 Nisan Perşembe günü saat 19.00’dabaşlayacak. Cuma, cumartesi, pazar günlerinin tamamını kapsayacak sokağa çıkma kısıtlaması,26 Nisan Pazartesi günü saat 05.00’tesona erecek. Daha önce genelge ile belirtilenSokağa Çıkma Kısıtlamasından Muaf Yerler ve Kişiler Listesiaynen geçerli olacak. Hafta sonu 10.00 - 17.00 saatleri arasında açık olan bakkal, market, kasap, manav ve kuruyemişçi ile şehirlerarası seyahat kısıtlamasına dair usul ve esaslar 23 Nisan Cuma günü de birebir uygulanacak. Türkiye Büyük Millet Meclisi, Anıtkabir ve Birinci Meclis’te gerçekleştirilecek tören ve kutlamalar dışında tüm il ve ilçelerde Ulusal Egemenlik ve Çocuk Bayramı aşağıdaki esaslara göre kutlanacak. Milli Eğitim Bakanlığı nın 06.04.2021 tarih ve 23672112 sayılı yazısı doğrultusunda çelenk sunma törenleri fiziki mesafe koşullarına uygun şekilde asgari düzeyde katılımla gerçekleştirilecek. Çelenk sunma törenleri dışında kişilerin bir araya gelmesine neden olabilecek kutlama programları yapılmayacak. Bunun yerineUlusal Egemenlik ve Çocuk Bayramının coşkusunu yansıtabilecek başta kolluk araçlarından oluşmak üzere araç konvoyları, ses, ışık ve havai ışık gösterileri, mobil araçlarla gösteriler ile çevrimiçi etkinliklere ağırlık verilecek. Ulusal Egemenlik ve Çocuk Bayramı kutlama törenlerinde görevli olan kişiler de tören ve kutlama programları süresi ile sınırlı olmak kaydıyla sokağa çıkma kısıtlamalarından muaf tutulacak. Bu esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27 nci ve 72 nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararları ivedilikle alınacak. Bilgisi yeralmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
22.04.2021
Et ve Süt Kurumu Hayvansal Yağ Satışı
Sayın Üyemiz, Et ve Süt Kurumu Sincan Et Kombinasından Borsamıza gelen yazıda; Kombinamızın stoklarında insani gıda özelliğini kaybeden, 5.187 kg sığır böbrek yağı, 24.868 kgsığır iç yağı ve 36.554 kg sığır kavurma bulunmaktadır. İnsani tüketim amacı dışında kullanılmak üzeresöz konusu emtiların birim fiyat teklifi toplanarak satışı yapılacaktır. İnsani gıda tüketimi dışında kullanılmak üzere satışı yapılacak ürünler için birim fiyat teklifleri07.05.2021 günü mesai saati sonuna kadar Sincan Et Kombinası Müdürlüğü ne elden yada kargo ilekapalı zarf içinde vereceklerdir. Satış yapılmadan önce alınan ürünün insani gıda olarak kullanılmayacağına dair noter tasdiklitaahhütname istenecektir. Satılacak yağlar ve kavurmalar ile ilgili ekteki listede gönderilen miktarlarınhepsine yada bir kısmına teklif verilebilecektir. Teklifler Genel Müdürlüğümüz tarafındandeğerlendirilecektir. Birim fiyat teklifi uygun görülen firma/şahıs peşin bedel veya kredi kartı tek çekim olarakverilen süre içerisinde söz konusu emtiaları Sincan Et Kombina sından teslim alacaklardır. Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
21.04.2021
Pandemi Döneminde Türk-Alman Ekonomik İlişkileri
Sayın Üyemiz, Türkiye ve Almanya arasındaki ilişkiler uzun bir geçmişe dayanmaktadır. İki ülke arasında var olan gerek ekonomik ilişkiler, gerekse insani ilişkiler özellikle son yarımasırda kat kat artmış bulunmaktadır. Pandeminin hayatımızı değiştirmesi, Almanya ile Türkiye arasındaki ticari ilişkilere de etki etmiş ve birçok iş insanının akıllarında farklı soruların ortaya çıkmasına sebep olmuştur. Pandeminin dünya çapında getirdiği sorunlarla birlikte, ikili ilşikilerde güncel durum nasıl değişmiştir? İki ülke arasındaki karşılıklı yatırımların cazibesi artmış mıdır, ya da Pandemi dönemi karşılıklı yeni frırsatlar yaratmış mıdır? Türk kökenli iş insanları, hangi koşullar altında Alman pazarına açılabilmekte ve iş takibi açısından Almanya için vize ya da oturum izni alabilmektedirler? Türkiye pazarına girmek, Alman iş insanları için ne tür avantajlar getirmektedir? Türk ve Alman iş insanları için hangi alanlarda iş birliği potansiyelleri mevcuttur? Düzce Ticaret ve Sanayi Odasıile birlikte22 Nisan 2021tarihindeTSİ 11:00’de (DE 10:00)gerçekleştireceğimiz web seminerimizde ele alacağımız bu ve benzeri konuları dinlemek üzere Sizleri de etkinliğimize içtenlikle davet ediyoruz. Ayrıntılı program için ekte ki dosyaya (2. sayfa) bakınız. Katılmak için bir zoom hesabına ihtiyacınız olacaktır. Eğer yoksahttps://zoom.us/signuplinki üzerinden ücretsiz ve kolayca sadece e-posta adresi ile kaydolabilirsiniz. Katılmak için lütfen seminerimize kaydolun:https://bit.ly/3mEo7Eo Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
21.04.2021
Hayvancılık İşletmelerine İyi Tarım Uygulamaları Zorunluluğu
Sayın Üyemiz, Tarım ve Orman Bakanlığı, tarımsal faaliyetlerden kaynaklanan nitrat kirliliğinin önlenmesine yönelik tebliğde düzenlemeye gitti. Bakanlık’ın hazırladığı “Sularda Tarımsal Faaliyetlerden Kaynaklanan Nitrat Kirliliğinin Önlenmesine Yönelikİyi TarımUygulamaları Kodu Tebliğinde Değişiklik Yapılmasına Dair Tebliğ” Resmi Gazete’de yayımlandı. 11 Şubat 2024 tarihinde itibaren geçerli olmak üzere yürürlüğe giren tebliğe “nitrat eylem planı” eklendi.İyi tarımuygulamaları kodu nitrata hassas bölgelere özgü hazırlanan nitrat eylem planları ile uygulanacak. Tebliğ kapsamında yürürlüğe girecek olan değişikliklere göre, nitrata hassas bölgelerde, yılda 1600 kilogram ve üzeri azot üretenhayvancılıkişletmeleri hayvansal gübre deposu ve hayvansal gübre yönetim planı; yeter gelirli tarımsal arazi büyüklüğüne sahip tarımsal işletmeler ise gübreleme planı yapmakla yükümlü olacak. Bu bölgelerde, yılda 1600 kilogramdan az azot üretenhayvancılıkişletmeleri için hayvansal gübre deposu ve hayvansal gübre yönetim planına yönelik hükümlerin uygulanması zorunlu olmayıp gönüllülük esas alınacak ancak bu işletmeler, diğer tüm hükümleri uygulamakla yükümlü olacak. Tebliğe göre, hayvansal gübre deposu, hayvansal gübre yönetim planı ve/veya gübreleme planı yapacak tarımsal işletmeler il/ilçe müdürlükleri tarafından belirlenecek. HİBE VE TEŞVİKLE KURULACAK İŞLETMELER Nitrata hassas ve hassas olmayan bölgelerde ise yılda 1600 kilogram ve üzeri azot üretme kapasitesine sahip olarak kurulacakhayvancılıkişletmeleri ile yıllık ürettikleri azot miktarına bakılmaksızın hibe, destek, teşvik ve düşük faizli kredi kullanılarak kurulacakhayvancılıkişletmeleri,iyi tarımuygulamaları koduna uyumlu olarak planlanacak. Tarımsal işletmeleriniyi tarımuygulamaları koduna uygunluğu il/ilçe müdürlüğü tarafından değerlendirilecek. ÜÇ YILDAN AZ ZAMAN KALDI Tebliğ kapsamındaiyi tarımuygulamaları koduna uymakla yükümlü olan ve bu maddenin yürürlüğe girdiği tarih itibarıyla faaliyet gösterenhayvancılıkişletmeleri, 11 Şubat 2024 tarihine kadar iyi tarım uygulamaları koduna uyum sağlamak zorunda olacak. Resmi Gazetedeki ayrıntılara ulaşmak için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
9.04.2021
"Petrol Endüstrisinde Millî Teknolojiler (PEMT)" Toplantısı Daveti
Sayın Üyemiz, Türkiye Cumhuriyeti Enerji ve Tabii Kaynaklar Bakanlığı’nın destekleri ve Türkiye Petrolleri Anonim Ortaklığı (TPAO) ev sahipliğinde, 10 Şubat 2020 tarihinde ilki düzenlenen "Petrol Endüstrisinde Millî Teknolojiler (PEMT)" Toplantısı bu yıl 20-21 Nisan 2021 tarihlerinde, pandemi koşulları nedeniyle dijital bir platform üzerinden düzenlenecektir. PEMT’21 Toplantısı ile petrol - doğal gaz arama ve üretim sektörü kapsamında yerli sanayinin ‘Millî Enerji ve Maden Politikası’nın bir parçası haline dönüştürülmesi, yüksek katma değerli mal / hizmet / teknoloji üretimine katkıda bulunulması ve paydaşların buluşturularak, yol haritası oluşturulmasına öncülük edilmesi hedeflenmektedir. Bu çerçevede; TPAO’nun yerli hizmet / ürün / teknoloji kullanımını artırma hedefi doğrultusunda, yerli tedarikçileri sektöre kazandırmak, karşılaşılan sorunlar karşısında alternatifli özgün çözümler geliştirilmesini sağlamak, faaliyetler ve tedarik süreçlerine ilişkin gerekli bilgilendirmeleri yaparak, işbirlikleri açısından fırsatlar yaratmak amaçlanmaktadır. Toplantı programına ve toplantıya ait diğer detaylara ekte sunulan e-davetiye, program veya ilgili web sitesiwww.pemt.com.tr<https://imsva91-ctp.trendmicro.com:443/wis/clicktime/v1/query?url=http%3a%2f%2fwww.pemt.com.tr&umid=D3ED0275-BFDF-0D05-949C-41FCA6EB8875&auth=b2fe8baccee5dc4fab1d34394afd8998ce5605da-f122f8a7e9f30ed25be859e64914a2f2af0c7bdc> aracılığıyla ulaşılabilir. Toplantıya katılım ücretsiz olup, web sitesi üzerinden kayıt yaptırılması (http://www.pemt.com.tr/kayit-ol/<https://imsva91-ctp.trendmicro.com:443/wis/clicktime/v1/query?url=http%3a%2f%2fwww.pemt.com.tr%2fkayit%2dol%2f&umid=D3ED0275-BFDF-0D05-949C-41FCA6EB8875&auth=b2fe8baccee5dc4fab1d34394afd8998ce5605da-8515c01eb65a0563a3a27bcdc4fb4ba9450e0058>) gerekmektedir. Kayıt altına alınan e-posta adreslerine, toplantı öncesinde, katılım için gerekli şifreler iletilecektir. Programa ilişkin her tür sorularınız için aşağıdaki iletişim bilgileri üzerinden temas sağlayabilirsiniz. pemt@tpao.gov.tr<mailto:pemt@tpao.gov.tr> /pemt.tpao@gmail.com<mailto:pemt.tpao@gmail.com> 0312 207 30 11 / 0533 789 68 68 Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
20.04.2021
TİGEM 1.164,84 Ton Buğday Satışı
Sayın Üyemiz, 22.04.2021 günü saat 10:00 da Şanlıurfa Ticaret Borsasında işletmemize ait 2020 yılı istihsali1.164,84 ton mahsul buğdayınsatış tekrarıiçin açık artırma usulü satış ihalesi yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
19.04.2021
Resmi Gazetede Yayınlanan "İşyeri Açma ve Çalışma Ruhsatlarına İlişkin " Yönetmelikte Yapılan Değişiklik
Sayın Üyemiz, Resmi Gazetede Yayınlanan "İşyeri Açma ve Çalışma Ruhsatlarına İlişkin " Yönetmelikte Değişiklik yayınlanarak yürürlüğe girmiştir. Resmi Gazetedeki ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
19.04.2021
Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari Para Cezalarının Hesaplanmasına Dair Yönetmelik
Sayın Üyemiz, 16 Nisan 2021 Tarihli ve 31456 Sayılı Resmi Gazetede yayımlanan Gıda ve Yemlerde Taklit ve Tağşiş Fiili ve İdari Para Cezalarının Hesaplanmasına Dair Yönetmelikte; Veteriner Hizmetleri, Bitki Sağlığı, Gıda ve Yem Kanununun 24 üncü maddesinin dördüncü fıkrası uyarınca gıda ve yemde taklit ve tağşiş fiillerine yönelik yaptırımların uygulanmasına ilişkin usul ve esaslar düzenlenmektedir. İlgili yönetmeliğe ulaşmak için; https://www.resmigazete.gov.tr/eskiler/2021/04/20210416-2.htm Saygılarımızla, Gültekin GÜLER Genel Sekreter
16.04.2021
Tarım Römorkları İmalatı/İthalatı
Sayın Üyemiz, T.C. Sanayi ve Teknoloji Bakanlığı ndan alınan tarım römorku imalatı / ithalatı alanında faaliyet gösteren üyelerin yıl içerisinde Bakanlıkça gerçekleştirilmesi planlanan PGD faaliyetleri kapsamında yükümlülükleri hakkındaki yazı ektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
16.04.2021
Balıkesir Temalı Ürün Tasarım Yarışması
Sayın Üyemiz, Eskişehir Valiliğinden Borsamıza gönderilen yazıda; Balıkesir Büyükşehir Belediye Başkanlığı Kültür ve Sosyal İşler Dairesi Başkanlığıtarafından "Balıkesir Temalı Ürün Tasarım Yarışması" yapılacağı ilgi yazı ile duyurulmuştur. Bilgisi yer almaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.04.2021
Ceylanpınar Tarım İşletmesi Müdürlüğü’ne Ait 24.500 Kg Mahsul Fıstık Satış Tekrarı
Sayın Üyemiz, TİGEM Ceylanpınar işletmesinden Borsamıza gelen yazıda,21.04.2021 günü saat 10:30 da Şanlıurfa Ticaret Borsası merkez binasında işletmemize ait 2019-2020 yılı istihsali24.500 kg mahsul fıstık içinaçık artırma usulü satış tekrarı ihalesi yapılacaktır. ihale ile ilgili evraklar www.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır.Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.04.2021
Damızlık Düve Yetiştiriciliğinin Desteklenmesine İlişkin Uygulama Esasları Tebliğinde Yapılan Değişiklik
Sayın Üyemiz, MADDE 1 –3/10/2016 tarihli ve 29846 sayılı Resmî Gazete’de yayımlanan Damızlık Düve Yetiştiriciliğinin Desteklenmesine İlişkin Uygulama Esasları Tebliği (Tebliğ No: 2016/39)’ne aşağıdaki geçici madde eklenmiştir.“Devam eden işlerde süre uzatımı GEÇİCİ MADDE 1 –(1) Bu Tebliğ kapsamında desteklenen işletmelerden Dünya Sağlık Örgütü tarafından pandemi ilan edilen Covid-19 salgını nedeniyle hayvan temininde yaşanan güçlükler sonucu belirlenmiş kapasitelerinin altına düşmüş olanlar kapasitelerine ulaşmalarına ve eksiklerini gidermelerine imkân sağlamak üzere bu maddenin yayımı tarihinden itibaren 30 gün içerisinde müracaat etmeleri halinde, ilave taahhütname vermeleri kaydıyla 12 nci madde hükümlerince belirlenen taahhüt süreleri 7 yıla çıkarılır.” MADDE 2 –Bu Tebliğ yayımı tarihinde yürürlüğe girer. MADDE 3 –Bu Tebliğ hükümlerini Tarım ve Orman Bakanı yürütür. Ayrıntılar için tıklayınız. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
15.04.2021
Ceylanpınar Tarım İşletmesi Müdürülüğü Ne Ait 16.500 Kg Mahsul Badem Satışı
Sayın Üyemiz, TİGEM Ceylanpınar işletmesinden Borsamıza gelen yazıda, 21.04.2021 günü saat 10:00 da Şanlıurfa Ticaret Borsası merkez binasında işletmemize ait 2020 yılı istihsali16.500 kg mahsul badem satışıiçin açık artırma usulü satış tekrarı ihalesi yapılacaktır. ihale ile ilgili evraklarwww.tigem.gov.trelektronik adresinin ihaleler bölümünde yayınlanmıştır. Bilgisi yer almaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.04.2021
Sınıf Dana Karkas Arka Çeyrek (But) Alım İşi
Sayın Üyemiz, Et ve Süt Kurumundan Borsamıza gönderilen yazıda; Müdürlüğümüzce e-ihale ile 4734 sayılı Kamu İhale Kanununun 3-g maddesi (istisna)kapsamında; malın bedeli mal tesliminden sonraki 14 iş günü içerisinde ödenmek kaydıyla, Ek-1 de kiteknik şartnameye uygun olarak 65.000 kg Mezbuh Taze Soğutulmuş 1. Sınıf Dana Karkas Arka Çeyrek(but) et alımı yapılması planlanmaktadır. İstekliler, 14.04.2021 Çarşamba saat 16.00 a kadar Et ve Süt Kurumu Sincan Et KombinasıMüdürlüğü / Vakıflar Bankası / Çetinemeç Şubesi IBAN NO: TR84 0001 5001 5800 7293 6199 08numaralı hesaba nakit olarak veya geçici teminat mektubunu yaklaşık ihale bedeli üzerinden % 3 olanbedeli 79,100,00 TL nin altında olmamak kaydıyla geçici teminatlarını vermeleri gerekmektedir.Sözleşme, ekonomik açıdan en avantajlı teklif veren firma ile imzalanacaktır. Sözleşme yapılacakolan firma teklif ettiği bedeli ile 65.000 kg ın çarpımı sonucu ortaya çıkan tutarın %6 sı oranında 3 aysüreli teminat mektubu veya nakit para verecek, ihaleyi alan yüklenici firma sözleşme bedeli üzerindenkarar pulu (binde 5,69) ve damga vergisi (binde 9,48) yatıracaktır.Söz konusu alım işiyle ilgili ihaleye katılmak istemeniz halinde yazımız ekindeki teknikşartnameyi ve sözleşmeyi göz önünde bulundurarak ekte belirtilen belge ve dökümanları 14.04.2021Çarşamba tarihi saat 16:00 a kadar gerek görüldüğünde aslını ibraz etmek kaydıylamgultekin.gulhan@esk.gov.tr mail adresine mail olarak iletmeniz veya Et ve Süt Kurumu Sincan EtKombinası Müdürlüğü ne ulaştırmanız gerekmektedir.Zamanında gönderilmeyen, belge ve dökümanları eksik olan firmalar ihaleye katılamayacaklardır. Bilgisi yer almaktadır. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
14.04.2021
81 İl Valiliğine Kısmi Kapanma Genelgesi Gönderildi
Sayın Üyemiz, İçişleri Bakanlığı tarafından 81 İl ValiliğineKısmi KapanmaGenelgesigönderildi. Genelgede, salgınla mücadele sürecinin temel prensipleri olan temizlik, maske ve mesafe kurallarının yanı sıra hayatın her alanına yönelik uyulması gereken kurallar ve önlemler; Sağlık Bakanlığı ve Koronavirüs Bilim Kurulunun önerileri, Cumhurbaşkanımız Sn. Recep Tayyip Erdoğan’ın talimatları doğrultusunda belirlenerek uygulamaya geçirildiği belirtildi. Genelgede, mutasyona uğrayan Covid-19 virüsünün dünya genelinde hastalığın yayılımını artırdığı, Türkiye’de de özellikle İngiltere varyantı sebebiyle günlük vaka, yoğun bakım ve entübe hasta sayılarında hızlı bir artış yaşandığı ifade edildi. Genelgede 12.04.2021 tarihinde Cumhurbaşkanımız Sn. Recep Tayyip Erdoğan başkanlığında toplanan Cumhurbaşkanlığı Kabinesinde alınan kararlar doğrultusunda14 Nisan 2021 Çarşamba günü saat 19.00’dan itibarenülke genelini kapsayacak şekilde iki haftalık kısmi kapanmaya yönelik alındığı belirtilerek, alınan tedbirler şu şekilde sıralandı: 1. Hafta içerisinde yer alan günlerde (Pazartesi, Salı, Çarşamba, Perşembe ve Cuma) 19.00-­05.00 saatleri arasında, hafta sonları ise Cuma günleri saat 19.00’da başlayıp, Cumartesi ve Pazar günlerinin tamamını kapsayacak ve Pazartesi günleri saat 05.00’de tamamlanacak şekilde sokağa çıkma kısıtlaması uygulanacak. 1.1-Sokağa çıkma kısıtlaması uygulanan süre ve günlerde üretim, imalat, tedarik ve lojistik zincirlerinin aksamaması, sağlık, tarım ve orman faaliyetlerinin sürekliliğini sağlamak amacıyla belirtilen Ek’te belirtilen yerler ve kişiler kısıtlamadan muaf tutulacak. Sokağa çıkma kısıtlamasına yönelik tanınan muafiyetler,daha önce illerimize gönderilen genelgemizle açıkça belirtildiği şekilde muafiyet nedenine ve buna bağlı olarak zaman ve güzergâh ile sınırlı olup, aksi durumlar muafiyetlerin kötüye kullanımı olarak görülerek idari/adli yaptırımlara konu edilecek. Öte yandan yabancılara yönelik sokağa çıkma kısıtlamasına dair muafiyet sadece turistik faaliyetler kapsamında geçici/kısa bir süre için ülkemizde bulunan yabancıları kapsamayacak. İkamet izinliler, geçici koruma statüsündekiler veya uluslararası koruma başvuru ve statü sahipleri dahil olmak üzere turistik faaliyetler kapsamı dışında ülkemizde bulunan yabancılar, sokağa çıkma kısıtlamalarına tabi olacak. 1.2-Sokağa çıkma kısıtlamasının olduğuCumartesi ve Pazar günleri market, bakkal, manav, kasaplar ve kuruyemişçiler 10.00-17.00 saatleri arasında faaliyet gösterebilecek. 65 yaş ve üzeri ile 18 yaş altında bulunanlar hariç,zorunlu ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine en yakın market, bakkal, manav, kasap ve kuruyemişçilere gidip gelebilecek. Aynı saatler arasında market, bakkal, manav, kasap, kuruyemişçiler ve online sipariş firmaları evlere/adrese servis şeklinde de satış yapabilecek. 1.3-Sokağa çıkma kısıtlamasının olduğu Cumartesi ve Pazar günleri ekmek üretiminin yapıldığı fırın ve/veya unlu mamul ruhsatlı iş yerleri ile bu iş yerlerinin sadece ekmek satan bayileri açık olacak. (Bu iş yerlerinde sadece ekmek ve unlu mamul satışı yapılabilecek.). 65 yaş ve üzeri ile 18 yaş altında bulunanlar hariç ekmek ve unlu mamul ihtiyaçlarının karşılanması ile sınırlı olmak ve araç kullanmamak şartıyla (engelli vatandaşlarımız hariç) ikametlerine yürüme mesafesinde olan fırına gidip gelebilecek. Ramazan ayı süresince iftar saati ve hemen öncesinde oluşabilecek pide kuyrukları ve yoğunluğun oluşturacağı riskin önlenmesi amacıyla fırınlardaki özel sipariş üretimi de dahil pide ve ekmek üretimi iftardan 1 saat önce sonlandırılacak ve iftar saatine kadar sadece satış yapılabilecek. İftardan sonra fırınlarda üretim, satış ve diğer hazırlık işlemlerine devam edilebilecek. Fırın ve unlu mamul ruhsatlı işyerlerine ait ekmek dağıtım araçlarıyla sadece market ve bakkallara ekmek servisi yapılabilecek, ekmek dağıtım araçlarıyla sokak aralarında kesinlikle satış yapılmayacak. 1.4-Sokağa çıkma kısıtlamasındaki sürelere uymak için tüm işyerlerinin (istisna getirilenler hariç) çalışma saatleri hafta içi günlerde 07.00-18.00 saatleri arası olarak belirlenecek. Zincir marketler ise saat 10.00’da açılacak. 2.Hafta içi günlerde;65 yaş ve üzeri vatandaşlarımız 10.00-14.00, 18 yaş altı gençler ve çocuklarımız ise 14.00-18.00 saatleri arasında sokağa çıkabilecekolup, bu saat aralıkları dışında sokağa çıkmayacak. Hafta içi/hafta sonu ayrımı olmaksızın 65 yaş ve üzeri vatandaşlarımız ile 18 yaş altı gençler ve çocuklarımızın şehir içi toplu ulaşım araçlarını (metro, metrobüs, otobüs, minibüs, dolmuş vb.) kullanmalarına müsaade edilmeyecek. Milli Eğitim Bakanlığınca yüz yüze eğitimin devamına karar verilen sınıf seviyeleri ile destekleme ve yetiştirme kursları/takviye kurslarında eğitim gören 18 yaş altı gençlerimiz, durumlarını belgelendirmeleri şartıyla toplu ulaşım araçlarından istifade edebilecek. 3. Sokağa çıkma kısıtlaması uygulanan süre ve günlerde (hafta içi ve hafta sonunda) zorunlu haller dışında vatandaşlarımızın toplu ulaşım vasıtaları dışında şehirlerarası seyahatlerine izin verilmeyecek. 3.1-Herhangi bir zorunlu hali bulunmayan kişilerin sokağa çıkma kısıtlaması uygulanan süre ve günlerdeki şehirlerarası seyahatleri ancak toplu ulaşım araçları (uçak, otobüs, tren, gemi vb.) kullanılmak suretiyle mümkün olacak. İşi ile ilgili illiyetini belgeleyen toplu ulaşım araçlarının görevlileri ile şehirlerarası seyahat edeceğini bilet, rezervasyon kodu vb. ile ibraz eden kişiler sokağa çıkma kısıtlamasından muaf olacak. 3.2-Zorunlu Haller Sayılacak Durumlar; Tedavi olduğu hastaneden taburcu olup asıl ikametine dönmek isteyen, doktor raporu ile sevk olan ve/veya daha önceden alınmış doktor randevusu/kontrolü olan, Kendisi veya eşinin, vefat eden birinci derece yakınının ya da kardeşinin cenazesine katılmak için veya cenaze nakil işlemine refakat edecek olan (en fazla 8 kişi), Bulunduğu şehre son 5 gün içerisinde gelmiş olmakla beraber kalacak yeri olmayıp ikamet ettikleri yerleşim yerlerine dönmek isteyen (5 gün içinde geldiğini yolculuk bileti, geldiği araç plakası, seyahatini gösteren başkaca belge, bilgi ile ibraz edenler), ÖSYM tarafından ilan edilen ve diğer merkezi sınavlara katılacaklar ve refakatçileri, Askerlik hizmetini tamamlayarak yerleşim yerlerine dönmek isteyen, Özel veya kamudan günlü sözleşmeye davet yazısı olan, Ceza infaz kurumlarından salıverilen, Belirtilen bu durumların varlığı halinde toplu ulaşım araçlarıyla veya İçişleri Bakanlığına ait E-BAŞVURU ve ALO 199 sistemleri üzerinden ya da Valilik/Kaymakamlıklara doğrudan başvuru yoluyla Seyahat İzin Kurullarından izin almak kaydıyla özel araçlarıyla seyahat edebilecek. 3.3-Sokağa çıkma kısıtlaması uygulanan süre ve günlerdeki şehirlerarası seyahat kısıtlamasının etkinliğinin artırılması amacıyla şehirlerin tüm giriş ve çıkışlarında (iller arası koordinasyon sağlanmak kaydıyla) kontrol noktaları oluşturulacak. Özel araçlarla seyahat edenlerin muafiyet kapsamında olup olmadıkları muhakkak tetkik edilecek ve geçerli bir mazereti/muafiyeti bulunmayan kişilerin şehirlerarası seyahatlerine izin verilmeyecek. 4. 16 Mayıs 2021 Pazar günü saat 24.00’e kadar yeme-içme yerleri (restoran, lokanta, kafeterya, pastane, tatlıcı gibi yerler) işyerlerinin iç veya dış alanlarında masada müşteri kabul edemeyecek. Bu süre içerisinde yeme-içme yerleri hafta içi günlerde 07.00-19.00 saatleri arasında gel-al ve paket servis, saat 19.00’dan sahur vaktine kadar sadece paket servis, Cumartesi ve Pazar günleri ise sabah 10.00’dan sahur vaktine kadar sadece paket servis şeklinde faaliyet gösterebilecek. Aynı şekilde online yemek sipariş firmaları hafta içi ve hafta sonlarında saat 10.00’dan sahur vaktine kadar evlere/adrese paket servis şeklinde satış yapabilecek. 5.Aşağıda belirtilen işyerlerinin faaliyetlerine 17 Mayıs 2021 Pazartesi gününe kadar geçici olarak ara verilecektir. Halı saha, yüzme havuzu, spor salonu, güzellik merkezi/salonları, hamam ve saunalar, lunaparklar ve tematik parkları, Kahvehane, kıraathane, kafe, dernek lokali, çay bahçesi gibi yerler, İnternet kafe/salonu, elektronik oyun yerleri, bilardo salonu gibi yerler. Çay ocakları ise masa, sandalye/taburelerini kaldırmak ve sadece esnafa servis yapmak kaydıyla faaliyetlerine devam edebilecek. 6.17 Mayıs 2021 tarihine kadar sivil toplum kuruluşları, kamu kurumu niteliğindeki meslek kuruluşları ve bunların üst kuruluşları ile birlikler ve kooperatiflerin genel kurul dahil yapacakları geniş katılımlı her türlü etkinliklerine izin verilmeyecek. 7.Evlendirme işlemlerinin gerçekleştirilmesine devam edilmekle birlikte nikah ve nikah merasimi şeklindeki düğünler, 17 Mayıs 2021 tarihinden itibaren yapılabilecek. Bu süreye kadar herhangi bir şekilde nişan, kına, tören, merasim, düğün yapılmasına müsaade edilmeyecek. 8.Şehir içi toplu ulaşım araçlarında; Oturma kapasitesi % 50 ile sınırlandırılacak, Minibüs/midibüsler ile koltuk kapasitelerinde herhangi bir seyreltme ve kaldırılma yapılmayan otobüsler gibi iç hacim bakımından fiziki mesafe kurallarının uygulanamayacağı şehir içi toplu ulaşım araçlarında ayakta yolcu alınmasına müsaade edilmeyecek, Bunların dışında kalan raylı sistem araçları (metro, tramvay vb.), metrobüsler ve koltuk kapasiteleri seyreltilmiş/kaldırılmış otobüsler gibi ayakta yolcu taşıma ağırlıklı toplu ulaşım araçlarında; fiziki mesafe kurallarına aykırı olmayacak şekilde hangi oranda/sayıda ayakta yolcu alınabileceği il/ilçe umumi hıfzıssıhha kurulları tarafından tespit edilecek. Raylı sistem araçları (metro, tramvay vb.), metrobüsler ve koltuk kapasiteleri seyreltilmiş/kaldırılmış otobüslerde ayakta alınabilecek yolcu sayısını belirtir levha/tabela herkesin görebileceği şekilde asılacak ve ayaktaki yolcuların durabileceği yerler fiziki olarak işaretlenmek suretiyle belirlenecek. 9.Huzurevi, yaşlı bakımevi, rehabilitasyon merkezi, çocuk evleri gibi sosyal koruma/bakım merkezlerinde 17 Mayıs 2021 tarihine kadar ziyaretçi kabul edilmeyecek. 10.Turistik tesisler dahil tüm konaklama tesislerinin (otel, motel, apart otel, pansiyon vb.) içerisinde bulunan yeme-içme yerleri, sadece konaklamalı müşterilerle sınırlı olmak ve aynı masada en fazla 2 kişiye servis açılmaması kaydıyla hizmet verebilecek. Konaklama tesislerinde kesinlikle toplu iftar organizasyonları yapılmayacak. Daha önce illere gönderilen genelgeler doğrultusunda konaklama tesislerinin denetimleri etkin şekilde sürdürülecek, sahte rezervasyon başta olmak üzere her türlü kötüye kullanımın önüne geçilecek. 11.Çeşitli işyerleri tarafından açılış nedeniyle veya belirli gün ya da saatlere özgü yapılan indirim uygulamaları kontrolsüz şekilde kalabalıkların oluşmasına neden olabilmekte. Bu sebeple işyerleri tarafından açılış nedeniyle veya belirli gün ya da saatlere özgü genel indirim uygulamalarının yerine yoğunluğun önüne geçilebilmesi için en az bir hafta sürecek şekilde uzun periyodlarla indirim uygulamaları yapılacak. 12.Cumhurbaşkanlığının 2021/8 sayılı Genelgesi doğrultusunda kamu kurum ve kuruluşlarında uzaktan ve/veya dönüşümlü çalışma gibi esnek çalışma yöntemlerinden azami düzeyde istifade edilecek.İdari izin kapsamındaki personele (hamile çalışanlar, süt izni kullananlar, 10 yaş ve altında çocuğu olan kadın çalışanlar, engelli çalışanlar, 60 yaş üzerindeki personel, kronik rahatsızlığı bulunanlar) kolaylık gösterilecek ve kamuda mesai saatlerinin başlangıç ve bitiş saatlerinin 10.00-16.00 olarak uygulanması sağlanacak. Çalışma koşulları, şartları ve imkanları uygun olan özel sektör firmalarında da esnek çalışma yöntemlerine geçilmesi teşvik edilecek. 13.Daha önce illere gönderilen genelge ile tüm kara, deniz ve hava sınır kapılarımızdan 15 Nisan 2021 tarihine kadar ülkemize giriş yapmak isteyen kişilerden son 72 saat içerisinde yapılmış negatif SARS-CoV-2 PCR testi sonucu ibrazı zorunluluğu 31 Mayıs 2021 tarihine kadar devam ettirilecek. Negatif SARS-CoV-2 PCR testi sonucu ibraz edemeyen kişilere uygulanacak karantina koşullarına ilişkin iş ve işlemler daha önceden yayımlanmış olan genelgelerimize göre yerine getirilecek. Yukarıda belirtilen esaslar doğrultusunda Umumi Hıfzıssıhha Kanununun 27’nci ve 72’nci maddeleri uyarınca İl/İlçe Umumi Hıfzıssıhha Kurulları kararlarının ivedilikle alınacak. Uygulamada herhangi bir aksaklığa meydan verilmeyecek ve mağduriyete neden olunmayacak. Eskişehir Ticaret Borsası
14.04.2021
Et ve Süt Kurumu Piyasa Araştırması
Sayın Üyemiz, Et ve Süt Kurumundan Borsamıza gelen yazıda; Kombina Müdürlüğümüzce Ek (1) de teknik şartname esaslarına uygun 65.000 kg Mezbuh TazeSoğutulmuş Dana Arka Çeyrek (but) Eti alımı planlanmaktadır. Söz konusu alım için yaklaşık maliyet hesaplamasında kullanılacak serbest piyasa birimfiyatlarınızı 13.04.2021 Salı saat 14:00 a kadar 0 (312) 270 42 14 numarasına fax olarak veyamgultekin.gulhan@esk.gov.tr mail adresine, Ek (2) de bulunan birim fiyat cetveline bedel, rakam veyazı birbirine uygun olarak açıkça yazılarak, üzerinde kazıntı, silinti ve düzeltme yapılmadan, kaşe veimzalı bir şekilde gönderilmesi hususunda; Konu ile ilgilenen üyelerimizin bilgisine, Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
13.04.2021
Connecting Eurasia: Smart Ports and Rail Forum
Sayın Üyemiz, A.B.D. Büyükelçiliği Ticaret Müsteşarlığı tarafından 27-28-29 Nisan 2021 tarihlerinde Azerbaycan, Gürcistan ve Türkiye deki demiryolu ve liman altyapıları için A.B.D li firmaların teknolojilerini, A.B.D ve uluslararası finansman kurumlarının ise finans araçlarını sunacağı "Connecting Eurasia: Smart Ports and Rail Forum isimli sanal etkinliğin gerçekleştirileceği bildirilmektedir. Etkinliğe ilişkin detaylı bilgi ve kayıt linkleri ekte sunulmakta olup, daha fazla bilgi için ABD Ticaret Müsteşarlığı Ticaret Ataşe Yardımcısı Naz Demirdöven ile Naz.Demirdoven@trade.gov adresinden iletişime geçilmesi mümkündür. Ayrıntılı bilgi ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
13.04.2021
IKBY İle Karşılıklı Ticari Temaslar
Sayın Üyemiz, Ticaret Bakanlığı nın kayıtlı yazılarında;  Irak ın ülkemizin geleneksel ihracat pazarları arasında en üst sıralarda yer aldığı,  Ülkemizin Irak a yaptığı ihracatın büyük bir kısmının karayolu ile Irak Kürt Bölgesel Yönetimi (IKBY) üzerinden Irak ın farklı bölgelerine taşınmakta veya IKBY içerisinde kalmakta olduğu,  Irak ile ticari ilişkilerimizin devam ettiği İbrahim Halil sınır kapısının da fiili olarak IKBY kontrolü altında bulunduğu bildirilmekte olup; kamu gelirleri ve ekonomik büyümesi büyük ölçüde petrol fiyatları ve gelirlerine bağlı olan IKBY ekonomisinin, petrol fiyatlarının son dönemde beklenenin üzerinde artmasıyla 2021 yılında ve pandemi sonrası süreçte toparlanma göstermesinin beklendiği bildirilmektedir. Bu çerçevede ilgide kayıtlı yazılarda;  Ülkemiz iş dünyasının IKBY iş insanları ve resmi iş kuruluşları ile sıcak temasının önemli olduğu ve önümüzdeki dönemlerde bu temasların gerek iş ziyaretleri gerekse nezaket ziyaretleri ile devam etmesinin ikili ticari ilişkilerimiz açısından faydalı olabileceği,  Başta IKBY Ticaret Odaları olmak üzere, ilgili IKBY kurum ve kuruluşları ile Irak iş çevreleri ile yapılan düzenli görüşmelerden, Türkiye den gelen iş heyetlerinin ve üst düzey ticari ziyaretlerin IKBY iş çevrelerinde memnuniyet yarattığı,  Irak ile ticaret ve turizm hacminin fazla olduğu şehirlerimizden başta İstanbul, Ankara, Bursa ve İzmir Ticaret ve Sanayi Odalarının IKBY yi ziyaret etmesinin yararlı olabileceği, bu yönde Erbil Ticaret Odası tarafından da mezkur illerle ilgili bir beklenti bulunduğu,  Bu ziyaretler ile beraber oluşturulacak taslak bir program kapsamında ilerleyen dönemlerde sonuç odaklı etkinlik/zirve/sektörel çalıştaylar yapılmasının faydalı olacağı değerlendirilmektedir. Diğer yandan, bu kapsamda düzenlenecek faaliyetlerin Ticaret Bakanlığı na iletilmek üzere Borsamıza (eskisehirtb@gmail.com) bildirilmesi önem arz etmektedir. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
8.04.2021
Moldova Ticaret Forumu Daveti
Sayın Üyemiz, Moldova Ticaret Forumu 2021 in, internet üzerinden, 28-30 Nisan 2021 tarihlerinde gerçekleştirileceği bildirilmektedir. 300 e yakın Moldovalı firmanın katılımının beklendiği etkinliğe kayıt için https://moldova-trade-forum.b2match.io/home adresi ziyareti edilmelidir. Etkinlikte yerel ve Avrupa pazarından yeni işbirliği imkanları bulma ve firmalar ile ikili görüşmeler gerçekleştirme fırsatları sağlanacaktır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
6.04.2021
Kişisel Verilerin Korunması Mevzuatına Uyum Eğitimi
Sayın Üyemiz, KOBİ yöneticileri ve çalışanlarına yönelik olarak internet üzerinden, Kişisel Verilerin Korunması Mevzuatına Uyum Eğitimi gerçekleştirilecektir. Eğitime ilişkin detaylı bilgi ekte sunulmaktadır. TOBB Ekonomi ve Teknoloji Üniversitesi Sürekli Eğitim ve Araştırma ve Uygulama Merkezi tarafından gerçekleştirilecek "Kişisel Verilerin Korunması Mevzuatına Uyum Eğitimi" başlıklı eğitimden; gerek çalışanlarının gerek müşterilerinin ve temasta bulunun diğer kişilerin kişisel verilerini mevzuata uygun şekilde işlemek isteyen şirket sahip ve yöneticileri bu eğitimden faydalanabilecektir. Eğitim sonunda katılımcılar kişisel verilerin korunması hukukunun temel kavramlarını, Kanun un getirdiği yeni koruma mekanizmasının işleyişini, riskleri, fırsatları, veri işleme faaliyetinde sorumluluğun ne şekilde işlediğini, verisi işlenenlerin haklarını, hak arama usulünü, kişisel verileri koruma envanterinin ne olduğunu, VERBİS e kayıt, aydınlatma, kişisel veri koruma politikası hazırlama gibi mutlaka yerine getirilmesi gereken çeşitli aşamaları öğrenmiş, farkındalık sahibi olmuş olurlar. Eğitim sonunda katılımcılara soru-cevap imkanı verilecektir. Eğitimin % 70 ine devam eden katılımcılar adına dijital doğrulanabilir katılım belgesi hazırlanacak ve e-posta adreslerine gönderilecektir. Ayrıntılar ekte bilgilerinize sunulmuştur. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
6.04.2021
TARSİM Son Kabul Tarihleri
Sayın Üyemiz, "Tarım Sigortaları Havuzu Tarafından 2021 Yılında Kapsama Alınacak Riskler,Kararın Ürünler ve Bölgeler ile Prim Desteği Oranlarına İlişkin (Karar Sayısı: 3205) 1 inci maddesinin 3üncü fıkrasında; "çiftçi kayıt sistemine (ÇKS) kayıtlı çiftçilerin özlük, ürün ve arazi bilgileri, dikkatealınarak Tarım Sigortaları havuzu tarafından teminat altına alınırlar" denilmekte olup, bölgemiz içinönemli olan ürünler (Arpa, Buğday, Yulaf, Tritikale, Çavdar, Mısır, vb.) için Tarsim sigortasıyaptırmak isteyen çiftçilerimizin, son kabul tarihlerinden önce, ÇKS dosyalarının Tarım BilgiSistemi (TBS) ne girilebilmesi için, İlçe Müdürlüğümüze ÇKS dosyalarını en az üç (3) gün öncedenteslim etmeleri gerekmektedir. Eskişehir İli Odunpazarı na ait ürünleri içeren (Ek) listede yadahttps://web.tarsim.gov.tr/havuz/ internet sitesinde duyurular kısmında "son kabul tarihleri" yeralmaktadır. Üyelerimize duyurulur. Saygılarımızla, Gültekin GÜLER Genel Sekreter
6.04.2021